Anda di halaman 1dari 17

Casereportsession

CongestiveHeartFailuree.cHipertiroid

WahyuUtamiHarli1110312138
RiriAgsari1110313057

Preseptor
dr.HSadeliMartinusSp.PD

BagianIlmuPenyakitDalam
FakultasKedokteranUniversitasAndalas
RSUDPariaman
1

2016
BABI
TINJAUANPUSTAKA
1.1GagalJantungKongestif(CHF)
1.1.1DefinisiCHF
Gagaljantungkongestifadalahketidakmampuanjantungmemompadarahdalamjumlah
yangcukupuntukmemenuhikebutuhanjaringanterhadapoksigendannutrien.2
Gagaljantungkongestifadalahkeadaanpatofisiologisberupakelainanfungsijantung,sehingga
jantungtidakmampumemompadarahuntukmemenuhikebutuhanmetabolismejaringanatau
kemampuannya hanya ada kalau disertai peninggian volume diastolik secara abnormal.
Penamaangagaljantungkongestifyangseringdigunakankalauterjadigagaljantungsisikiridan
sisikanan.1
1.1.2EtiologiCHF
Gagaljantungkongestifdapatdisebabkanoleh:
1. Kelainanototjantung
Gagaljantungseringterjadipadapenderitakelainanototjantung,disebabkanmenurunnya
kontraktilitasjantung.Kondisiyangmendasaripenyebabkelainanfungsiototmencakup
ateriosklerosiskoroner,hipertensiarterial,danpenyakitdegeneratifatauinflamasi.4
2. Aterosklerosiskoroner
Mengakibatkandisfungsimiokardiumkarenaterganggunyaalirandarahkeototjantung.
Terjadi hipoksia dan asidosis (akibat penumpukan asam laktat). Infark miokardium
(kematian seljantung)biasanyamendahului terjadinya gagaljantung.Peradangan dan
penyakitmiokardiumdegeneratif,berhubungandengangagaljantungkarenakondisiyang
secaralangsungmerusakserabutjantung,menyebabkankontraktilitasmenurun.4
3. Hipertensisistemikataupulmonal
Meningkatkanbebankerjajantungdanpadagilirannyamengakibatkanhipertrofiserabut
ototjantung.4
4. Peradangandanpenyakitmiokardiumdegeneratif
Berhubungandengangagaljantungkarenakondisiinisecaralangsungmerusakserabut
jantungmenyebabkankontraktilitasmenurun.4
5. Hipertiroid
T3menurunkanekspresigenbetamiosinrantaiberatsekaligusmenaikkanekspresialfa
miosin rantai berat,menghasilkan efek hipertrofi dan peningkatan kontraktilitas
kardiomiosit.6
6. Penyakitjantunglain
2

Gagaljantungdapatterjadisebagaiakibatpenyakitjantungyangsebenarnya,yangsecara
langsungmempengaruhijantung.Mekanismebiasanyaterlibatmencakupgangguanaliran
darahyangmasukjantung(stenosis katupsemiluner), ketidakmampuan jantunguntuk
mengisi darah (tamponade, perikardium, perikarditif konstriktif, atau stenosis AV),
peningkatanmendadakafterload.4
7. Faktorsistemik
Terdapatsejumlahbesarfaktoryangberperandalamperkembangandanberatnyagagal
jantung.Meningkatnyalajumetabolisme(misal:demam),hipoksiadananemiadiperlukan
peningkatancurahjantunguntukmemenuhikebutuhanoksigensistemik.Hipoksiadan
anemia juga dapat menurunkan suplai oksigen ke jantung. Asidosis respiratorik atau
metabolikdanabnormalitaselektronikdapatmenurunkankontraktilitasjantung.4
1.1.3PatofisiologiCHF
Gagaljantungbukanlahsuatukeadaanklinisyanghanyamelibatkansatusistemtubuh
melainkan suatu sindroma klinik akibat kelainan jantung sehingga jantung tidak mampu
memompamemenuhikebutuhanmetabolismetubuh.Gagaljantungditandaidengansaturespon
hemodinamik, ginjal, syaraf dan hormonal yang nyata serta suatu keadaan patologik berupa
penurunanfungsijantung.Salahsaturesponhemodinamikyangtidaknormaladalahpeningkatan
tekanan pengisian (filling pressure) dari jantung atau preload. Respon terhadap jantung
menimbulkan beberapa mekanisme kompensasi yang bertujuan untuk meningkatkan volume
darah, volume ruang jantung, tahanan pembuluh darah perifer dan hipertropi otot jantung.
Kondisi ini juga menyebabkan aktivasi dari mekanisme kompensasi tubuh yang akut berupa
penimbunanairdangaramolehginjaldanaktivasisystemsarafadrenergik.Pentingdibedakan
antarakemampuanjantunguntukmemompa (pumpfunction) dengankontraktiliasototjantung
(myocardialfunction).
Pada beberapa keadaan ditemukan beban berlebihan sehingga timbul gagal jantung
sebagaipompatanpaterdapatdepresipadaototjantungintrinsik.Sebaliknyadapatpulaterjadi
depresiototjantungintrinsiktetapisecaraklinistidaktampaktandatandagagaljantungkarena
bebanjantungyangringan.PadaawalgagaljantungakibatCOyangrendah,didalamtubuh
terjadi peningkatan aktivitas saraf simpatis dan sistem renin angiotensin aldosteron, serta
pelepasan arginin vasopressin yang kesemuanya merupakan mekanisme kompensasi untuk
mempertahankan tekanan darah yangadekuat. Penurunankontraktilitas ventrikel akandiikuti
penurunan curah jantung yang selanjutnya terjadi penurunan tekanan darah dan penurunan
volumedaraharteriyangefektif.Haliniakanmerangsangmekanismekompensasineurohumoral.
Vasokonstriksi dan retensi air untuk sementara waktu akan meningkatkan tekanan darah
sedangkan peningkatan preload akan meningkatkan kontraktilitas jantung melalui hukum
Starling.Apabilakeadaaninitidaksegerateratasi,peninggianafterload,peninggianpreloaddan
hipertrofidilatasijantungakanlebihmenambahbebanjantungsehinggaterjadigagaljantung
3

