Anda di halaman 1dari 11

Instituto Politcnico Nacional.

Unidad Profesional Interdisciplinaria de Biotecnologa.

Ingeniera Enzimtica.

Produccin de fosfatasa alcalina para diagnostico


medico de cncer

Grupo: 4BV1
Equipo:
Integrantes:
Garca Schacht Brenda Lizeth
Zamora Zecua Leonardo
Profesor:
M. en C. David Lule Chable

Fecha de entrega: 10 de marzo del 2016

Contenido
INTRODUCCIN.............................................................................................. 2
DESARROLLO.................................................................................................. 2
CONCLUSIN.................................................................................................. 4
Estructura 1ria 2ria 3ria y 4ria.......................................................................4
Dominios de la enzima................................................................................... 4
Secuencia gentica........................................................................................ 4
Condiciones optimas...................................................................................... 4
A.E. vs Temp & A.E. vspH............................................................................ 4
Sustratos, cofactores, coenzimas productos..................................................4
Tipo de inhibicion e inhibidores......................................................................4
Parametros cineticos Km y Vmax teoricos.....................................................4
Definicion de su actividad enzimatica............................................................4
Cmo se mide experimentalmente su A.E......................................................4
Referencias..................................................................................................... 5

Proyecto 2do Parcial

Estructura 1ria 2ria 3ria y 4ria


Para profundizar en el conocimiento de la Fosfatasa alcalina placentaria se
utilizaron herramientas bioinformticas para obtener informacin confiable.
La fosfatasa alcalina placentaria pertenece al grupo de las fosfatasa
alcalinas 3.1.3.1, es una enzima hidrolasa responsable de eliminar grupos
de fosfatos de varios tipos de molculas como nucletidos, protenas y
alcaloides. El proceso de eliminar el grupo se denomina desfosforilacin.
Como sugiere su nombre, recibe el nombre de orto-fosfrico-monoster
hidrolasa.
ESTRUCTURA PRIMARIA
Para comenzar la caracterizacin de la Fosfatasa Alcalina placentaria, se
accedi a la pgina de NCBI y se eligi la opcin de protena; una vez dentro
de la pgina, se localiz la secuencia de nucletidos correspondiente al
ARNm de la fosfatasa alcalina humana tipo 1. Posteriormente se tradujo con
ayuda de la herramienta ExPASy traslate para obtener la estructura primaria
correspondiente a la secuencia de aminocidos.
Como resultados se obtuvo una gran cantidad de datos los cuales se dividen
en de acuerdo al marco abierto de lectura que presentan y resaltando en
rojo las secuencias peptdicas de importancia. Se eligi la ms larga que
contiene 535 aminocidos, que corresponde al pptido enzimtico antes de
ser modificado.
MGVSTVTAARIL
KGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAA
ARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVP
ASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQ
EWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAA
LRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVT
ADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESG
SPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEPYTACD
LAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP

ESTRUCTURA SECUNDARIA
Con ayuda de otra herramienta bioinformtica se proces la secuencia de
aminocidos elegida y se obtuvo un anlisis de la estructura secundaria
debida a las interacciones entre aminocidos. El anlisis indica la presencia
dominante de estructuras -hlices seguidas de lminas beta formando a lo
largo del polipeptido con 3 giros importantes en la estructura final y 479
residuos expuestos.

Estructura Terciaria
Las fosfatasas alcalinas existen en forma de dmero, cada monmero se
presenta unido a 2 tomos de Zinc y un tomo de Magnesio. El sitio activo
de cada monmero se encuentra entre los aminocidos 111-119 donde
dentro de la estructura se encuentran 2 tomos de Zinc y la Arginina 166.

Localizacin del sitio activo en el pptido del monmero de la fosfatasa


alcalina placentaria obtenido de el algoritmo de The protein model portal.
La dimerizacin de los monmeros es mediante interacciones que son
especficas de acuerdo a la especie perteneciente de la fosfatasa. En estas
interacciones se forman uniones Van der Waals remplazando a puentes de
hidrgeno.

Modelo 3D de la Fosfatasa Alcalina placentaria, A): El monmero simple, B):


El monmero con los iones metlicos presentes, C): Modelo de la interaccin
de monmeros durante la dimerizaci

ESTRUCTURA CUATERNARIA
Por ltimo, se accedi a la base de datos Protein Data Bank donde se
encontr el modelo de la estructura cuaternaria de la enzima, la cual fue
cristalizada y conservada con L-Fenilalania para su estudio.

