Anda di halaman 1dari 29

BABI

Pendahuluan

Menurut International Task Force on HepatitisB Immunization. Indonesia


termasukdlamkelompokendemissedangdantinggihepatitisB,denganprevalensidi
populasi 7%10%. Setidaknya 3,9 % ibu hamil di Indonesia merupakan pengidap
hepatitisdneganrisikopenularanmaternalkuranglebih45%.Saatinidiperkirakan
terdapatlebihdari11jutapengidappenyakitHepatitisBdiIndonesia. DiNegara
denganprevalensihepatitisBredahsebagianbesarpengidapberusia2040tahun,
sedangkan dinegara dengan prevalensi hepatitis B tinggi sebagian besar pengidap
merupakananakanak.
Risikoterjadinyahepatitisbjauhlebihbesar(90%)bilainfeksiterjadipada
awal kehidupan dibandingkan dengan infeksi yang terjadi pada usia dewasa.
Sementarainfeksipadamasadewasamudabiasanyamenimbulkanhepatitisyangakut
secarakliniktetapiriskomenjadikronikhanya12%.Transmisiverticaltergantung
dari umur kehamilan saan terinfeksi. Infeksi pada dua trimester pertama berisiko
sebesar8%10%danmeningkatsecarabermkanapadatrimesterketigakehamilan
sebesar67%.
Tidak dilakukannya uji saring hepatitis B pada ibu hamil di Indonesia
memberikanpemikiran bahwa imunisasi hepatitis Byangpertama dilakukan pada
usia07hari. ImunisasiHBdiberikan3dosisdenganjadwalpemberianimunisasi
HB1padaumur07hari.HB2danHB3padaumur2dan3bulan.Jadwaltersebut
diberikanpadabaybarulahirdimaksudkanuntukmencegahadanyatransmisivertical
hepatitisBdariibukebayinya.
Hepatitisvirusadalahinfeksisistemikyangmenyeranghati.Penyakithepatitis
Btersebarluasdengantingkatendemisitasyangberbedamenurutgeografisdanetnis.
TingkatendemisitasdiIndonesiatergolongsedangtinggidenganprevalensiHbsAg
bervariasimenurutgeografis.DataprevalensuHbsAgdiIndonesiasangatbervariasi
ini,dapatdimengertimengingatIndonesiamemilikidaerahyangsangatluas,dengan
perilakudanbudayayangberanekaragam.

Penularan nonperkutaneus melalui ingesti oral telah dicatat sebgai jalur


pemajanan potensial tetapi efisiensinya cukup rendah. Di lain pihak, dua jalur
penularannonperkutaneusyangdianggapmemilikidampakterbesaradalahmelalui
hubunganseksualdanperinatal.Penularanperinatalterutamaditemukanpadabayi
yang dilahirkan dari ibu karier HBsAg atau ibu yang menderita hepatitis B akut
selamakehamilantrimesterketigaatauselamaperiodeawlapascapartus.Meskipun
kirakira10%dariinfksitimbulkirakirapadasaatpersalinandantidakberhubungan
dengan proses menyusui. Pada hampir semua kasus, infeksi akut pada neonatus
secaraklinisasimtomatik,tetapianakitukemungkinanbesarmenjadiseorangkarier
HbsAg.
Kurangnya pengetahuan keluarga meliputi persepsi yang salah tentang
oentingnyaimunisasidankeparahansuatupenyakitmerupakanfactorpentingyang
menjadihambatanberhasilanimunisasi.Persepsiyangsalahtentangkeparahansuatu
penyakitdipengaruhiolehkepercayaansetetmpatdankurangnyapengetahuantentang
kesehatan.Kepercayaandankurangnyapengetahuaninimembuatindividuberasumsi
bahwapenyakittidakberbahaya,jarangada,tidakmenular,merupakanhalyangbiasa
bagianakatauindiiduakanresistendengansendirinya.Haltersebutlahyangsering
membuat banyak masyarakat yang lalai melakukan pemeriksaan sehingga angka
kejadian kasus hepatitis B pada ibu hamil meningkat demikian juga dengan
kemungkinanmeningkatnyaangkakejadianpenularandariibukeanak,

BABII
TINJAUANPUSTAKA

2.1.HepatitisB
2.1.1. Definisi
Penyakit infeksi akut pada yang menyebabkan peradangan hati yang disebabkan
oleh Virus Hepatitis B. Infeksi HBV mempunyai 2 fase akut dan kronis

Akut, infeksi muncul segera setelah terpapar virus itu.beberapa kasus berubah

menjadi hepatitis fulminan.


Kronik, bila infeksi menjadi lebih lama dari 6 bulan
2.1.2.Epidemiologi
Diperkirakan350400jutaindividudiseluruhduniatelahterinfeksiolehvirus
hepatitisB. Prevalensiinfeksivirusinibervariasidiseluruhdunia,dengansetengah
daripopulasinyahidupdidaerahdaerahdimanahepatitisBmerupakansuatupenyakit
endemik. Daerah dengan prevalensi tinggi (lebih dari 2%) antara lain: Australia
aborigin,selandiabaru,kepulauandiPasifik:Melanesia,Mikronesia,polinesia,Asia
selatan:India,Banglades,Pakistan,Srilangka,Asiatenggara:Camboja,Indonesia,
laos,Malaisia,Filipina,Singapura,Thailand,Vietnam,Asiatimur:Cina,Hongkong,
Korea dan Taiwan, seluruh afrika kecuali afrika selatan, Amerika Selatan: Chili,
daerahmediterania,daerahtimurtengah:Mesir,Iran,Libia,Jordania,Turki,serta
EropatengahsepertiRumaniadanYugoslavia.TingkatinfeksivirushepatitisBmasih
tetaptinggi,diCinamencapai7,18%,sedangkandatadariNigeriamencapai215%
daritotalpopulasinya,denganrentangumurantara2535tahun.Berdasarkandata
yangdihimpunWHO tahun2008,Indonesiamerupakansalahsatunegaradengan
prevalensitinggiyaitu7,2%9%diikutidenganFilipina7,09,0%sedangkanMalaysia

berkisar antara 6,09,0%. Data dari Negara maju seperti Amerika Serikat
menunjukkanangkahanya12%daripopulasinnya.
Padanegaranegaradenganprevalensitinggisepertidisebutkandiatas,wanita
hamil yang memiliki kadar Hepatitis B e Antigen (HBeAg) yang lebih tinggi,
memiliki kemampuan dalam mensalurkan infeksinya secara transmisi ibuanak.
Transmisisecaraverticaltersebutdiatasdiketahuisebagaipenyebabterjadinyainfeksi
perinatalyangberkaitandenganangkakroniksitasyangsangattinggi(>95%)
2.1.3.Etiologi

Gambar1.MorfologivirushepatitisB.
Virus Hepatitis B merupakan virus berkapsul, berdiameter 42 nm yang
termasuk dalam keluarga Hepadinaviridae dan memiliki genom yang tersusun
melingkardenganpanjangmolekul3,2kbterdiridarimolekulDNAGanda.Molekul
tersebutmengandung4rangkaianyangsalingtumpangtindihyaituproteinpermukaan
(HBsAg), Protein inti/core (HBc/HBeAg), polymerase virus serta transaktivator
transkripsiHBx.
Telahditemukanbeberapabentukantigenyangpentingsecaraklinisdalam
mengkonfirmasi perkembangan infeksi virus hepatitis B, yaitu HepatitisVirus B s
antigen(HBsAg)yangmenandakanadanyainfeksivirushepatitisB,HepatitisBe
Antigen(HBeAg)yangmenandakanadanyareplikasivirus,sertatransaktivatorHBx
yang berkaitan dengan kemampuan virus tersebut dalam menyatukan genomnya
dengangenomhostsertakemampuannyadalammenyebabkansuatubentukpenyakit
keganasan(onkogenisitas).