yangtidakterkompensasi.Dilatasiventrikelmenyebabkandisfungsisistolik(penurunanfraksi
ejeksi) dan retensi cairan meningkatkan volume ventrikel (dilatasi). Jantung yang berdilatasi
tidak efisien secara mekanis (hukum Laplace). Jika persediaan energi terbatas (misal pada
penyakitkoroner)selanjutnyabisamenyebabkangangguankontraktilitas.2 Selainitukekakuan
ventrikelakanmenyebabkanterjadinyadisfungsiventrikel.4Padagagaljantungkongestifterjadi
stagnasialirandarah,embolisasisistemikdaritrombusmural,dandisritmiaventrikelrefrakter.24
Disamping itu keadaan penyakit jantung koroner sebagai salah satu etiologi CHF akan
menurunkan aliran darah ke miokard yang akan menyebabkan iskemik miokard dengan
komplikasi gangguan irama dan sistem konduksi kelistrikan jantung.4,10 Beberapa data
menyebutkan bradiaritmia danpenurunanaktivitas listrikmenunjukan peningkatan presentase
kematian jantung mendadak, karena frekuensi takikardi ventrikel dan fibrilasi ventrikel
menurun.11WHOmenyebutkankematianjantungmendadakbisaterjadiakibatpenurunanfungsi
mekanis jantung, seperti penurunan aktivitas listrik, ataupun keadaan seperti emboli sistemik
(embolipulmo,jantung)dankeadaanyangtelahdisebutkandiatas.
Mekanismeyangmendasarigagaljantungmeliputigangguankemampuankontraktilitas
jantung,yangmenyebabkancurahjantunglebihrendahdaricurahjantungnormal.Konsepcurah
jantungpalingbaikdijelaskandenganpersamaanCO=HRXSVdimanacurahjantungadalah
fungsi frekuensi jantung X volume sekuncup. Curah jantung yang berkurang mengakibatkan
sistemsarafsimpatisakanmempercepatfrekuensijantunguntukmempertahankancurahjantung,
bila mekanisme kompensasi untuk mempertahankan perfusi jaringan yang memadai, maka
volume sekuncup jantunglah yang harus menyesuaikan diri untuk mempertahankan curah
jantung.Tapipadagagaljantungdenganmasalahutamakerusakandankekakuanserabutotot
jantung,volumesekuncupberkurangdancurahjantungnormalmasihdapatdipertahankan.
Volumesekuncup,jumlahdarahyangdipompapadasetiapkontraksitergantungpadatigafaktor
yaitu:

Preload: setara dengan isi diastolik akhir yaitu jumlah darah yang mengisi jantung
berbanding langsung dengan tekanan yang ditimbulkan oleh panjangnya regangan
serabutjantung.

Kontraktilitas:mengacupadaperubahankekuatankontraksiyangterjadipadatingkatsel
danberhubungandenganperubahanpanjangserabutjantungdankadarkalsium.

Afterload:mengacupadabesarnyaventrikelyangharusdihasilkanuntukmemompa
darahmelawanperbedaantekananyangditimbulkanolehtekananarteriole.