Vista estructura cuaternaria 3D. A) Vista de frente, B) Vista lado izquierdo,


C) Vista por detrs y D) Vista por lado derecho. En las distintas imgenes se
pareca el dmero presentando estructuras laminas beta en amarillo y las
alfa hlices en rosa. Las regiones de residuos en color blanco y los iones
metlicos en forma molecular

Dominios de la enzima
Como tal todo el polipeptido forma un monmero que corresponde a un
dominio de la enzima, esto es debido a que como se observa en la imagen
el polipeptido presenta varias estructuras en toda la estructura.

Secuencia gentica
Obtenida de NCBI correspondiente al ARNm que codifica a la fosfatasa
alcalina humana tipo 1
GCATGTCTGGAGGGCATCATCCCAGTTGAGGAGGAGAACCCGGACTTCTGGAACCGCGAGGCAGCCGAGG
CCCTGGGTGCCGCCAAGAAGCTGCAGCCTGCACAGACAGCCGCCAAGAACCTCATCATCTTCCTGGGCGA
TGGGATGGGGGTGTCTACGGTGACAGCTGCCAGGATCCTAAAAGGGCAGAAGAAGGACAAACTGGGGCCT
GAGATACCCCTGGCCATGGACCGCTTCCCATATGTGGCTCTGTCCAAGACATACAATGTAGACAAACATG
TGCCAGACAGTGGAGCCACAGCCACGGCCTACCTGTGCGGGGTCAAGGGCAACTTCCAGACCATTGGCTT
GAGTGCAGCCGCCCGCTTTAACCAGTGCAACACGACACGCGGCAACGAGGTCATCTCCGTGATGAATCGG
GCCAAGAAAGCAGGGAAGTCAGTGGGAGTGGTAACCACCACACGAGTGCAGCACGCCTCGCCAGCCGGCA
CCTACGCCCACACGGTGAACCGCAACTGGTACTCGGACGCCGACGTGCCTGCCTCCGCCCGCCAGGAGGG
GTGCCAGGACATCGCTACGCAGCTCATCTCCAACATGGACATTGACGTGATCCTAGGTGGAGGCCGAAAG
TACATGTTTCGCATGGGAACCCCAGACCCTGAGTACCCAGATGACTACAGCCAAGGTGGGACCAGGCTGG
ACGGGAAGAATCTGGTGCAGGAATGGCTGGCGAAGCGCCAGGGTGCCCGGTATGTGTGGAACCGCACTGA
GCTCATGCAGGCTTCCCTGGACCCGTCTGTGACCCATCTCATGGGTCTCTTTGAGCCTGGAGACATGAAA
TACGAGATCCACCGAGACTCCACACTGGACCCCTCCCTGATGGAGATGACAGAGGCTGCCCTGCGCCTGC
TGAGCAGGAACCCCCGCGGCTTCTTCCTCTTCGTGGAGGGTGGTCGCATCGACCATGGTCATCATGAAAG
CAGGGCTTACCGGGCACTGACTGAGACGATCATGTTCGACGACGCCATTGAGAGGGCGGGCCAGCTCACC
AGCGAGGAGGACACGCTGAGCCTCGTCACTGCCGACCACTCCCACGTCTTCTCCTTCGGAGGCTACCCCC
TGCGAGGGAGCTCCATCTTCGGGCTGGCCCCTGGCAAGGCCCGGGACAGGAAGGCCTACACGGTCCTCCT
ATACGGAAACGGTCCAGGCTATGTGCTCAAGGACGGCGCCCGGCCGGATGTTACCGAGAGCGAGAGCGGG
AGCCCCGAGTATCGGCAGCAGTCAGCAGTGCCCCTGGACGAAGAGACCCACGCAGGCGAGGACGTGGCGG
TGTTCGCGCGCGGCCCGCAGGCGCACCTGGTTCACGGCGTGCAGGAGCAGACCTTCATAGCGCACGTCAT
GGCCTTCGCCGCCTGCCTGGAGCCCTACACCGCCTGCGACCTGGCGCCCCCCGCCGGCACCACCGACGCC
GCGCACCCGGGGCGGTCCGTGGTCCCCGCGTTGCTTCCTCTGCTGGCCGGGACCCTGCTGCTGCTGGAGA
CGGCCACTGCTCCCTGAGTGTCCCGTCCCTGGGGCTCCTGCTTCCCCATCCCGGAGTTCTCCTGCTCCCC
ACCTCCTGTCGTCCTGCCTGGCCTCCAGCCCGAGTCGTCATCCCCGGAGTCCCTATACAGAGGTCCTGCC
ATGGAACCTTCCCCTCCCCGTGCGCTCTGGGGACTGAGCCCATGACACCAAACCTGCCCCTTGGCTGCTC
TCGGACTCCCTACCCCAACCCCAGGGACTGCAGGTTGTGCCCTGTGGCTGCCTGCACCCCAGGAAAGGAG
GGGGCTCAGGCCATCCAGCCACCACCTACAGCCCAGTGGGTACCAGGCAGGCTCCCTTCCTGGGGAAAAG
AAGCACCCAGACCCCGCGCCCCGCTGATCTTTGCTTCAGTCCTTGAATCACCTGTGGGACTTGAGGACTC
GGGATCTTCAGGACGCCTGGAGAAGGGTGGTTTCCTGCCACCCTGCTGGCCAAGGAGGCTCCTGGGGTGG
GGATCACCAGGGGGATTTTGACACAGCCTTCGGCTGCCCCCCACTAAGCTAATTCCACACCCCTGTACCC
CCCCAGGGGGCCCTCTGCCTCATGGCAAAGGCTTGCCCCAAATCTCAACTTCTCAGACGTTCCATACCCC
CACATGCCAATTTCAGCACCCAACTGAGATCCGAGGAGCTCCTGGGAAGCCCTGGGTGCAGGACACTGGT
CGAGAGCCAAAGGTCCCTCCCCAGACATCTGGACACTGGGCATAGATTTCTCAAGAAGGAAGACTCCCCT
GCCTCCCCAGGGCCTCTGCTCTCCTGGGAGACAAAGCAATAATAAAAGGAAGTGTTTGTAATCCCAGCAC
TTTGGGAGGCCGAGGTGGGCGGATCACGAGGTCAGGAGATGGAGACCATCCTGGCTAACACGGTGAAACC
CCTTATCTATGCGCCTGTAGTCCCAGCTACCCAGGAGGCTGAAGCAGGATAATCGCTTGAACCCGGGCGG
CGGAGATTGCAGTGAGCCGAGGTCATGCCACTGCACTGCAGCCTGGGCGACAGAGCGAGATTCTGCCTCA
AAAATAAAC