2.1.4.Patogenesis
VirusHepatitisBmemilikimasainkubasiantara6minggusampaidengan6
bulandenganrataratayaitu90hari(3bulan),virusinimenularsecaraperkutaneus
(lukapadakulit)ataumukosayangterpaparolehdarah,cairantubuhsepertiserum,
semendanairliuryangtelahtercemarolehvirustersebut.ReplikasivirusHepatitisB
sebagianbesarterjadidiselhati.
VirusHepatitisByangmenginfeksimanusiaakanmenyebabkanterjadinya
infeksi akut yang kemudian dapat berkembang menjadi kronik sebanyak 10%,
memberigejalahepatitisakutsebanyak25%yangkemudiansembuh,65%akantidak
bergejalakemudiansembuhdan<1%yangakanmenjadihepatitisBfulminan.

Gambar2.SkemapathogenesishepatitisBakut.
Secaraalamiah,perjalananpenyakitvirushepatitisBdapatdikelompokkan
dalam5faseyangterjadiwalautidakselaluharusterjadisecaraberurutanyaitu:
1) FasetoleransiImun
DalamdarahpasienpadafaseiniakanditemukanHBeAgpositifdengankadar
HBVDNAyangtinggi( 108kopi/ml)sedangkankadarALTnormalatau
hanyasedikittinggi(<35IU/mlwanita).PadapemeriksaanHistologiselhati
tidakakanditemukanadanyaperadanganataufibrosis.

2) Faseimunaktif
PadafaseiniakanditemukanHBeAgpositifdengankadarHBVDNAyang
tinggi(106107 kopi/ml)sedangkankadarALTmeningkatdiatasnormaldan
berfluktuasi . Pada pemeriksaan Histologi sel hati akan ditemukan adanya
peradangansedanghinggaberat.
3) Faseinaktif/carrier(FaseLaten)
Pada fase ini akan ditemukan HBeAg negative dan tergantikan dengan
munculnya antiHBe . Kadar HBVDNA rendah ( 103 kopi/ml) atau
bahkan tiak terdeteksi lagi, selain itu kadar ALT menjadi normal. Pada
pemeriksaanHistologiselhatiakanditemukanperadanganminimalnamun
disertaidenganfibrosishinggasirosis.
4) Fasereaktif(HepatitisBHBeAg()kronikAktif)
FaseiniditandaidenganmeningkatnyaALTdisertaidengankadarHBVDNA
yang tinggi ( 104 kopi/ml), biasanya disertai juga dengan ditemukan
kembalinya HBeAg dalam darah yang menggantikan antiHBe yang ada
sebelumnya.PadapemeriksaanHistologiselhatiakanditemukanperadangan
aktifdisertaidenganfibrosisprogresif.
5) FaseResolusi
Padafaseini,bentukinfeksidarivirushepatitisBakansembuhyangditandai
denganHBsAgnegativedankadarHBVDNAtidakditemukanlagi,selainitu
kadar ALT juga dalam batas normal. Jika dalam perkembangan fase
sebelumnyatelahterbentukfibroticatausirosishati,makahaltersebutakan
menetapwalaupuninfeksinyatelahsembuh.Padakasussupresiimunyang
berat,reaktifasibiasterjadi.

Gambar3.FasehepatitisBkronik.panahputih,perubahanhistopatologi;panah
abuabu,perubahanmarkerserologiantarafase.Panahatasmaupun
bawah, peningkatan atau penurunan level DNA (=
sedikit
meningkat;=peningkatansedang;

=penurunanmoderate;

menigkattinggi).ALT,alanineaminotransferase;HBeAg,hepatitis
Beantigen.
Secara umum tidak terdapat perbedaan cara atau tahapan infeksi maupun
gejala yang timbul antara wanita hamil atau manusia lainnya. Namun demikian
adanya perubahan fisiologis selama kehamilan dimana terjadi peningkatan
metabolismsepertipeningkatankonsumsinutrisiyangdiakibatkanolehpertumbuhan
janinmakaeksarsebasikerusakandanpenyakithatiyangtelahadasebelumnyaakan
lebihmudahterjadi.
2.1.5.TransmisiVirusHepatitisB
Padadaerahendemik,carapentingdalampenularanhepatitisBdariindividu
keindividuyanglaindiperankanolehkontakdenganpasien(bagitenagakesehatan),
kontak seksual serta penggunaan obatobatan melalui intravena. Sedangkan pada
daerahyangmemilikiprevalensirendah,carapenularanyangsangatberperanadalah
melaluiparenteralatauperkutaneussepertisaatmelakukan piercing,membuattato
atausaatberbagipisaucukurmaupunpunsikatgigi.Selainitu,tindakanoperasidan
perawatangigidapatmenjadisumberinfeksisedangkanpenularaninfeksimelalui

transfusidarahdinegaraberkembangtelahmenurunangkakejadiannyaolehkarena
telahditerapkannyapemeriksaanserologisertamolekulerdarahnamuntetapmenjadi
suatu sumber infeksi di Negaranegara miskin. Cara penularan lainnya yang juga
merupakancarapenularanyangmenyebabkanangkakroniksitasyangtinggiadalah
melaluitransmisiibuanak.
Transmisiinfeksidariibukeanaksecaratradisionaldisebutsebagaiinfeksi
perinatal. Transmisi ini merupakan transmisi yang terpenting diantara transmisi
verticallainnyadalamhalpenyebabterbentuknyapenyakithepatitisBkronik.Dari
definisinyaperiodeperinatalyangdimulaidariusiagestasional28minggu28hari
postpartummakainfeksidiluarmasatersebuttidaktermasukdalaminfeksiperinatal,
olehkarenaitusaatiniistilahtersebuttelahberubahmenjaditransmisiibuanakyang
mencakup keseluruhan infeksi yang terjadi sebelum, saat dan sesudah kelahiran,
termasukinfeksiyangterjadipadausiadini.
Transmisiibuanaksecaragarisbesardapatdibagiatas:
1. Transmisiintrauterine/prenatal
2. Transmisiintrapartum/saatmelahirkan
3. TransmisiPostpartum(selamaperawatanbayi)
1. Transmisiintrauterin(transmisiprenatal)
Mekanisme pasti terjadinya infeksi prenatal/ intrauterine ini masih belum jelas,
namundemikianterdapatbeberapakemungkinandiantaranya:
Kerusakansawarplasenta
Kebocoran transplasenta yang terjadi oleh karena kontraksi uterus
selamakehamilandanadanyarobekanpadasawarplasentamerupakancara
yang sering menjadi penyebab infeksi intrauterine. sebuah penelitian juga
menunjukkan bahwa tindakan amniosisntesis yang dilakukan pada wanita
hamil dengan HBsAg positif dapat menyebabkan darah ibu yanginfeksius
terbawa melalui jarum amniosintesis ke dalam rongga intrauterine, namun
demikiantransmisidengancarainisangatjarangterjadi.
Infeksiplasentadantransmisitransplasenta
PenelitianWang&ZhumenunjukkankemampuanhepatitisBuntuk
bergabungdenganjaringanplasentadanmengakibatkanterbentuknyafokus

