Anda di halaman 1dari 10

Makalah Zat Aditif Makanan

KATAPENGANTAR
PujidansyukurdipanjatkankehadiratTuhanYangMahaEsa,karena
atas perkenaan dan penyertaanNya penulis masih dapat diberi kesempatan
untukmenyelesaikanhasilpenelitiantentangZatAditifMakanan.
Penulisjugamengucapkanterimakasihyangsebesarbesarnyakepada
ibu Alfrida Payuk, S.Pd. selaku guru mata pelajaran Biologi yang telah
memberikanbimbingandanarahandalamprosespembuatanlaporanini.Tanpa
tuntunandaribeliau,penulistidakakanbisamenyelesaikanlaporaninidengan
baik.Uraiandalammakalahinipenulissusunberdasarkanbukudansumber
websiteyangrelevandengantopiktersebut.
Didalamlaporaninimembahasberbagaimanfaatdanakibatburukdari
zat aditif. Namun, penulis menyadari masih banyak kekurangan dalam
penulisan laporan ini. Penulis memohon kiranya pembaca dapat memaklumi
keberadaan penulis sebagai pelajar yang masih membutuhkan tuntunan dari
berbagaipihak.
Akhir kata, penulis tetap berharap laporan ini dapat berguna dan
memberi manfaat baik bagi pembaca. Namun, kritik dan saran sangat di
harapkandaripembaca.
Sekian,terimakasih.

Penulis
Februari2015

BABI
PENDAHULUAN
A.Latarbelakang

Setiap hari kita memerlukan makanan untuk mendapatkan energi (karbohidrat dan
lemak) dan untuk pertumbuhan selsel baru, menggantikan selsel yang rusak (protein).
Selainitu,kitajugamemerlukanmakanansebagaisumberzatpenunjangdanpengaturproses
dalamtubuh,yaituvitamin,mineral,danair.
Sehat tidaknya suatu makanan tidak bergantung pada ukuran, bentuk, warna,
kelezatan,aroma,ataukesegarannya,tetapibergantungpadakandunganzatyangdiperlukan
olehtubuh.Suatumakanandikatakansehatapabilamengandungsatumacamataulebihzat
yangdiperlukanolehtubuh.Setiaphari,kitaperlumengonsumsimakananyangberagamagar
semuajeniszatyangdiperlukanolehtubuhterpenuhi.Halinidikarenakanbelumtentusatu
jenismakananmengandungsemuajeniszatyangdiperlukanolehtubuhsetiaphari.
Supaya orang tertarik untuk memakan suatu makanan, seringkali kita perlu
menambahkanbahanbahantambahankedalammakananyangkitaolah.Bisakitaperkirakan
bahwa seseorang tentu tidak akan punya selera untuk memakan sayur sop yang tidak
digaramiataububurkacanghijauyangtidakmemakaigula.Dalamhalini,garamdangula
termasuk bahan tambahan. Keduanya termasuk jenis zat aditif makanan.Zat aditifbukan
hanyagaramdangulasaja,tetapimasihbanyakbahanbahankimialain.
Zataditifmakananditambahkandandicampurkanpadawaktupengolahanmakanan
untukmemperbaikitampilanmakanan,meningkatkancitarasa,memperkayakandungangizi,
menjagamakananagartidakcepatbusuk,danlain.
Penggunaanzataditifsendirisudahberlangsungsejaklamadimasyarakat,baikyang
sintetismaupunalami.Dansaatinihampirsemuaorangsangatbergantungpadapenggunaan
zat aditif ini dalam kehidupannya. Dalam industri makanan dan minuman, zat aditif ini
merupakan faktor kunci untuk menghasilkan produk yang baik dan disenangi konsumen.
Sedangkan penggunaannya untuk keperluan rumah tangga bertujuan untuk meningkatkan
citarasadarisuatumakanan.

B.Tujuan
Makalahinibertujuanagarpembacadapatmengetahuidampakpositifdandampak
negatifdarizataditif.

C.Rumusanmasalah
1.Apakahpengertiandarizataditif?

2.Bagaimanakahmacammacamdarizataditif?
3.Apacontohmakananyangmengandungzataditifberbahaya?
4.Bagaimananakahkelebihandankekurangandarizataditif?