Condiciones ptimas
Todas las iso-enzimas tienen un pH ptimo (9-10) similar afinidad por los
sustratos, y son metaloprotenas dependientes de zinc y magnesio.
Temperatura 37C.

A.E. vs Temp &

A.E. vs pH
En un estudio hecho por Herman
Van Belle. (1976), se consider
para el experimento un rango de
tmperatura de 30-58 C y lo
experimentos fueron llevados a
30C. Puede observarse que el pH
ptimo es con el buffer de etanol
amida a pH 10.3 +/- 0.1 en una
concentracin de 0.9 mol/L.
La actividad enzimtica alcanzada

llega a las 370 U/L

Sustratos, cofactores, coenzimas productos


La fosfatasa alcalina presenta hidrolisis en su mayora aunque llega a
presentar actividad de trans-fosforilacin. El sustrato principal de la
hidrolasa alcalina placentaria son los fosfatos mono ster alcalinos aunque
se ha encontrado actividad con glicerol fosfatos.
La fosfatasa alcalina es una metal-enzima la cual requiere a Mg 2+ y Zn2+
como cofactores.

Tipo de inhibicin e inhibidores


El aminocido L-fenilalanina es inhibidor no competitivo y estereoespecfico
de las isoenzimas de fosfatasa alcalina de manera diferencial cuando se
encuentra en concentraciones entre 5 y 10 mM. Estudios realizados
empleando homogenados de tejido heptico, seo e intestinal demostraron
que la isoenzima intestinal es la ms afectada por este inhibidor (actividad
remanente: isoenzima intestinal 5%, sea 74.5%, heptica 74.5%) [7,8,9].
Resultados similares se han hallado con el L-triptfano. Con concentracin
de 3 mM de este inhibidor las isoenzimas intestinal y placentarias se

inhibieron aproximadamente un 70%, mientras que las isoenzimas sea y


heptica sufren menos del 25% de inhibicin [10]. A diferencia de Lfenilalanina, el levamisole (5-20 mM), el L-p-bromotetramisol (0.10-0.27
mM) y la Lhomoarginina (8 mM), actan inhibiendo predominantemente las
isoenzimas sea, heptica y renal. Con el primero la actividad remanente de
la misma ronda, segn la concentracin utilizada, entre 0.7 y 2% mientras
que las isoenzimas de intestino y placenta presentan una actividad
remanente entre 47% y 75%. El L-pbromotetramisol muestra 3-10% de
actividad remanente para las isoenzimas tejido no especficas, con un 8290% para las isoenzimas de intestino y placenta [11,12,13,14]. Las
isoenzimas sea y heptica son relativamente inestables a la temperatura
(15 min 56C) y a la desnaturalizacin por urea (1.3 - 3 M) y clorhidrato de
guanidina (0.3 M) [15,16,17].