infeksi.PenelitianZhangdkkmenunjukkanadanyakonsentrasidari2antigen
(HBsAgdanHBeAg)yangturundarisisiibukefetusmelaluiselseldesidua
maternal > selsel trofoblas> selsel vili mesenkim> sel endotel kapiler.
denganhasiltersebut,penelitimenyimpulkanbahwacarainimerupakancara
yangdominan padatransmisiintrauterine.Suatupenelitianmengungkapkan
adanya DNA HBV pada oosit dan sperma individu yang terinfeksi, oleh
karenaituinfeksipadafetusdapatterjadiselamamasakonsepsi.
Liudkkmendapatiadanyagengenotip"7/5"ofDCSIGNRyangsesuaiuntuk
terjadinyainfeksiintrauterine.
2. Transmisiintrapartum/saatmelahirkan
Transmisi virus hepatitis B ke bayi saat lahir dimungkinkan oleh adanya
beberapafaktordiantaranyaperpindahandariibukejaninsaatkontraksiselama
persalinanatausebagaikonsekuensirupturemembranplasentayangterjadi,selain
itudapatpulaterjadimelaluicairanamnion,darahmaupunsekretyangterdapat
sepanjangjalanlahirtertelanolehbayi.
Okadadkkmenemukan85%dariinfeksineonatalterjadiselamaintrapartum
halinidisebabkanolehkarenapaparandarahdansekretvaginayanginfeksius.7
3. TransmisiPostpartum/postnatal/saatperawatan
Walaupun DNA HBV, HBsAg dan HBeAg telah terbukti di eksresikan
bersamadengankolostrumdanairsusupadaibuyangterinfeksihepatitisB,tidak
ditemukanbuktibahwamenyusuimeningkatkanresikotransmisisecaraibuanak.
Mekanismepastimengenaicaratransmisipostnatalbelumdiketahuisecara
pasti,namunbeberapaliteraturemendugatransmisiterjadimelaluiciumanibuke
mulutbayidanakibatkontaminasiairsusuibudenganeksudatyangterbentuk
darilukadisekitarputtingsusuibu.
2.1.6.ManifestasiKlinik
Gejala klinis pada pasien yang terinfeksi virus hepatitis B seperti pada
umumnya,tidakberbedaantarawanitahamildenganwanitayangtidakhamil.Pada
kasus infeksi akut akan timbul keluhan yang tidak spesifik, termasuk kelemahan,
kelelahan,anoreksia,mual,sakitkepala,nyeriototdandemamderajatrendah.Gejala

sepertimualmuntahpadastradiumprodromaliniterkadangmembingungkandengan
gejalayangtimbulpadawanitahamilmudatanpapenyakithepatitisB.Jikapenyakit
inisembuhsebelumterbentuknyakerusakanhatiyangmenyebabkandisfungsihati
sekundermakagejalaprodromalsepertidiatasakandianggapsepertisuatusindrom
flu biasa akibat virus atau bahkan akan dianggap sebagai bentuk efek fisiologis
normaldarikehamilanitusendiri.
Ikterusakanmunculsekitar210harisetelahgejalaprodromalmuncul,pasien
juga akan mengeluhkan rasa tidak nyaman di region perut kanan atas dan pada
pemeriksaanfisikbisaditemukanadanyahepatomegali.Namunpemeriksaanuntuk
menemukanadanyahepatomegalitersebutakansulitdilakukanpadapasiendengan
usiakehamilanlanjut.
Umumnya ikterus dan gejala penyakit hati lainnya akan sembuh dalam 6
minggu, namun beberapa diantaranya dapat berlanjut menjadi gagal hati yang
fulminant yang ditandai dengan kegagalan organ multiple, edema cerebri dan
koagulopati. Ada pula yang kemudian menetap lebih dari 6 bulan dan menjadi
hepatitisBkronik.
PadasebagianbesarindividuyangmengalamihepatitisBkroniktidakakan
memberikangejalaklinishinggastadiumakhir.InfeksikronikhepatitisBkadangkala
diketahui secara tidak sengaja saat pasien hamil tersebut memeriksakan
kehamilannya.TemuanlaboratoriumlainumumnyanormalkecualikadarALTyang
cenderungtidaknormal.
PemeriksaanfisikwanitahamildenganinfeksikronikhepatitisBterkadang
tampak normal oleh karena tandatanda sirosis dini seperti eritema Palmaris,
splenomegalidanukuranhatiyangkecildapattersamarkandenganperubahankondisi
fisikakibatkehamilantersebut.
EfekinfeksihepatitisBpadaibuhamilumumnyatidakbermakna.Namun
bagiibuyangtelahmengalamisirosissebelumkehamilannyaakanmemilikiresiko
lebih besar untuk terjadinya rupture varises esophagus yang menyebabkan
perdarahan.
PenelitianlainmenunjukkaninfeksikronikhepatitisBberhubungandengan
terjadinyadiabetesmellitusgestasional,perdarahanantepartum,kelahiranpremature
dankondisiskorapgaryangrendahpadabayibarulahir.selainituibuhamildengan

gangguan hati yang berat dapat menyebabkan terjadinya perdarahan postpartum,


distress hingga kematian janin,asfiksia neonatorumdanberatbadan lahir rendah.
Perdarahanpostpartumdanintrapartumdapatterjadiolehkarenakurangnyavitamin
Kyangterjadiakibatadanyagangguanhati.
Adanyainfeksihepatitis Bdidalamuterus selamakehamilanmerupakanindikator
yangpentingkarenajaninyangmengalamipaparandinidenganantigenHepatitisB
saat perkembangan embriogenik akan mengalami toleransi imun terhadap antigen
tersebut dan memungkinkan terbentuknya infeksi kronik pada janin oleh karena
ketidakmampuanimunjanindalammengeliminasivirustersebut.
2.1.7.Diagnosis
Diagnosis seringdidasarkanpadariwayatklinik,meningkatnyakadarALT
sertaditemukannyaantigenhepatitisBvirus(HBsAg)diserumpasien.Pemeriksaan
tambahansepertiantiHBeIgMkadangkaladibutuhkanpadabeberapakasusdimana
pasien diduga mengalami infeksi akut dengan kadar HBsAg negatif, pasien pada
kasusiniharusdicurigaisedangberadapadafasejendela(windowphase).
PadapasiendengandugaanhepatitisBkronikharusdilakukanpemeriksaan
HBsAg dan HBV DNA guna diagnosis, indikasi terapi dan untuk mengamati
perkembangandaripasientersebut.
BeberapatesserologipentingantaralainHBeAgyangmenunjukkankondisi
pasienyangsangatinfeksius,HBV DNAmenunjukkanjumlahvirusdalamtubuh
pasien, anti HBe atau HBeAg yang mengindikasikan bahwa pasien tersebut lebih
kurangmenulardibandingkandenganHBeAgpositif.
2.1.8.Penatalaksanaan
Beberapa faktor yang mempengaruhi pilihan terapi bagi wanita usia
reproduktif yang terinfeksi virus hepatitis B diantaranya adalah keamanan saat
bersalin dan menyusui efektivitas agen terapi, lama masa terapi dan yang paling
pentingadalahakibatdariterapitersebutbagiibudanjanin.
Keputusanuntukmemulaiterapiselamakehamilanharusmempertimbangkan
beberapa hal mengenai resiko dan keuntungan bagi ibu serta janin yang