1.1.4ManifestasiKlinisCHF
Manifestasiklinisgagaljantungbervariasi,tergantungdariumurpasien,beratnyagagal
jantung, etiologi penyakit jantung, ruangruangjantung yangterlibat, apakah keduaventrikel
mengalamikegagalansertaderajatgangguanpenampilanjantung.
Padapenderitagagaljantungkongestif,hampirselaluditemukan:
4

1)Gejalaparuberupadyspnea,orthopneadanparoxysmalnocturnaldyspnea.
2)Gejalasistemikberupalemah,cepatlelah,oliguri,nokturi,mual,muntah,asites,hepatomegali,
danedemaperifer.
3)Gejalasusunansarafpusatberupainsomnia,sakitkepala,mimpiburuksampaidelirium.8
1.1.5KomplikasiCHF
a) Tromboemboliadalahrisikoterjadinyabekuanvena(thrombosisvenadalamatau deep
venousthrombosis danemboliparuatauEP)danembolisistemiktinggi,terutamapada
CHFberat.Bisaditurunkandenganpemberianwarfarin.
b) KomplikasifibrilasiatriumseringterjadipadaCHFyangbisamenyebabkanperburukan
dramatis. Hal tersebut indikasi pemantauan denyut jantung (dengan digoxin atau
blockerdanpemberianwarfarin).
c) Kegagalan pompa progresif bisa terjadi karena penggunaan diuretik dengan dosis
ditinggikan.
d) Aritmiaventrikelseringdijumpai,bisamenyebabkansinkopatau suddencardiacdeath
(2550%kematianCHF).Padapasienyangberhasildiresusitasi,amiodaron, blocker,
danvebrilatoryangditanammungkinturutmempunyaiperanan.2
1.1.6PenatalaksanaanCHF
Dasarpenatalaksanaanpasiengagaljantungadalah:
1)Dukungistirahatuntukmengurangibebankerjajantung.
2)Meningkatkankekuatandanefisiensikontraksijantungdenganbahanbahanfarmakologis.
3)Menghilangkanpenimbunancairantubuhberlebihandenganterapidiuretikdietdanistirahat.9
1.1.6.1TerapiFarmakologi
a. Diuretik(Diuretiktiaziddanloopdiuretik)
Mengurangikongestifpulmonaldanedemaperifer,mengurangigejalavolumeberlebihan
seperti ortopnea dan dispnea noktural peroksimal, menurunkan volume plasma
selanjutnyamenurunkanpreloaduntukmengurangibebankerjajantungdankebutuhan
oksigendanjugamenurunkanafterloadagartekanandarahmenurun.3
b. Antagonisaldosteron
Menurunkanmortalitaspasiendengangagaljantungsedangsampaiberat.3
c. Obatinotropik
Meningkatkankontraksiototjantungdancurahjantung.3
d. Glikosidadigitalis
Meningkatkan kekuatan kontraksi otot jantung menyebabkan penurunan volume
distribusi.3
5

e. Vasodilator(Captopril,isosorbitdinitrat)
Mengurangi preload dan afterload yang berlebihan, dilatasi pembuluh darah vena
menyebabkanberkurangnyapreloadjantungdenganmeningkatkankapasitasvena.3
f. InhibitorACE
Mengurangi kadar angiostensin II dalam sirkulasi dan mengurangi sekresi aldosteron
sehinggamenyebabkanpenurunansekresinatriumdanair.Inhibitorinijugamenurunkan
retensivaskulervenadantekanandarahygmenyebabkanpeningkatancurahjantung.3
1.1.6.2Terapinonfarmakologi
Penderita dianjurkan untuk membatasi aktivitas sesuai beratnya keluhan seperti: diet rendah
garam, mengurangi berat badan, mengurangi lemak, mengurangi stress psikis, menghindari
rokok,olahragateratur.3
1.2Hipertiroid
1.2.1definisi,etiologidanepidemiologi
Penyakithipertiroidismmerupakanbentuktiroktoksikosisyangpalingseringdijumpaidalam
praktekseharihari.Dapatterjadipadasemuaumur,seringditemukanpadaperempuandaripadalaki
laki. Tanda dan gejala penyakit hipertiroid yang paling mudah dikenali ialah adanya struma
11

(hipertrofi dan hiperplasia difus), tirotoksikosis (hipersekresi kelenjar tiroid/ hipertiroidisme) dan
seringdisertaioftalmopati,dandisertaidermopatimeskipunjarang.Patogenesispenyakithipertiroid
sampaisejauhinibelumdiketahuisecarapasti.Didugafaktorgenetikdanlingkunganikutberperan
dalammekanismetersebut.13,14
Berdasarkan ciriciri penyakitnya, penyakit Graves dikelompokkan ke dalam penyakit
autoimun,antaralaindenganditemukannyaantiboditerhadapreseptorTSH(ThyrotropinStimulating
HormoneReceptorAntibody/TSHRAb)dengankadarbervariasi.PadapenyakitGraves,limfositT
mengalamiperangsanganterhadapantigenyangberadadidalamkelenjartiroidyangselanjutnyaakan
merangsanglimfositBuntukmensintesisantiboditerhadapantigentersebut.Antibodiyangdisintesis
akan bereaksi dengan reseptor TSH didalam membran sel tiroid sehingga akan merangsang
pertumbuhan dan fungsi sel tiroid, dikenal dengan TSHR antibodi. Adanya antibodi didalam
sirkulasi darah mempunyai korelasi yang erat dengan aktivitas dan kekambuhan penyakit.
Mekanisme autoimunitas merupakan faktor penting dalam patogenesis terjadinya hipertiroidisme,
oftalmopati,dandermopatipadapenyakitGraves.Sampaisaatinidikenalada3autoantigenutama
terhadapkelenjartiroidyaitutiroglobulin(Tg),thyroidalperoxidase(TPO)danTSHreseptor(TSH
R).