D.Manfaat
1.Pembacadapatmengetahuipengertianzataditif.
2.Pembacadapatmengetahuimacammacamzataditif.
3.Pembacadapatmengetahuimakananyangmengandungzataditifberbahaya.
4.Pembacadapatmengetahuikelebihandankekuranganzataditif.

BABII
PEMBAHASAN
A.Pengertianzataditif

IstilahzataditifsendirimulaifamiliarditengahmasyarakatIndonesiasetelahmerebak
kasuspenggunaanformalinpadabeberapaprodukolahanpangan,tahu,ikandandagingyang
terjadipadabeberapabulanbelakangan.Formalinsendiridigunakansebagaizatpengawet
agarprodukolahantersebuttidaklekasbusuk/terjauhdarimikroorganisme.Penyalahgunaan
formalininimembukakacamatamasyarakatuntukbersifatproaktifdalammemilahmilah
mana zat aditif yang dapat dikonsumsi dan mana yang berbahaya.Zat aditif makanan
merupakan zat yang biasanya ditambahkan ke dalam makanan selama pengolahan untuk
menyimpannyauntukwaktuyanglama.
Secaraumum,zataditifmakanandapatdibagimenjadiduayaitu:
Aditifsengaja,yaituaditifyangdiberikandengansengajadenganmaksuddantujuantertentu,
seperti untuk meningkatkan nilai gizi, cita rasa, mengendalikan keasaman dan kebasaan,
memantapkanbentukdanrupa,danlainsebagainya.
Aditif tidak sengaja, yaitu aditif yang terdapat dalam makanan dalam jumlah sangat kecil
sebagaiakibatdariprosespengolahan.
Biladilihatdarisumbernya,zataditifdapatberasaldarisumberalamiahsepertilesitin,
asamsitrat,danlainlain,dapatjugadisintesisdaribahankimiayangmempunyaisifatserupa
dengan bahan alamiah yang sejenis, baik susunan kimia, maupun sifat metabolismenya
seperti karoten, asam askorbat, dan lainlain. Pada umumnya bahan sintetis mempunyai
kelebihan, yaitu lebih pekat, lebih stabil, dan lebih murah. Walaupun demikian ada
kelemahannyayaituseringterjadiketidaksempurnaanprosessehinggamengandungzatzat
berbahayabagikesehatan,dankadangkadangbersifatkarsinogenyangdapatmerangsang
terjadinyakankerpadahewandanmanusia.
Zataditif makanan atau lebih dikenal dengan bahan tambahan makanan (BTM)
mungkintidakbegitufamiliarditelinganmasyarakat,tapijenisjenisdaribahantambahan
panganpastisudahbanyakdigunakaknolehmasyarakatseharihari.ZataditifatauBTM
merupakansemuajeniszatyangditambahkandalammakananmaupunminumanyangkita
konsumsiseharihari.Zataditifyangadadipasaranamemilikibanyakmacam,beberapajenis
darizataditifdiantaranyapewarna,pengawet,pemanis,penyedap,pengental,pengemulsi,
sertamasihbanyakyanglain.Penambahanzataditifinibertujuanuntukmemperbaikiwarna,
citarasa,penampakan,tekstur,flavor,sertamemperpanjangdayasimpandarisuatumakanan.
Zataditifsendiriterdiridariduajenis,yaituzataditifalamidansintetis.Zataditif
alamimerupakanzataditifyangberasaldaritanaman,hewan,danprodukturunannyayang
tidak mengalami proses pengolahan industri dan tidak ditambahkan bahanbahan kimia.
Sedangkan zat aditif sintetis merupakan zat aditif yang diproduksi oleh industri modern
dengan menggunakan berbagai campuran bahanbahan kimia. Kedua jenis zat aditif ini
memilikikeunggulandankekuranganmasingmasingdanmemilikipeminatsendirisendiri.
Peningkatanpermintaanzataditifdimasyarakatmenjadipeluangparaprodusenuntuk
memproduksi zat aditif dengan berbagai macam dan jenisnya yang sangat banyak. Dan
penggunaan zat aditif sintetis ini semakin hari semakin meningkat penggunaannya oleh
industrimakanandanminumansertarumahtangga.Banyakmasyarakatyanglebihmemilih
menggunakanzataditifsintetisinikarenaalasankepraktisandanhasilyangdidapatkanbisa
maksimal.Namun,penggunaanzataditifsintetisdalammakanandanminumandibatasioleh