dikandungnya, bahkan harus pula dipikirkan mengenai kapan atau pada trimester
berapaterapiharusdimulai.
PadakasushepatitisBakut,Tidakdiberikanpenanganankhusus,penanganan
hanyaberupatirabaring(bedrest)dantinggiprotein,dietrendahlemak.Sedangkan
indikasi untuk rawat inap seperti anemia berat, diabetes, mual muntah hebat,
gangguan protrombin time, kadar serum albumin yang rendah, kadar bilirubin
>15mg/dl. Bagi wanita hamil yang merasa dirinya telah terpapar dengan virus
hepatitisBdapatdiberikanimmunoglobulinhepatitisB(HBIG)gunamelawanvirus
tersebut,idealnyadiberikandalam72jampertamasetelahpaparan.Selainituguna
meningkatkanprofilaksis,pasientersebutdapatdiberikanvaksinhepatitisBdalam7
hari pertama setelah terpapar, dilanjutkan dengan 1 dosis pada bulan berikutnya
(vaksinyangkedua)dan1dosis(vaksinyangketiga)lagisetelah5bulandarivaksin
keduaatau6bulandarisaatterpapar.
Pada kasus tertentu, obatobatan antiviral harus digunakan. Terdapat 7
pengobatanantivirusyangtelahditerimaolehFood&DrugsAdministration(FDA)
sebagaiterapiuntukhepatitisB. Namuntidaksatupundariobatobattersebutyang
diterimauntukdigunakanpadaibuhamil.

Tabel1:TerapihepatitisByangditerimaolehFDA.

Tabel2:Pengolonganobatyangdigunakanpadapasienyangsedangmengandung.
Obatobatan antiviral memiliki kemampuan dalam menghambat nukleotida
maupunpolimerasenya,walaupuntargetnyaadalahRNAdependentDNApolymerase
virus hepatitis B, namun karena obat ini mampu dengan bebas melalui plasenta,
merekajugadapatmengganggureplikasiDNAdalammitokondria,jikahaliniterjadi
makaakanmengangguorganogenesisjaninolehkarenaitupasienyangsedangdalam
terapiobatantivirusyangkemudianmenjadihamilharusmenghentikanpengobatan
tersebutkhususnyabagipasienyangtidakmemilikipenyakithatiyangberat,selain
itu pengobatan saat kehamilan muda juga tidak disarankan untuk diterapkan pada
wanitahamilyanginfeksinyamasihberadadalamfasetoleransiimun(serumHBV
DNAtingginamunkadarALTnormalsertahasilbiopsyhaninormal).Haltersebut
diterapkangunamengurangipaparanantiviralpadafetusselamatrimesterpertama.
Sedangkan bagi mereka yang ingin hamil, harus mengatur rencana kehamilannya.
sebagai contoh, pasien yang sebelumnya menggunakan terapi interferon harus
menghentikan terapi tersebut selama minimal 6 bulan sebelum merencanakan
kehamilannya,olehkarenainterferonmerupakanobatantipolimeraseyangmenjadi
kontraindikasibagikehamilan.
Penggunaan antiviral selama kehamilan didasarkan pada data keamanan
penggunaan antiviral virus hepatitis B yang berasal dari 2 sumber utama yaitu
Antiviral Pregnancy Registry (APR) dan Development of Antiretroviral Therapy
Study(DART).8

Data dari APR yang dilaporkan pada tahun 2010 menunjukkan bahwa
lamivudinedantenovovirmerupakan2obatdenganpengalamanpenggunaansecara
invivoditrimesterpertamakehamilanyangpalingaman.

Tabel3.DataAntiviralPregnancyRegistry(APR).8
Oleh sebab itu didunia saat ini terdapat 2 jenis obat yang paling sering
digunakansebagaiterapihepatitisBpadaibuhamil,yaitulamivudindantenovovir.
WalaupunlamivudinedigolongkanobatkelasColehFDAatasdasarditemukannya
toksisitas saat penggunaanya di kelinci hamil saat trimester pertama. Namun
penelitian di Cina telah menunjukkan kesuksesan lamivudine dalam menghambat
transmisiverticalselamatrimesterke3kehamilan,saatdigunakanpadapemberian
pertamadiusiakehamilan28minggu,dengankadarDNAHBV 108 IU/ml.
PenelitianinijugamenunjukkanpenurunankadarDNAHBVhingga 106IU/ml
bagi pasien dengan kadar DNAHBV 108 IU/ml yang mendapatkan terapi
lamivudine. Penelitian lain yang juga menggunakan lamivudin selama trimester 3
kehamilan menunjukan penurunan angka transmisi intrauterine dan tidak
ditemukannyaabnormalitaspadabayibarulahirdalamkelompoktersebut.
TenovovirtermasukkategorikelasB,obatinimemilikikelebihantambahan
berupakemampuannyadalammancegahresistensivirus,bahkanhinggasaatinitidak
terdapatlaporanmengenaiterjadinyaresistensivirushepatitisBterhadapobatini.
Obatlainyangmulaidigunakanadalahtelbivudinyangmasukdalamkategori
kelasBmenurutFDA,namunpenggunaanyamasihterbatasoehkarenakurangnya
data keamanan penggunaan obat ini dalam penelitian in vivo pada ibu hamil dan
mudahnyaobatinimenjadiresisten.
Penelitianyangmelibatkanpenggunaantelbivudinetelahdilaksanakanpada
wanitahamildenganusiakehamilan2032mingguyangmemilikiHBsAgpositifdan

kadar DNAHBV 107 IU/ml menunjukan adanya penurunan angka transmisi


perinatal,selainituterjadipenurunankadarHBVDNA,HBeAgdannormalnyakadar
ALTsebelumtibasaatnyabersalin.
Terapi pada wanita hamil dengan HBsAg positif harus didasarkan pada
evaluasidasarsepertikondisikadarHBVDNA,HBVM(HBsAg,HBeAg,antiHBe)
sertapenyulitpenyulitlainsepertifibrosishatiberat(kadarALTmeningkatlebih
dari2kalinilainormal,kadarHBVDNA>105kopi/ml),atautelahmengalamisirosis
hepatis.Dengankondisidiatasmakaterapiantiviralharusdimulaisejakkehamilan
muda.jikapadapemeriksaanawalfungsihati,ALT,kadarHBVDNAdidapatkan
dalam keadaan normal maka evaluasi ulang harus dilakukan kembali pada usia
kehamilan 2628 minggu. Jika pada saat itu ditemukan kadar HBVDNA > 10 7
kopi/mlataupasienmemilikiriwayatmelahirkananakyangmengidaphepatitisB
makaantiviralsepertilamivudin,tenofovirharusdiberikansaatusiakehhamilan28
30 minggu hingga 6 bulan setelah melahirkan, selanjutnya pengobatan dapat
dilanjutkantergantungdarikondisipasien,namunsebaiknyaterapidihentikanbilaibu
Penjaringan HBsAg wanita hamil pada kunjungan awal antenatal
yang ingin menyusui karena antiretroviral tidak di anjurkan saat menyusui.
PemantauanALTdanHBVDNAharusdilakukanpadabulanke1,3dan6setelah
HBsAg Negatif
HBsAg Positif
melahirkan.