13,14,15

Disamping itu terdapat pula suatu protein dengan BM 64 kiloDalton pada permukaan
membran sel tiroid dan selsel orbita yang diduga berperan dalam proses terjadinya perubahan
kandungan orbita dan kelenjar tiroid penderitapenyakitGraves.

11,12

Selsel tiroid mempunyai

kemampuan bereaksi dengan antigen diatas dan bila terangsang oleh pengaruh sitokin (seperti
interferongamma)akanmengekspresikanmolekulmolekulpermukaanselkelasII(MHCkelasII,
sepertiDR4)untukmempresentasikanantigenpadalimfositT. 14
6

Gambar.1.1.
PatogenesispenyakitGraves3Faktorgenetikberperanpentingdalamprosesotoimun,antara
lainHLAB8danHLADR3padaraskaukasia,HLABw46danHLAB5padarascinadanHLA
B17padaorangkulithitam.Faktorlingkunganjugaikutberperandalampatogenesispenyakittiroid
autoimunsepertipenyakitGraves.Asupanyodiumyangtinggidapatmeningkatkankadariodinated
immunoglobulin yang bersifat lebih imunogenik sehingga meningkatkan kecenderungan untuk
terjadinyapenyakittiroidautoimun.

14

Hormontiroidmempengaruhihampirseluruhsistempadatubuh,termasukpadapertumbuhan
dan perkembangan, fungsi otot, fungsi Sistem Syaraf Simpatik, Sistem Kardiovaskular dan
metabolismekarbohidrat.

Homorntiroiddapatmempengaruhimetabolismekarbohidratbaikpada

14,15

kadar hormon yang meningkat (hipertiroid) ataupun menurun (hipotiroid). Penyakit Graves
merupakan penyebab paling umum hipertiroidisme. Sekitar 60% hipertiroidism disebabkan oleh
16

penyaktGraves.
Sampaisaatinibelumadadidapatkanangkayangpastiinsidensidanprevalensipenyakit
Graves di Indonesia. Sementara di Amerika Serikat Sebuah studi yang dilakukan di Olmstead
CountryMinnesotadiperkirakankejadiankirakira30kasusper100.000orangpertahun.Prevalensi
tirotoksikosis pada ibu adalah sekitar 1 kasus per 500 orang. Di antara penyebab tirotoksikosis
spontan,penyakitGravesadalahyangpalingumum 3.PenyakitGravesmerupakan6090%dari
semuapenyebabtirotoksikosisdiberbagaidaerahdidunia.DalamStudiWickhamdiBritaniaRaya,
dilaporkan100200kasusper100.000pendudukpertahun.InsidensipadawanitadiInggristelah
dilaporkan80kasusper100.000orangpertahun.Padapopulasiumumprevalensigangguanfungsi
hormon tiroid diperkirakan 6% 3 Wengjun Li dkk (2010) dari Fakultas Kedokteran Universitas
ShanghaiCina,menelititentanghubunganpenyakitGravesdanResistensiinsulin(RI),pada27
subjekpenyakitGravesterjadigangguanmetabolismeglukosasebesar63,0%denganRI44,4%.. 21
Chih H C dkk (2011) dari Divisi endokrin dan metabolik, bagian Penyakit Dalam, Kaohsiung
Veterans General Hospital, KaohsiungTaiwan meneliti tentang RI pada pasien hipertiroidism

sebelumdansesudahpengobatanhipertiroiddandijumpaiadanyaperbaikanRIpadapasienyang
mendapatpengobatanselama37bulan
1.2.2GambaranKlinis
Pada penyakit Graves terdapat dua kelompok gambaran utama yaitu tiroidal dan
ekstratiroidalyangkeduanyamungkintidaktampak.Ciriciritiroidalberupagoiterakibathiperplasia
kelenjar tiroid dan hipertiroidisme akibat sekresi hormon tiroid yang berlebihan. Gejalagejala
hipertiroidismeberupamanifestasihipermetabolismedanaktifitassimpatisyangberlebihan. Pasien
15

mengeluhlelah,gemetar,tidaktahanpanas,keringatsemakinbanyakbilapanas,kulitlembab,berat
badanmenurunwalaupunnafsumakanmeningkat,palpitasi,takikardi,diaredankelemahanserta
atrofiotot.