aturanpemerintahdalamUUNo.7tahun1996tentangPangan.Pembatasaninibertujuan
untukmembatasipenggunaanzataditifsintetisyangberlebihandalammakananyangkita
konsumsiseharihari,karenabagaimanapunzataditifsintetisterbuatdaribahanbahankimia
yang asing bagi tubuh. Akumulasi bahanbahan kimia ini dalam waktu lama pasti akan
memberikan efek negatif bagi tubuh, hal inilah yang menjadi alasan terkait pembatasan
penggunaanzataditifsintetis.
Sedangkanuntukzataditifalamimerupakansemuajeniszattambahanmakananyang
berasaldarialamtanpamenggunakanpengolahandanbahantambahankimiawi.Padaawal
penggunaanzataditif,jenisalamiinilahyangbanyakdigunakan,tetapiseiringberjalannya
waktudanmeningkatnyakebutuhanakanzataditif,banyakorangberalihdarizataditifalami
kezataditifsintetis.Alasankepraktisandanhasilyanglebihbaikmenjadialasanutama
masyarakat meniggalkan zat aditif alami ini. Namun, meskipun demikian ada beberapa
masyarakatyangmasihsetiamenggunakanzataditifalamiini,denganalasankeamanandan
tanpaefeksamping,membuatmasyarakattetapsetia.Zataditifalamimemilikikelebihan
tidakmenimbulkanefeksampingberbahayabagitubuh,karenaberasaldaribahanalamidan
tidakditambahkanbahanbahankimia.Namun,kelemahandarizataditifalamiiniadalah
kepraktisandanhasilyangdihasilkantidaksebaikzataditifsintetis.
Pemilihan penggunaan zat aditif sintetis maupun alami memiliki keunggulan dan
kelemahanmasingmasing.Danyangperludiperhatikanketikaandamemilihpenggunaanzat
aditif sintetis adalah batasi penggunaannya, jangan terlalu banyak mengkonsumsinya dan
janganterlalusering.Karenasekalilagizataditifsintetisterbuatdaribahanbahanyangasing
bagi tubuh, sehingga akumulasinya dalam tubuh dapat menimbulkan reaksi tertentu pada
tubuh.Lebihbijakdanselektifdalammemilihmakananyangakankitakonsumsiadalahcara
cerdasuntukmenjagatubuhkita.

B.Macammacamzataditif

Zataditifpadamakanan,adayangberasaldarialamdanadayangbuatan(sintetik).
Untukzataditifalamitidakbanyakmenyebabkanefeksamping.Lainhalnyadenganzat
aditifsintetik.
Beberapazataditifdarialamyangseringdigunakandalamkehidupanseharihari,
yaitu:
1.Pewarna.
Contohnya:Daunpandan(hijau),kunyit(kuning),buahcoklat(coklat),wortel(orange),
anato(orange),karamel(cokelathitam),betakaroten(kuning)danklorofil(hijau).
2.Penyedap.
Contohnya:Pala,merica,cabai,laos,kunyit,ketumbar.
3.Pengawet.
Contohnya : asam cuka (untuk acar), gula (untuk manisan), dan garam (untuk asinan
ikan/telur). Selain itu beberapa bahan alam misalnya saja penambahan air jeruk atau air
garam yang dapat digunakan untuk menghambat terjadinya proses reaksi waktu coklat
(browingreaction)padabuahapel.
4.Pengemusi.
Contohnya:putihtelur.
Beberapazataditifsintetikyangseringdigunakandalamberanekajenismakanan,