Pemberian vaksin
Pemberian
Hep B pada
vaksin
Trimester
Bayi
Hep
saat
BI pada
lahir
Periksa:
Ibu HBs
selama
Ab, kehamilan
HBeAg, HBeAb, PLT, ALT, Kadar HBV-DN
Ada dugaan suatu bentuk inf

Melengkapi Vaksinasi Hep B sesuai jadwal

TIDAK

YA

Akhir Trimester II (UK 26-28 mgg) periksa


: ALT, Kadar
HBV-DNA
Pertimbangkan
Terapi
dengan

Riwayat melahirkan anak sebelumnya


TIDAK

YA
Anak HBV (-)

HBV-DNA
< 107 kopi/ml

Anak HBV

HBV-DNA
>
107 kopi/ml
Pertimbangkan
terapi dengan Lamivudine / Tenofovir pa

Pengawasan setelah partus : periksa kadar ALT, HBV-DNA saat bulan 1, 3 & 6
Pertimbangkan penghentian terapi
Gambar 2. Alur penatalaksanaan terapi hepatitis B pada kehamilan.

Bagi ibu dengan HBsAg negative, pemberian vaksinasi sangat dianjurkan, sama
halnya dengan pemberian vaksinasi bagi bayi yang dilahirkannya. Selanjutnya
pemberianvaksinasipadabayimengikutijadwalyangtelahada.
2.1.9.Pencegahan
Penjaringan merupakan teknik yang tepat untuk pencegahan dan
penataksanaan lanjutan bagi pasien hamil yang terinfeksi hepatitis B serta pasien
resiko tinggi. Sehingga penjaringan hepatitis B menjadi standar pada saat asuhan
antenatal.penjaringaninijugamemungkinkantenagakesehatanmenilaijaninyang
memerlukanimunoprofilaksisbaikdenganvaksinmaupunimmunoglobulinhepatitis
B (HBIG), mengetahui indikasi terapi antiviral pada pasien carier, serta berguna
dalamkonselingaktivitasseksual.TheAmericanAssociationStudyofLiverDisease
(AASLD),merekomendasikanpenjaringanuntukHBsAgpadasemuawanitahamil
selamatrimesterpertamakehamilan.
Vaksinasimerupakansalahsatucarapencegahanpenularanpenularanvirus
hepatitisBdariibukeanak.Denganpemberianvaksinasipadaibuyanghamilakan
memungkinkan terjadinya penyaluran pasifantibodikejaninyang memungkinkan
suatubentukperlindungandariinfeksihorizontalhinggabayitersebutmendapatkan
imunisasiaktif,vaksinasijugaterbuktiamanbagiibudanjanin,efeksampingyang
paling sering muncul adalah nyeri ditempat suntikan dan demam ringan sampai
dengansedang.

Vaksin pertama tersedia tahun 1981, vaksin tersebut dibuat dari antigen
permukaanhepatitisBdaripasienHBsAgkarrier,yangberisi22nmHBsAgpartikel
inaktifdigabungkandenganurea,pepsin,formaldehiddanpemanasan.Vaksinini
telahsuksesdigunakanpadalebihdariratusanjutaindividudandikenaldenganistilah
plasmaderivedvaccine.Padatahun1982,dikembangkanvaksinrekombinanyang
diekstrakdariDNAyeastatauselmamaliayangdibuatterinfeksivirushepatitisB.
Teknologi baru ini telah memungkinkan dibuatnya vaksin dengan produksi tidak
terbatassehinggavaksindapatdigunakansecaraluasdiseluruhdunia.
Sejak dikembangkan vaksin rekombinan hepatitis B tahun 1982, sebagian
besar otoritas kesehatan, termasuk World Health Organitation (WHO)
merekomendasikanpenggunaanvaksinpadabayibarulahirterutamayanglahirdari
ibu dengan HBsAg positif atau dari kelompok resiko tinggi. 4 Bentuk vaksinasi
lainnyaadalahvaksinasipasifyangdikenaldengannamaimmunoglobulinhepatitisB
(HBIG).HBIGinimerupakanbentukantiHBsyangdiambildariindividudonor
yangdalamplasmanyamengandungkadarantiHBsyangtinggi.

Gambar4.ContohVaksinHepatitisB(kanan)29&HBIG(kiri)28

Tabel3.KelompokresikotinggimenurutAASLD.
Gabungan vaksin Hepatitis B dengan Hepatitis B immunoglobulin (HBIG)
yangmerupakanbentukimunisasipasifseringdiberikanpadabayibarulahiryang
lahir dari ibu dengan HBsAg positif. US Preventive Task Force (USPSTF)
merekomendasikanpemberiandosispertamavaksinhepatitis BdanHBIGadalah
dalam 12 jam pertama kelahiran, sedangan Center for Disease Control (CDC)
menganjurkan pemberian vaksin hepatitis B dengan atau tanpa HBIG diberikan
segerasetelahbayilahir,kemudiandilanjutkan1dosissaatusia12bulandan1dosis
lagipadasaat68bulan.Denganpemberianvaksintersebut,antibodiyangtimbul
gunamelawanHBsAgyangdisebutantiHBsmendekati100%padaanakkecildan
hampir95%padadewasamuda.

Tabel4.Jadwalvaksinasiaktifdanpasif.7
Penelitian Beasley dkk menunjukkan pemberian HBIG dapat menurunkan
transmisidariibuHBsAgpositifyangmencapailebihdari90%menjadikuranglebih
26%sedangkanketikadiganbungkandenganvaksin,lajutransmisiibuanakmenurun
hinggahanya27%.
Cara pemberian vaksin adalah via injeksi intramuscular, dimana pada bayi
usia>1tahundapatdiberikandiregiondeltoid,sedangkanpadabayiusia<1tahun
diberikandiregionlateralpaha.VaksinhepatitisBdapatditoleransidengansangat
baik,efeksampingyangbiasaditemukanadalahbengkakdankemerahanditempat
suntikansedangkanefekyanglebihsistemiksepertidemam,nyerikepala,mualdan
nyeriperutsangatjarangditemukan.Satusatunyakontraindikasipemberianvaksin
adalahriwayathipersensitivitasterhadapfaksintersebutatauriwayatsyokanafilaktik
padapemberianvaksinsebelumnya.

2.2HepatitisBpadaKehamilan
2.2.1PengaruhinfeksiVHBpadakehamilan
Infeksi VHB kronis atau akut pada kehamilan sama dengan populasi pada