12,13,14

Manifestasiekstratiroidalberupaoftalmopatidaninfiltrasikulitlokalyangbiasanya

terbataspadatungkaibawah.Oftalmopatiyangditemukanpada50%sampai80%pasienditandai
denganmatamelotot,fissurapalpebramelebar,kedipanberkurang, lidlag (keterlambatankelopak
matadalammengikutigerakanmata)dankegagalankonvergensi.
GambaranklinikklasikdaripenyakitGravesantaralainadalahtritunggalhipertitoidisme,
goiterdifusdaneksoftalmus.12,13 Padapenderitayangberusialebihmuda,manifestasiklinisyang
umum ditemukan antara lain palpitasi, nervous, mudah capek, hiperkinesia, diare, berkeringat
banyak,tidaktahanpanasdanlebihsenangcuacadingin.Padawanitamudagejalautamapenyakit
Gravesdapatberupaamenoreatauinfertilitas.Padaanakanak,terjadipeningkatanpertumbuhandan
percepatanprosespematangantulang.Sedangkanpadapenderitausiatua(>60tahun),manifestasi
klinisyanglebihmencolokterutamaadalahmanifestasikardiovaskulerdanmiopati,ditandaidengan
adanyapalpitasi,dyspneadeffort,tremor,nervousdanpenurunanberatbadan.

13,14,17

1.2.3Pemeriksaanlaboratorium
Autoantiboditiroid,TgAb,danTPOAbdapatdijumpaibaikpadapenyakitGravesmaupun
tiroiditisHashimoto,namunTSHRAb(stim)lebihspesifikpadapenyakitGraves. 14Pemeriksaanini
bergunapadapasiendalamkeadaanapathetic hyperthyroid ataupadaeksoftamosunilateraltanpa
tandatandaklinisdanlaboratoriumyangjelas.Untukdapatmemahamihasilhasillaboratoriumpada
penyakit Graves dan hipertiroidisme umumnya, perlu mengetahui mekanisme umpan balik pada
hubungan(axis)antarakelenjarhipofisisdankelenjartiroid.Dalamkeadaannormal,kadarhormon
tiroidperifer,sepertiLtiroksin(T4)dantriiodotironin(T3)beradadalamkeseimbangandengan
thyrotropinstimulatinghormon(TSH).Artinya,bilaT3danT4rendah,makaproduksiTSHakan
meningkatdansebaliknyaketikakadarhormontiroidtinggi,makaproduksiTSHakanmenurun.
PadapenyakitGraves,adanyaantiboditerhadapreseptorTSHdimembranselfolikeltiroid,
menyebabkanperangsanganproduksihormontiroidsecaraterusmenerus,sehinggakadarhormon
tiroid menjadi tinggi. Kadar hormon tiroid yang tinggi ini menekan produksi TSH di kelenjar
hipofisis, sehingga kadar TSH menjadi rendah dan bahkan kadangkadang tidak terdeteksi.
Pemeriksaan TSH generasi kedua merupakan pemeriksaan penyaring paling sensitif terhadap
hipertiroidisme,olehkarenaitudisebutTSHsensitive(TSHs),karenadapatmendeteksikadarTSH
sampaiangkamendekati0,05mIU/L.Untukkonfirmasidiagnostik,dapatdiperiksakadarT4bebas
(freeT4/FT4).

14,17

1.2.4Pengobatan.
Walaupunmekanismeautoimunmerupakanfaktorutamayangberperandalampatogenesis
terjadinya sindrom penyakit Graves, namun penatalaksanaannya terutama ditujukan untuk
mengontrolkeadaanhipertiroidisme.

12,17

Sampaisaatinidikenaladatigajenispengobatanterhadap

hipertiroidisme akibat penyakit Graves, yaitu: Obat anti tiroid, pembedahan dan terapi yodium
radioaktif.

17

Pilihan pengobatan tergantung pada beberapa hal antara lain berat ringannya

tirotoksikosis, usia pasien, besarnya struma, ketersediaan obat antitiroid dan respon atau reaksi
terhadapnyasertapenyakitlainyangmenyertainya.

12,17

a. ObatAntitiroid:GolonganTionamid
Terdapat2kelasobatgolongantionamid,yaitutiourasildanimidazol.Tiourasildipasarkan
dengan nama propiltiourasil (PTU) dan imidazol dipasarkan dengan nama metimazol dan
karbimazol.Obatgolongan tionamidlain yang baruberedarialahtiamazol yang isinya sama
dengan metimazol.

11,12,14

Obat golongan tionamid mempunyai efek intra dan ekstratiroid.

Mekanismeaksiintratiroidyangutamaialahmencegah/mengurangibiosintesishormontiroidT3
dan T4, dengan cara menghambat oksidasi dan organifikasi iodium, menghambat coupling
iodotirosin, mengubah struktur molekul tiroglobulin dan menghambat sintesis tiroglobulin.
SedangkanmekanismeaksiekstratiroidyangutamaialahmenghambatkonversiT4menjadiT3di
jaringanperifer(hanyaPTU,tidakpadametimazol).