yaitu:
5.ZatPewarna

Zat pewarna adalah bahan yang dapat memberi warna pada makanan, sehingga
makanantersebutlebihmenarik.Tartrazinadalahpewarnamakananbuatanyangmempunyai
banyakmacampilihanwarna,diantaranyaTartrazinCI19140.Contohpewarnasintetik:biru
berlian(biru),coklatHT(coklat),eritrosit(merah)danhijauFCF(hijau).
6.Penyedaprasadanaroma(flavor).
Penyedaprasadanaromayangbanyakdigunakanberasaldarigolonganester.Contoh:
Isoamilasetat(rasapisang),isoamilvalerat(rasaapel),butilbutirat(rasananas),isobutil
propionat(rasarum).
7.Penguatrasa(flavourechancer).
Bahanpenguatrasaataupenyedapmakananyangpalingbanyakdigunakanadalah
MSG(MonosodiumGlutamate)yangsehariharidikenaldengannamavetsin.MSGsebagai
penguat rasa makanan dan juga untuk melezatkan makanan. MSG merupakan zat aditif
makananbuatan,sedangkanyangalamidiantaranyaadalahbungacengkeh.
8.Zatpemanisbuatan.
Bahan ini tidak atau hampir tidak mempunyai nilai gizi, contohnya
sakarin(kemanisannya500xgula),dulsin(kemanisannya250xgula),dannatriumsiklamat
(kemanisannya50xgula)danserbitol.
9.Pengawet.
Pengawet adalah bahan yang dapat mencegah atau menghambat fermentasi,
pengasamanataupenguraianlainterhadapmakananyangdisebabkanmikroorganisme.Zat
pengawetdimaksudkanuntukmemperlambatoksidasiyangdapatmerusakmakanan.
Contohbahanpengawetdanpenggunaannya:
Asam benzoat, natrium benzoat dan kalium benzoat, untuk minuman ringan,
kecap,acarketimundalambotoldancaos.
Natriumnitrat(NaNo3),untukdagingolahandankeju.
Natriumnitrit(NaNo2),untukdagingolahan,dagingawetandankornetkalangan.
Asampropionate,untukrotidansediaankejuolahan.
10.Antioksidan.
Zataditifinidapatmencegahataumenghambatoksidasi.Contohnya:
Asam askorbat (bentukan garam kalium, natrium, dan kalium), digunakan
padadagingolahan,kaldu,danbuahkalangan.
Butilhidroksianisol(BHA),digunakanuntuklemakdanminyakmakanan.
Butil hidroksitoluen (BHT), digunakan untuk lemak, minyak makan, margarine dan
mentega.
11.Pengemulsi,pemantap,danpengental.
Zataditifinidapatmembantupembentukanataupemantapansistemdispersiyanghomogen
padamakanan.GomArabadalahbahanaditifalamiyanggunanyauntukmengemulsiminyak
danairagardapatbersatu.Garamalginatdangliserinmerupakanbahanaditifbuatanyang
digunakanuntukmenstabilkandanmemekatkansuatumakanansehingggadapatmembuat
makananberteksturlembutdanrata.
Contoh:agaragar,gelatin,dangomarab.
12.Pemutihdanpematangtepung.
Zat aditif ini dapat mempercepat proses pemutihan atau pematangan tepung
sehinggadapatmemperbaikimutupemanggangan.
Contoh:Asamaskorbat,asetonperoksida,dankaliumbromat
13.Pengaturkeasaman.
Zat aditif ini dapat mengasamkan, menetralkan, dan mempertahankan derajat
keasamanmakanan.

Contoh:asamasetat,aluminiumamoniumsulfat,ammoniumbikarbonat,asamklorida,asam
laktat,asamsitrat,asamtentrat,dannatriumbikarbonat
14.
Antikempal.
Zat aditif ini dapat mencegah pengempalan makanan yang berupa serbuk.
Contoh:aluminiumsilikat(susububuk),dankalsiumaluminiumsilikat(garammeja).
15.
Pengeras.
Zat aditif ini dapat memperkeras atau mencegah melunaknya makanan.
Contoh:aluminiumamoniumsulfat(padaacarketimunbotol),dankaliumglukonat(pada
buahkalangan).
16.
Sekuestran.
Merupakanbahan yang mengikat ion logam yang ada dalam makanan.
Contoh:asamfosfat(padalemakdanminyakmakan),kaliumsitrat(dalameskrim),kalsium
dinatriumEDTAdandinatriumEDTA.
17.
Penambahgizi.
Zataditifyangditambahkanadalahasamamino,mineral,atauvitaminuntukmemperbaik
gizi

makanan.
Contohnya:Asamaskorbat,ferifosfat,vitaminA,danvitaminD.