umumnya. Infeksi VHB tidak menyebabkan peningkatan mortalitas maupun


menyebabkan efek teratogenik. Namun, pada infeksi VHB akut insidensi untuk
terjadinya berat bayi lahir rendah dan prematur lebih tinggi. Dimana diabetes
gestasional,perdarahanantepartumdanpersalinanprematurlebihseringterjadipada
infeksiVHBkronik.
Kelahiranprematurmeningkatsebesar1535%,yangkemungkinandisebabkan
karena keadaan penyakitnya yang berat, pengaruh virus pada janin atau plasenta.
Diperkirakanbahwakenaikankadarasamempedudanasamlemakbebasbersama
dengan timbulnya ikterus dapat meningkatkan tonus otot uterus dan memulai
persalinan.
Tidak didapatkan adanya efek teratogenik maupun kondisi akut pada janin,
sehinggadianggapoutcomebayiyangdilahirkandariibuyangterinfeksiVHBsama
dengan bayi yang dilahirkan dari ibu yang tidak terinfeksi. Pada umumnya yang
menjadi permasalahan di sini adalah penularan vertikalnya saja. Bila ibu hamil
terinfeksi VHB pada kehamilan trimester I dan II maka penularan vertikal hanya
kurang dari 10%. Tetapi bila infeksi VHB terjadi pada kehamilan trimester III,
penularanvertikalmenjadilebihtinggiyaitu76%.
Infeksi akut VHB pada kehamilan trimester III sering berkembang
menjadi/menyebabkanhepatitisfulminantdanpersalinanprematursedangkanpada
persalinandapatmenyebabkanperdarahanpostpartumterutamabilaterjadigangguan
fungsihati.Dikarenakanadanyagangguanpadafungsihatimakaterjadiperpanjangan
waktuprotrombindanwaktuaktivasiparsialtromboplastinyangdapatmenyebabkan
kecenderunganperdarahan,terutamaperdarahanpostpartum.
2.2.2.PengaruhkehamilanpadainfeksiVHB
Padaibuhamilnormalseringterlihattandatandasepertiyangkitadapatkan
padapenderitasirosishatimisalnyaspiderangiomadaneritemapalmaris.Halini
wajarpadakehamilansebagaiakibatmeningkatnyakadarestrogen.Selamakehamilan
masihdalambatasnormal,fungsihatitidakakanterganggu.Padateslaboratorium
faalhatiseringdidapatkannilainyayangberubahpadakehamilantrimesterIII.Halini
mungkin disebabkan karena meningkatnya volume plasma darah sehingga terjadi
hemodilusi yang digambarkan dengan menurunnya protein total, albumin, gama
globulin dan asam urat. Plasenta yang sedang berkembang menghasilkan alkali

fosfatase sehingga kadar alkali fosfatase meningkat dalam darah. Demikian juga
kolesterol, globulin dan fibrinogen akan meningkat. Bilirubin, transaminase, asam
empedutidakberubahataubilaberubahmeningkatsedikitdanakanmenurunlagi
padasaataterm.
Resiko infeksi VHBpada kehamilan adalah sama dengan pada wanita yang
tidakhamil.Bahayainfeksitersebutadalahsamapadasemuatrimesterkehamilan.
Pada masyarakat dengan gizi yang baik, angka kematian dari infeksi VHB pada
wanita hamil maupun wanita tidak hamil adalah sama. Tetapi pada masyarakat
denganmasalahmalnutrisi,angkakematiannyaadalahlebihtinggitetapitetapsama
padawanitahamilmaupuntidak.BilainfeksiVHBterjadipadakehamilantrimesterI
ataupermulaantrimesterII,makagejalagejalanyaakansamadengangejalainfeksi
VHBpadawanitatidakhamil.SedangkaninfeksiVHByangterjadipadaibuhamil
trimester III, akan menimbulkan gejalagejala yang lebih berat bahkan dapat
menunjukkan gejalagejala hepatitis fulminant. Hal ini disebabkan karena pada
kehamilantrimesterIIIterdapatdefisiensifaktorlipotrofikdisertaikebutuhanjanin
akannutrisiyangmeningkat.Halinimenyebabkanibumudahjatuhkedalamakut
hepaticnekrosis.Angkakejadianhepatitisfulminantpadawanitahamilberkisar10
20%,terutamaterjadipadakehamilantrimesterIII.
Selama kehamilan terjadi beberapa perubahan pada sistem imun ibu, seperti
pergeseran pada keseimbangan Th1Th2 ke respon Th2, peningkatan jumlah dari
regulator sel T, dll, yang berkontribusi terhadap penurunan respon imun terhadap
HBV. Tujuan dari perubahan ini adalah untuk mencegah terjadinya penolakan
terhadapfetusyangsebagianbersifatalogenikterhadapsistemimunibu.Perubahan
ini menyebabkan peningkatan DNA HBV dan penurunan level aminotransferase.
Setelahpersalinanterjadiperbaikankembalisistemimunyangmenyebabkanhalyang
sebaliknya.Terjadipeningkatanalanineaminotransferase(ALT)yangsignifikandan
penurunanDNAHBVpadasaatitu.
2.2.3TransmisiVHBperinatal
Transmisiperinatalmerupakancarayangpalingumumterjadipadatransmisi
HBV.SekitarsepertigainfeksiHBVdidapatkanmelaluitransmisiperinatal.Infeksi
HBVpadaneonatusdidefinisikansebagaididapatkanHBsAgpositif6bulansetelah
lahir.AntibodiuntukantiHBedanantihepatitisBcoreantigendapatmelewatisawar

plasentadanmenghilangsebelumusia12dan24bulan.Jadi,itumerupakanantibodi
ibutransplasentadanbukanmerupakanindikatorinfeksiHBV.
Infeksiperinataldimediasimelaluitigacarautama:1)transmisiintrauterine;2)
transmisi intrapartum atau labor; 3) transmisi postnatal. Mekanisme transmisi
intrauterine masih belum banyak diketahui tapi terdapatnya infeksi intrauterine
diperlihatkandalambeberapastudi,diindikasikandenganditemukannyaHBsAgdan
HBVDNApadabayibarulahirdandariplasentadanstudiPCR.Faktorresikountuk
terjadinyainfeksiintrauterineadalahibudenganHBeAgpositif,DNAHBV yang
terdeteksi,mutasispesifikallelpadaHBVibu,riwayatpartusprematurusiminens,
daninfeksihepatitisBakutdidapatsaathamil,terutamasaattrimesterakhir.HBeAg
negatif pada ibu dengan viral load yang tinggi (DNA HBV load >10 8 IU/mL)
merupakan resiko yang tinggi untuk terjadinya transmisi virus kepada janin di
intrauterine.
Sejak lama para ahli berpendapat bahwa partikel VHB utuh (partikel Dane)
dalam keadaan biasa tidak dapat menembus plasenta. Dahulu diduga lewatnya
partikel Dane melalui plasenta hanya terjadi bila terdapat kebocoran plasenta,
misalnyabilaterjadirobekandanlainlain.Namun,banyakbuktimenunjukkabahwa
dalamkeadaantertentutanpakebocoranplasentajugadapatterjadiperpindahanvirus.
Buktibukti tersebut antara lain 43,8% dari jaringan hati dan serum bayi yang
dilahirkanolehibuHBsAgpositifyangmengalamiabortusternyatamenunjukkan
DNA VHB yang positif dan bahkan 33,3% bayibayi tersebut telah mengalami
integrasiDNAVHBdalamgenomselhati.Disampingitu,banyakneonatusyang
menunjukka HBsAg positif dengan titer yang sangat tinggi pada darah tali pusat
ataupun darah bayi yang diambil pada harihari pertama setelah lahir. Hal ini
menunjukkanbahwaVHBtelahmengalamireplikasisebelumbayidilahirkan.
SampaisaatiniseorangbayidikatakantelahmendapatinfeksiVHBinuterobila
dalamjangkawaktukurangdari6minggu(yangmerupakanmasatunasterpendek
VHB)bayitersebuttelahmenunjukkanHBsAgyangpositif.Untukmudahnyabila
seorangbayisudahHBsAgpositifpadausia1bulan,bayitersebuttelahmendapat
infeksi VHB inutero. Sampai sekarang belum diketahui bagaimana VHB dapat
melewatiplasenta.Salahsatuteorimengatakanbahwapadakeadaantertentuyang
menyebabkan kontraksi uterus terjadi maternofetal micro perfusion. Hal ini dapat