Atas dasar kemampuan menghambat konversi T4 ke T3 ini, PTU lebih dipilih dalam

pengobatankrisistiroidyangmemerlukanpenurunansegerahormontiroiddiperifer.Sedangkan
kelebihan metimazol adalah efek penghambatan biosintesis hormon lebih panjang dibanding
PTU,sehinggadapatdiberikansebagaidosisitunggal. Belumadakesesuaianpendapatdiantara
17

paraahlimengenaidosisdanjangkawaktupengobatanyangoptimaldenganOAT. Beberapa
kepustakaanmenyebutkanbahwaobatobatantitiroid(PTUdanmethimazole)diberikansampai
terjadiremisispontan,yangbiasanyadapatberlangsungselama6bulansampai15tahunsetelah
pengobatan.12 Untuk mencegah terjadinya kekambuhan maka pemberian obatobat antitiroid
biasanyadiawalidengandosistinggi.Bilatelahterjadikeadaaneutiroidsecaraklinis,diberikan
dosispemeliharaan(dosiskecildiberikansecaratunggalpagihari).
RegimenumumterdiridaripemberianPTUdengandosisawal100150mgsetiap6jam.

Setelah 48 minggu, dosis dikurangi menjadi 50200 mg, 1 atau2kalisehari. Propiltiourasil


17

mempunyaikelebihandibandingkanmethimazolekarenadapatmenghambatkonversiT4menjadi
T3,sehinggaefektifdalampenurunankadarhormonsecaracepatpadafaseakutdaripenyakit
Graves. Methimazolemempunyaimasakerjayanglamasehinggadapatdiberikandosistunggal
sekalisehari.Terapidimulaidengandosismethimazole40mgsetiappagiselama12bulan,
dilanjutkandengandosispemeliharaan520mgperhari.Apabilaresponspengobatanbaik,dosis
dapatditurunkansampaidosisterkecilPTU50mg/haridanmetimazol/tiamazol510mg/hari
yang masih dapat mempertahankan keadaan klinis eutiroid dan kadar T4 bebas dalam batas
9

normal.Biladengandosisawalbelummemberikanefekperbaikanklinisdanbiokimia,dosis
dapat di naikkan bertahap sampai dosis maksimal, tentu dengan memperhatikan faktorfaktor
penyebab lainnya seperti ketaatan pasien minum obat, aktivitas fisis dan psikis. 20 Meskipun
jarang terjadi, harus diwaspadai kemungkinan timbulnya efek samping, yaitu agranulositosis
(metimazolmempunyaiefeksampingagranulositosisyanglebihkecil),gangguanfungsihati,
lupuslikesyndrome,yangdapatterjadidalambeberapabulanpertamapengobatan.

BABII
LAPORANKASUS
IDENTITAS
Nama

:Ny.Z

JenisKelamin :Perempuan
Umur

:54th

NoRM

:045124

Alamat

:PauhKambar

Status

:Menikah

Pekerjaan

:IbuRumahTangga

SukuBangsa :MinangKabau
10

ANAMNESIS
KeluhanUtama:Sesaknafasyangterasasemakinsesaksejak1mingguyanglalu.
RiwayatPenyakitSekarang:
-

Sesaknafasdirasakansemakinsesaksejak1mingguyanglalu.Sesaknafassudah
dirasakansejak5bulanyanglalu.Pasienmerasasemakinsesaksaatberaktivitasdansaat

tidur,pasienlebihnyamantidurdenganmenggunakansandaranyangtinggi.
Keduatungkaisembabdanperutmembuncitterasasemakinmembesarsejak1minggu
yanglalu.Awalnyapasienmenyadarikeduatungkaisembabdanperutmembuncitsejak2

bulanyanglalu,makinlamaterasasemakinmembesardanperabaankerassepertipapan.
Dadaterasaberdebardebarsejak3bulanyanglalu.
Benjolandileherterasasemakinmembesarsejak5bulanyanglalu,danterasa

mengganjalsaatmenelan.Benjolandilehersudahdirasakansejak1tahunyanglalu.
Tanganterasaseringgemetarandantelapaktanganseringbasahsejak1tahunyanglalu.
Seringberkeringatbaiksiangataumalamdansukamerasapanassertalebihsukacuaca

dinginsejak1tahunyanglalu.
Beratbadanterusturunsejak1tahunyanglaluyangawalnya80kgmenjadi65kg.
Buangairkecilbiasa.
Buangairbesarsusahdantidakteratur.
Demamtidakada.