Parametros cineticos Km y Vmax tericos


Representacin de la velocidad frente al cociente v/[S].
(Representacin de Eadie-Hofstee)
Datos obtenidos en el experimento por Jos Antonio Brcena Ruiz,
Concepcin Garca Alfonso, Carmen Alicia Padilla Pea, Emilia Martnez
Galisteo, Jess Dez Dapena (Laboratorio de Biologa sea y Metabolismo
Mineral Facultad Cs. Mdicas - UNR - Rosario Argentina):

Clculo de Vm y Km mediante las representaciones de EadieHofstee

Definicin de su actividad enzimtica.


La fosfatasa alcalina hidroliza el 1 mol de mono ster por U de fosfatasa
alcalina. ya que la enzima solo presenta un sitio activo. Todo esto a
condiciones optimas.

Cmo se mide experimentalmente su A.E.


La fosfatasa alcalina (Ortofosfrico monoster fosfohidrolasa, (EC 3.1.3.1) es
una enzima ampliamente distribuida que hidroliza (3) el enlace ster (1)
fosfrico entre un grupo fosfato y un radical orgnico a pH bsico (pH
ptimo entre 9 y 10) liberando fosfato inorgnico.

Como sustrato de la fosfatasa alcalina utilizaremos un compuesto artificial:


p-Nitrofenil-fosfato que, al poseer un resto orgnico con un grupo fosfato
unido, puede ser reconocido por la enzima. El sustrato al ser hidrolizado
origina un producto, el p-Nitrofenol, compuesto coloreado que en solucin
alcalina absorbe a una longitud de onda de 405 nm, por lo que su aparicin
en el transcurso de la reaccin, puede seguirse colorimtricamente. Para
detener la reaccin se aadir fosfato, ya que el exceso de este producto de
la reaccin inhibe la actividad enzimtica.
Equipamiento
Bao termostatizado a 30C.
Colormetro ajustado a 405 nm (fototubo normal).
Material

Pipetas de vidrio (5,0 ml).


Pipeta automtica P-1000 (puntas).
Propipeta.
Rotulador para vidrio.
Tubos de ensayo de vidrio (1,5x 16 cm) 16 en una gradilla.
Cronmetro.
Tubos especiales para medir en el colormetro.
Reactivos
Tampn de ensayo.
Solucin sustrato.
Enzima: fosfatasa alcalina de mucosa intestinal bovina.
Solucin para detener la reaccin.

Mtodo
A 5 tubos de ensayo y se aaden los reactivos que se detallan en la Tabla 1.
Se agitan suavemente e incuban en bao termostatizado a 30 C los
tiempos indicados.

A medida que se cumplen estos tiempos, se retira el tubo correspondiente


del bao a 30 C y se le aade inmediatamente 1 ml de fosfato mezclando
las soluciones para detener la reaccin.
A continuacin se mide la absorbancia a los distintos tubos a 405 nm
usando el n 1 como blanco.

Referencias
Juan Antonio Vlchez Aguilera, 2011. Isoenzima de fosfatasa alcalina
placental-like, importancia clnica como marcador en tumores de tipo
germinal. Servicio de Anlisis Clnicos, Hospital Universitario Virgen de la
Arrixaca, Murcia, Espana.
Laura A. Palomares, 2001. Aplicaciones de la Bioingeniera en la
produccin de portenas recombinantes por clulas de insecto. Instituto
de Biotecnologa, UNAM.
Laura A. Palomares et al. 2003. Novel Insect Cell Line capable of complex
N-glicosylation and sialytion of recombinant proteins. School of Chemical
and Biomolecular Engineering and the Boyce Thompson Institute, Cornell
University and Instituto de Biotecnologa UNAM.
Herman Van Belle. (1976). Alkaline Phosphatase. I. kinetics and inhibition
by levamisole of
Berk P, Korenblat K. Approach to the patient with jaundice or abnormal
liver tests. In: Goldman L, Schafer AI, eds. Cecil Medicine. 24th ed.
Philadelphia, Pa: Saunders Elsevier; 2011:chap 149.
American Cancer Society. (2016). Cncer de hgado. 08/03/2016, de
American
Cancer
Society
Sitio
web:
http://www.cancer.org/acs/groups/cid/documents/webcontent/002309pdf.pdf
Caracterizacin electrofortica y cintica de las isoenzimas oseas,
heptica e intestinal de fosfatasa alcalina de rata, Cecilia Guglielmi,
Laboratorio de Biologa sea y metabolismo mineral Facultad CS.
Mdicas - UNR - rosario argentina.

http://www.ebi.ac.uk/
http://www.ncbi.nlm.nih.gov/
http://www.expasy.org/
http://www.proteinmodelportal.org/
http://www.rcsb.org/pdb/home/home.do