terjadipadatrimester2dan3.
Transmisiintrapartumataulabordapatterjadijikaterdapattransfusidarahibu
kefetussaatkontraksi;akibatdariketubanpecah;daridarahibuyangterkontaminasi
HBV atau cairan ketuban atau cairan vagina yang tertelan bayi atau masuk ke
sirkulasi darah bayi melalui ruptur plasenta; atau melalui kontak langsung fetus
dengan darah atau cairan yang terinfeksi melalui jalan lahir ibu. Jumlah HBV
sebanyak108IU/mLdaridarahibuyangmasukkejanindapatmenyebabkaninfeksi
HBVpadajanin.
Transmisi postpartum terjadi dalam jumlah yang sedikit dan mekanismenya
masih belum diketahui dengan jelas. Mekanisme yang mungkin terjadi adalah
terdapatkontaklangsungdaribayiterhadapsekretibuyangterkontaminasiinfeksi
HBV.Dapatjugaterjadimelalui:kontaklangsungdariibukebayisepertumencium
bayidenganmulutkemulut,selainitujugadapatterjadiakibatinfeksinosocomial
yaitukurangnyahigenitastenagakesehatanyangberhubungandenganbayidanibu.
Tanpa profilaksis resiko transmisi ibu ke bayi sangat tinggi. Bervariasi
tergantung dari status HBeAg/antiHBe ibu. 70%90% pada ibu dengan HBeAg
positif, 25% pada ibu dengan HBeAg negatif/HBeAb negatif, dan 12% pada ibu
denganHBsAgnegatif/antiHBepositif.Programskriningpadaibuhamilbertujuan
untuk mengidentifikasi HBsAg positif pada ibu merupakan pemeriksaan yang
umumnya di lakukan pada kehamilan di kebanyakan negara. Saat HBsAg positif
teridentifikasimakabayiakanmendapatkanimunoprofilaksisaktifdanpasifuntuk
mencegahpenularansecaravertikaldariibukebayi.Imunoprofilaksispasifadalah
denganmemberikanimunoglobulanHepatitisB(HBIG)danimunoprofilaksisaktif
adalahdenganmemberikanvaksinhepatitisB.
Meskipundenganpemberianprofilaksisiniefektifdalammencegahpenularan
HBVmelaluiibu,namunbeberapaanak(3%13%)yanglahirdariibudenganHBsAg
positif, terutama dengan HBeAg akan menjadi karier HBsAg meskipun telah
diberikanimunoprofilaksisbaiksecaraaktifmaupunpasif.
HBeAgibudapatmelewatiplasentadariibukefetusdanmerangsangtoleransi
sel T dalam uterus. Mekanisme infeksi HBV intrauterine masih belum diketahui
denganjelasnamunpenyebabutamanyaadalahgagalnyablockadeimun.SerumDNA
HBVyangtinggipadawanitahamilmerupakanfaktorresikoutamauntukterjadinya

infeksi HBV intrauterine, berhubungan dengan kadar DNA HBV dalam darah
umbilicaldantiterHBsAg.HBVdapatmenginfeksisemuaselpadaplasenta(desidua,
trofoblastik,mesenkimalvilli,selendotelkapilervili)danDNAHBVterdapatpada
semuagenerasiselspermatogenikdanspermapadalakilakidenganinfeksiHBV,
cairanfolikulardanpadaovarium.Adanyaviruspadaselspermadapatmenjadisalah
satupenyebabtransmisiinfeksiHBVpadaneonatus.
2.2.4PenangananinfeksiVHBsaatkehamilan
Penanganan infeksi VHB pada kehamilan harus mempertimbangan semua
resikodankeuntunganpadaibudanfetus.Masalahutamapadafetusadalahmengenai
bahayateratogenikdariobatsaatembryogenesis.Tujuhobatyangtelahdisetujuioleh
Food andDrugAdministration (FDA) untuk pengobatan hepatitis BadalahPEG
interferonalpha2a,Interferonalpha2b,lamivudine,adefovir,entecavir,telbivudine
dantenofovir.
Interferon kontraindikasi diberikan saat hamil, dapat digunakan pada wanita
usia subur karena biasanya diberikan pada periode tertentu (4896 minggu).
Pemberianinterferondirekomendasikandiberikanbersamapenggunaankontrasepsi
selamapengobatan.
Agenantivirusoralsepertinukleosidaatauanolognukleosidabekerjadengan
menginhibisipolymerasevirus,biasanyadigunakandalamjangkawaktuyanglama.
ObatinidapatmempengaruhireplikasiDNAmitokondriasehinggaberpotensiuntuk
menyebabkantoksisitaspadamitokondriayangberpengaruhterhadapperkembangan
fetus.
Tabel2.KategoriobatantiviraluntukhepatitisBpadakehamilan
Obat
Lamivudin
Entecavir
Telbivudin
Adefovir
Tenofovir
Interferonalpha2a
PegylatedInterferonalpha2a

Kategorikehamilan
C
C
B
C
B
C
C

FDAmengklasifikasiobatmenjadi5kategori(A,B,C,DdanX)tergantungdari
kemungkinan efek teratogenik pada manusia maupun hewan. 5 obat oral analog

nukleotida untuk terapi HBV diklasifikasikan sebagai kategori B atau kategori C.


ObatyangtergolongdalamkategoriCadalahlamivudine,adefovir,danentecavir
merupakan obat yang memperlihatkan efek teratogenik atau embriosidal pada
binatangpercobaandantidakadastuditerkontrolpadawanitahamil.
ObatyangtergolongdalamkategoriBadalahtelbivudinedantenofovirdimana
obatinitidakmemperlihatkanadanyaresikopadajaninpadastuditerhadapbinatang
percobaan dan tidak ada studi terkontrol pada wanita hamil atau pada binatang
percobaan memperlihatkan adanya efek samping yang tidak terjadi pada studi
terkontrolterhadapwanitahamiltrisemester1dantidakadabuktimengenairesiko
padatrisemesterselanjutnya.
PemilihanterapiantiHBVpadawanitahamilsangatsulit.Terdapatbeberapa
parameteryangbiasanyadigunakanuntukmenentukanterapipadahepatitisB(usia,
stadiumpenyakit,komobiditas,jumlahvirus,genotype,kekuatandariagen,barrier
genetik,dll),pemilihanobatpadawanitausiasuburdipertimbangkanjugakeamanan
obatselamakehamilan,menyusuidanlamanyaterapi.
Pada kasus dimana perempuan yang tidak mendapat pengobatan HBV dan
berencanauntukhamil,makaterapidapatditundasetelahpersalinan.Contohnya,jika
perempuantersebutberadapadafaseimuntoleransisaatinfeksi(tingginyakadarDNA
HBV dengan ALT normal dan biopsi hepar inaktif) terapi dapat ditunda setelah
persalinan. Namun, perempuan dengan HBeAg positif dan viral load yang tinggi
makaprofilaksisharusdiberikanpadatrisemesterketigauntukmengurangitransmisi.
Padaperempuanyangdalampengobatandanhamil,jikaterdapatfibrosisyang
signifikanmakanterapiharustetapdilanjutkanuntukmengurangiresikoterjadinya
dekompensasio dari penyakit hepar. Ini memiliki efek yang negatif terhadap
kesehatanfetus.Jikamemungkinkandapatdigantidenganagenantiviralyanglebih
amanuntukkehamilan.
Kesimpulannya,pemilihanterapiantiHBVpadaperempuanhamiltergantung
daritujuanpengobatanapakahuntukmenanganipenyakithepatakutdimanaterapi
tidakdapatditundaatauuntukmencegahtransmisiinfeksipadafetusdaritingginya
viremiapadaibutanpakelainanheparyangsignifikan.Padaperempuanyangsedang
dalam pengobatan dan hamil makan obat dapat dilanjutkan atau dihentikan atau
digantidenganobatkategoriB.