RiwayatPenyakitDahulu
- RiwayatHipertensitidakada.
- RiwayatDiabetesMelitustidakada.
- Riwayatkeganasantidakada.
RiwayatPenyakitKeluarga
- Riwayathipertiroidadapadaadikkandungpasien.
- Riwayatkeganasandikeluargatidakada.
RiwayatSosioekonumi,dankebiasaan
- Pasienseorangiburumahtangga.
PEMERIKSAANFISIK(23Mei2016)
Keadaanumum:SakitSedang
Kesadaran
:Composmentis
TekananDarah:110/70mmHg
Nadi
:95kali/menit
Nafas
:23kali/menit
Suhu
:36.70C
TinggiBadan :160cm
BeratBadan :65cm
11

StatusGizi

:Overwheight

Kepala

:Normocefal

Mata

:konjungtiva:anemis/sclera:ikterik+/+

Kulit

:Sawomatang,turgorbaik.

Rambut

:Hitam,tidakmudahdicabut

Leher

:JVP5+3,5cmH20,Kelenjertidoidteraba10x5x2cm.Konsistensikenyal,
mobile,ikutdengangerakanmenelan,bruit().

KGB

:TidakadapembesaranKGB

Telinga

:Tidakadakelainan

Hidung

:Tidakadakelainan

GigidanMulut:OralHygienebaik
Tenggorokan:Faringtidakhiperemis,TonsilT1T1

.Thorax
Cardiovascular
Inspeksi:iktusCordistidakterlihat.
Palpasi:IktusCordisterabadi1jarilateralLMCRICV
Perkusi:batasjantung

Kiri1jarilateralLMCRICV

KananLSD
AtasRICII
Auskultasi:Cardio:S1S2tunggalreguler,murmur(),gallop()
-

Pulmo

Inspeksi:simetris,retraksitidakada.
12

Palpasi:fremitussamakiridankanan.
Perkusi:redup
Auskultasi:vesikulermenurun,ronki+/+,whezing/
Abdomen
Inspeksi:Membuncit(+),Distensi(),Massa()
Auskultasi:BisingUsusnormal
Palpasi:nyeritekanepigastrium(),Hepardanlientidakteraba,shiftingdullnes(+),
undulasi(+).
Extrimitasatas:pittingedema+/+,akralhangat,CRT<2Detik,pembesaranKGBaksila/.
Extrimitasbawah:pittingedema+/+,akralhangat,CRT<2Detik.
Laboratorium:
-

Darahlengkap(22Mei2016):
Hb:11,2gr%
WBC:6.800/mm3
PLT:213.000
HT:34%
GDS:154mg%
Ureum :19mg%
Kreatinin:0.3mg%
TSH :0.005n/L(0.274.2)
FT3 :2.35ng/dL(0.20.4)
FT4 :>7.77ng/dL(0.931.71)
IndeksWayne
Gejala

Skor

Tanda

Skor

Sesaknafas

+1

PembesaranTiroid

+3

Palpitasi

+2

Hiperkinesis

+2

Mudahlelah

+2

Telapaktangan

+1

lembab
Senanghawadingin

+5

Keringatberlebihan

+3

Nadilebih90x/menit

13

+3

Beratbadanturun

+1

Totalskor:23=Hipertiroid
Diagnosa
:Hipertiroid
CongestiveHeartFailure

Tatalaksana :Lasix:1x20mg
PTU3x100mg
KSR1x600mg
Propanolol2x10mg

Prognosis
:QuoetSanam:Bonam
QuoetVitam:Bonam
QuoetFungsionam:Bonam

BABIII
DISKUSI
Seorangpasienperempuanusia54tahundatangkepoliklinikRSUDPariamandengan
keluhanutama. Sesaknafas dirasakansemakinsesaksejak1mingguyanglalu. Sesaknafas
sudahdirasakansejak5bulanyanglalu.Pasienmerasasemakinsesaksaatberaktivitasdansaat
tidur, pasien lebih nyaman tidur dengan menggunakan sandaran yang tinggi. Sesak bisa
diakibatkan oleh gangguan paru maupun ekstra paru. Pada pasien sesak yang dialami
kemungkinandisebabkankarenakomplikasidarigagaljantungkiriyangmenyebabkanudem
paru akibat bendungan aliran darah karena tidak adekuatnya kontraksi ventrikel kiri
memompakandarahkeseluruhtubuh.Halinidikuatkandengansesakyangmeningkatsetelah
aktivitas dan dipengaruhi perubahan posisi. Ditambah dengan pemeriksaan fisik didapatkan
perkusi thoraks yang meredup, suara nafas yang melemah dan adanya rhonki memeperkuat
kearahudemparu.
Keduatungkaisembabdanperutmembuncitterasasemakinmembesarsejak1minggu
yanglalu.Awalnyapasienmenyadarikeduatungkaisembabdanperutmembuncitsejak2bulan
yanglalu,makinlamaterasasemakinmembesardanperabaankerassepertipapan.Halinipada
pasienkemungkinandisebabkankarenagagaljantungkanansehinggaterjadibendungandarah
balikvenamenujujantung,sehinggamenyebabkanedemapadaekstramitasatasmaupunbawah
sertaasites.PadapemeriksaaanfisikdiperkuatdenganadanyaJVPyangmeningkat,adanyatanda
14