C.ContohMakananYangMengandungZatAditifBerbahaya

a.Zataditifyangterkandungdalammieinstan
oPemanis:Gula
oPengawet:1.NatriumBenzoat
2.Natriummetabisolfit
oAntioksidan:TBHQ
oPengaturkeasaman
oPewarna:tartazinCl19140
5
oPenguatrasa:1.dinatriuminosinat
2.monoatriumglutamat
oPenguatrasa:nabatidantripolifosfat

b.DampakNegatifZatAditifDalamMieInstan
1.Gula
Konsumsigulaberlebihanmemangdapatmemperburukkesehatantubuh.Karenaitu,gula
seringkalidihindariuntukmencegahberbagaipenyakit,sepertiseranganjantung,selulit,dan
penumpukanlemak.Namun,menurutsebuahpenelitian,konsumsiguladalamtingkatyang
amanpundapatmemilikiefekburukbagikesehatan.
DalampenelitianyangdilakukanolehUniversityofUtah,parapenelitimemberikantakaran
gula yang sama dengan takaran gula diet sehat manusia, kepada tikus betina. Hasilnya,

ditemukanbahwatikusbetinatersebut,meninggalduakalilebihcepatsetelahmengonsumsi
makananyangsebagianbesarnyamengandunggula.
2.Natriumbenzoat
DampaknegatifpadaNatriumbenzoat:
Kandunganbahanpengawetyangadapadamieinstanumumnyatidakterlalubesar.Akan
tetapi,jikadikonsumsiterusmenerustentuakanberkomulasidanmenimbulkanefekterhadap
kesehatan
Dampak lain adalah kanker. Dikonsumsi secara berlebihan dapat timbul efek samping
berupa edema(bengkak ) yang dapat terjadi karena retensi atau tertahannya cairan dalam
tubuh
Naiknyatekanandarahsebagaiakibatbertambahnyavolumeplasmalantaranpengikatanair
olehnatrium
Natriumbenzoatbisamemicuterjadinyaseranganasma
3.TBHQ

penuaan dan penyakit degeneratif seperti kanker kardiovaskuler, penyumbatan


pembuluh darah yang meliputi hiperlipidemik, aterosklerosis, stroke, dan tekanan darah
tinggisertaterganggunyasistemimuntubuhdapatdisebabkanolehstress
6
oksidatif.Stressoksidatifadalahkeadaantidakseimbangnyajumlahoksidandanprooksidan
dalam tubuh. Pada kondisi ini, aktivitas molekul radikal bebas ataureactive oxygen
species(ROS)dapatmenimbulkankerusakanselulerdangenetika.Kekuranganzatgizidan
adanyasenyawaxenobiotikdarimakananataulingkunganyangterpolusiakanmemperparah
keadaantersebut.

4.Pengaturkeasaman
Zat aditif ini dapatmengasamkan, menetralkan, dan mempertahankanderajat
keasamanmakanan.Contoh:asamasetat,aluminiumamoniumsulfat,amoniumbikarbonat,
asamklorida,asamlaktat,asamsitrat,asamtentrat,dannatriumbikarbona.
5.tartazinCl19140
Pada penggunaannya, dilaporkan muncul reaksi hipersensitifitas (alergi) pada
penderitaasma,tumorpadaanakanakdanintolerasipadaaspirin.Halitubisaterjadikarena
tertelan tartrazin ataupun kontak langsung kulit dengan tartrazin. Insidensi kejadian
intoleransiterhadaptartrazininirelatifsedikit,sehinggadisimpulkanpenggunaannyapada
dosis minimal masih dianggap cukup aman. Namun, setiap bahan makanan
yangmengandungtartrazinharusdisebutkanpadalabelkemasan.DiAmerika,FDA(Food
andDrugAdministration)secararutinmemeriksakalaukalauadaprodukyangmengandung
tartrazinnamuntidakmencantumkannya.
6.monoatriumglutamat
Berikutadalahbeberapaefeksampingdangangguanspesifikyangberhubungandengan
MSGmenurutBlaylock:
1.Kejang
2.Mual
3.Alergi
4.Ruam