Semuaperempuanhamilpadatrisemesterpertamaharusmelakukanskrining
terhadapinfeksiHBV.Jikahasilnyanegatif,tidakdiperlukanvaksinasiyangrutin
selamahamil,meskipunamandanharusdiberikanpadamerekadenganresikotinggi:
bergantiganti pasangan (lebih dari dua dalam waktu 6 bulan terakhir), riwayat
penyakitmenularseksualatauterinfeksipenyakitmenularseksual,Intravenousdrug
users,tinggaldidaerahendemikHBV,danmerekadenganpasanganHBsAgpositif.
PadabayidiberikanvaksinasiterhadaphepatitisBdanvaksinasilainnya.Jikapada
perempuanhamildidapatkanhasilyangpositifpadaawalkehamilan,perludiketahui
statusdaripenyakittersebut.JikaperempuantersebutdidapatkaninfeksiHBVyang
sangataktif(peningkatanALTyangsignifikandenganviralloadyangtinggi),atau
dengan suspek sirosis, terapi harus diberikan tanpa melihat usia gestasi. Jika
perempuantersebutterinfeksidalamkeadaanyanginaktif(ALTrendahdanViral
loadrendah)terapitidakdiperlukandanpengawasanberlanjuttetapdilakukanuntuk
mencegahresikoterjadipeningkatanVHBnantinyapadakehamilandanbeberapa
bulansetelahpostpartum.
Kuantitas dari DNA HBV direkomendasikan pada semua perempuan yang
terinfeksipadaakhirtrisemesterkedua(usiakehamilan2628minggu):jikaviral
load>106 kopi/mL,profilaksisantiviraluntuktransmisiHBVpadaneonatusdapat
diberikanpadaawaltrisemesterketiga(2830minggu).

Gambar7.AlgoritmapenanganganinfeksiVHBsaatkehamilan
2.2.5Imunoprofilaksis

Pada juli 2004, WHO merekomendasikan vaksin HBV dimasukkan dalam


programimunisasinasionaldanneonatuspadadaerahendemikHBVuntukdiberikan
vaksinHBVsaatlahirdandiikuti23dosisselanjutnya.Pemberianvaksindalam3
dosismemperlihatkankonsentrasiantibodyproteksipda95%bayidananakdan90%
padamasadewasa.
Di Australia di rekomendasikan untuk memberikan dosis awal vaksin HBV
dalamwaktu24jamsetelahlahir,diikutidengan3dosisberturutturutpadabulanke
2,4,dan6atau12bulan.PadabayiyanglahirdariibudenganinfeksiHBVkronik
diberikanimunoprofilaksissecaraaktifdanpasifyaitusatudosisawalvaksinHBV
dansatudosisHBIGsegerasetelahlahir,dandiikutidengan3dosisvaksinHBVpada
dalamtahunpertamakehidupan.Tujuandaristrategiiniadalahuntukmengurangi
transmisi dari ibu ke bayi saat masa nifas, infeksi akut pada usia ini dapat
menyebabkanresikotinggiuntukmenjadiinfeksikronikkarenatoleransiimunpada
sistemimunbayiyangimatur.Setelahserangkaianvaksinlengkapdiberikanmaka
pemeriksaan terhadap HBsAG dan antibody terhadap HBsAg (antiHBs) harus
dilakukanpadausia9sampai18bulan.HBsAgnegatifdengankadarantiHBslebih
dari 10 mIU/mL dianggap sebagai imun dan tidak diperlukan managemen terapi
lanjutan.JikaantiHBskurangdari10mIU/mlLmakaperludilakukanvaksinulang(3
dosis)diikutidenganpemeriksaanulangdalamwaktu1sampai2bulansetelahdosis
akhir.
AdanyaantiHBsibupadabayiyanglahirdariibudenganimunitasterhadap
hepatitisB(melaluiplasentadanASI)walaupundalamkonsentrasiyangbesar,tidak
menunjukkanefekyangpanjangterhadapHBV.PemberianvaksinHBVtetapharus
diberikan.5

Gambar8.AlgoritmapencegahantransmisiinfeksiHBVprenatal

2.2.6PenanganananakdanibudenganHBsAg(+)
Dinegaraberkembang,termasukIndonesia,penularanvirusHepatitisBsecara
vertikalmasihmemegangperananpentingdalampenyebaranvirusHepatitisB.Selain
itu, 90% anak yang tertular secara vertikal dari ibu dengan HBsAg (+) akan
berkembang mengalami Hepatitis B kronis. Maka pencegahan penularan secara
vertikal merupakan salah satu aspek yang paling penting dalam memutus rantai
penularanHepatitisB.
Langkahawalpencegahanpenularansecaravertikaladalahdenganmengetahui

statusHBsAgibuhamil.Langkahinibisadilakukandenganmelakukanpenapisan
HBsAg pada setiap ibu hamil. Metode penapisan HBsAg bisa menggunakan
pemeriksaancepat(rapidtest).Penapisaninisebaiknyadiikutiolehsemuawanita
hamilpadatrimesterpertamakehamilannya.Halinidimaksudkanagaribu,keluarga,
dan tenaga medis memiliki kesempatan untuk mempersiapkan tindakan yang
diperlukanapabilaibumemilikistatusHBsAg(+).Pelayananpemeriksaanpenapisan
HepatitisBinidapatdilaksanakandandisediakanpadasaranapelayanankesehatan
olehtenagakesehatanyangtelahdilatih.
ApabilaibuyangakanmelahirkanmemilikistatusHBsAg(+)danHBeAg(+),
maka persalinan ibu tersebut wajib dilakukan/didampingi oleh tenaga medis yang
terlatih.BayiyanglahirdariibudenganHBsAg(+)danHBeAg(+)disarankansegera
mendapat suntikan HBIG 0,5 mL dan vaksin Hepatitis B. Kedua suntikan ini
diberikan segera setelah bayi dilahirkan (kurang dari usia 12 jam). Pemberian
imunisasiselanjutnyasesuaiProgramImunisasiHepatitisBNasional(padabulanke
2,3dan4).SelanjutnyaperludiketahuistatusHBsAgdanantiHBsnyapadasaatbayi
berusia912bulan.
Ibu dengan HBsAg (+) dan HBeAg (+) harus dirujuk ke dokter ahli untuk
berkonsultasimengenaikemungkinanterapipenyakitnya.Penderitajugasebaiknya
diperiksakanstatus,antiHBe,DNAVHB,danALTnya.IbuyangpositifHepatitisB
disarankanuntuktetapmenyusuibayinya.
ApabilaibuyangakanmelahirkanmemilikistatusHBsAg(+)danHBeAg(),
maka persalinan ibu tersebut wajib dilakukan/didampingi oleh tenaga medis yang
terlatih.Sesuaianjuranprogramimunisasi,bayisegeramendapatkanimunisasiHB0,
sedangkan ibunya sebaiknya mendapat konseling dari dokter ahli Penyakit Dalam
ataudokteryangtelahdilatihtentangHepatitisBvirus.