5.Seranganasma
6.Sakitkepala
7.Hilangingatan

c.UpayaMenanggulangi

Caramengurangidampaknegatifpadamieinstan
1.GantiAir
Saatmerebusmieinstanttentunyaterdapatairkuahyangtersisa.Jikamietersebutberupa
mie kuah, maka setelah mie direbus buanglah kuah dari hasil rebusan tadi. Kemudian
gantilah dengan air panas lain. Hal ini bertujuan agar zat pengawet dan lainnya yang
terkandungdalammieinstantterbuangbersamakuahtadi.
2.JanganMerebusBumbu
Saatmembuatmieinstantbiasanyasudahterterabagaimanacaramemasakyangbenar.Akan
tetapi beberapa orang malah memasak mie dengan mencampurkan bumbu saat merebus.
Tentunyainiakanmenimbulkandampakyanglebihberbahaya.Dampaktersebutmunculdari
MSGyangdirebus.MSGyangdipanaskanakanberubahmenjadizatkarsinogenyangsangat
berbahayakarenamamputerjadinyakanker.
3.KurangiBumbuDanGantiDenganBumbuAlami
Sepertiyangdiketahuibumbuyangdisiapkanolehpabrikanterdapatbebagaimacamzatyang
berbahayabagitubuh.Untukitukurangipenggunaanbumbutersebutdangantilahdengan
bumbudapuralami.Bumbudapuralamisepertibawang,merica,garamkemiri,dll.
4.HindariKonsumsiberlebihan
Salah satucara terbaikuntukmenghindari dampatnegatifdari mengkonsumsimieinstant
tentunyaadalahtidakmengkonsumsiberlebihandantidakmengkonsumsisecararutin.

D.Kelebihandankekuranganzataditif.
1.Kelebihanzataditif.
Penggunaan zat aditif memiliki keuntungan meningkatkan mutu makanan dan
pengaruhnegatifbahantambahanpanganterhadapkesehatan.Agar makanan dapat
tersediadalambentukyanglebihmenarikdenganrasayangenak,rupadankonsentrasinya
baiksertaawetmakaperluditambahkanbahanmakananataudikenaldengannamalainfood
additive.Zataditifjugamenambahrasadanmembuatmakananterlihatlebihmenariksecara
visual,mencegahmakanandarirakmenjadibasidanmeningkatkankehidupan,mencegah
pertumbuhanbakteridanjamuryangmenyebabkankeracunanmakanan.
2.Kekuranganzataditif.
Bahanaditifjugabisamembuatpenyakitjikatidakdigunakansesuaidosis,apalagi
bahanaditifbuatanatausintetis.Penyakityangbiasatimbuldalamjangkawaktulamasetelah
menggunakansuatubahanaditifadalahkanker,kerusakanginjal,danlainlain.Zataditif
juga dapat menyebabkan reaksi alergi terhadap orangorang seperti diare, ruam kulit,
gangguanperut,nyeridada,asma,sensasikesemutan,mualataumeningkatnyapanastubuh.

BABIII
PENUTUP
A.Kesimpulan
Zataditifmakananmerupakanzatyangbiasanyaditambahkankedalammakananselama
pengolahanuntukmenyimpannyauntukwaktuyanglama.Berdasarkanhasilanalisisdiatas,
dapatkitasimpulkanbahwaperilakumenyimpangpengusahaadalahmencampurkanbahan
bahanbahayakedalammakananmasyarakatyangrataratamenyukaibahkanbisamenjadi
menumakanseharihari.Tapi,ternyatahalitusangatmembahayakanbagipengonsumsibila
dikonsumsisecaraberlebihanatausecararutin.Denganadanyamasalahinimasyarakatharus
pandaidalamhalsaji.

B.Saran

Setelah kita mengetahui kelebihan dan kekurangan zat aditif, sekiranya kita dapat
memilahmilihjenismakananapayangbaikuntukdikonsumsi.