shiftingdullnessdanundulasiyangmenandakanasitessertaadanyapittingedempadakeempat
ekstremitas.
Benjolan di leher terasa semakin membesar sejak 5 bulan yang lalu, dan terasa
mengganjalsaatmenelan.Benjolandilehersudahdirasakansejak1tahunyanglalu.Tangan
terasa sering gemetaran dan telapak tangan sering basah sejak 1 tahun yang lalu. Sering
berkeringatbaiksiangataumalamdansukamerasapanassertalebihsukacuacadinginsejak1
tahunyanglalu.Dadaterasaberdebardebarsejak3bulanyanglalu.Beratbadanterusturun
sejak1tahunyanglaluyangawalnya80kgmenjadi65kg.
Padapasiendidugamenderitapenyakithipertiroiddimanaterdapatduakelompokgambaran
utamayaitutiroidaldanekstratiroidalyangkeduanyamungkintidaktampak.Ciriciritiroidalberupa
goiterakibathiperplasiakelenjartiroid,didapatkanpembesaranpadaleheryangbiasanyabenjolan
padalehertersebutmengikutipergerakanlehersaatmenelan.Padapasienterlihatdaripemeriksaan
fisikKelenjertidoidteraba10x5x2cm.Konsistensikenyal,permukaanbernodul,mobile,ikut

dengangerakanmenelan,bruit().Denganbenjolanyangkonsistensikenyal,masihmobiledan
tidakadanyabruitkitabisamenyingkirkanpembesarantiroidakibatkeganasan.
Hipertiroidismeakibatsekresihormontiroidyangberlebihan.Gejalagejalahipertiroidisme
berupamanifestasihipermetabolismedanaktifitassimpatisyangberlebihan. Pasienmengeluhlelah,
gemetar,tidaktahanpanas,keringatsemakinbanyakbilapanas, beratbadanmenurunwalaupun
nafsumakanmeningkat,palpitasi,takikardi.DarigejalagejalapasientersebutdapatkitanilaiIndeks
Wayne yang dapat membantu menegakan diagnosis hipertiroid. Pada penilaian indeks wayne
didapatkantotalskor23menandakanpadapasienterdapatgangguanhipertiroid.
DaripemeriksaanlaboratoriumdidapatkanTSHmenurunFT3danFT4meningkat.Halini
menandakanadanyapeningkatanhormontiroid.Padagravedisseaseterjadireaksiautoimundimana
antibodi terbentuk terhadap reseptor TSH mengakibatkan meningkatnya stimulasi untuk
menghasilkanT3danT4.FeedbackdaripeningkatanT3danT4adalahmenekandariTSH,sehingga
TSH didspatkan rendah. Untuk uji diagnostik dinilai FT3 dan FT4 yang meningkat mengganti
pengukuranT3danT4.
Untuktatalaksanadiberikanlasixsebagaidiuretikkarenatelahterjadiedemaparu,acitesdan
edemaekstremitaspadapasienakibatbendunganalirandarahakitabgagaljantungyangmerupakan
15

komplikasidarihipertiroidyangdideritanya.KemudiandiberikanPTUuntukmenekanpembentukan
hormontiroidberlebihandimanaPTUmenghambatbiosintesisT3danT4.DiberikanjugaKSRuntuk
menggantielektrolityangkeluarakibatpemakaiandiuretik.Jugadiberikanpropanolol,propanolol
menghambat reseptor beta yang berefek menurunkan aktivitas otot jantung dan pembuluh darah
sehinggadapatmengatasitakikardidabmenurunkanresistensipembuluhdarah.

DAFTARPUSTAKA
1.AmericanHeartAssociation.HeartDiseaseandStrokeFacts,2006Update.Dallas,Texas:AHA,
2006.
2.Baughman,C.Diane&HackleyJoAnn.KeperawatanMedikalBedahBukuSakuuntukBrunner
danSuddarth,Edisi1,Alihbahasa:Yasminasih,EditorMonicaEster,Jakarta:EGC.2000.
3.Brundside,JW.McGlynn,Tj.DiagnosisFisik.AlihBahasa:Lumanto,Henny.Jakarta:EGC.1995.
4.BrunnerdanSuddarth.KeperawatanMedikalBedahEdisi8.Jakarta:EGC.2002.
5.Caroline,Stevany.2011.GambaranFaktorDemografi,PenyakitGayaHidupPadaCongestive
HeartFailure(CHF)diRSUPDR.WahidinSudirohusododeanRS.StellaMarisMakassarTahun
2011.Availablefrom:http://repository.unhas.ac.id/handle/123456789/385
6.CentersforDiseaseControlandPrevention.TheBurdenofHeartDiseaseandStrokeintheUnited
States:StateandNationalData,1999.Atlanta:CentersforDiseaseControlandPrevention,2004.
7.Dorland,W.ANewman.KamusKedokteranDorland.Jakarta:EGC.2002.
8.ElixhauserA,YuK,SteinerC,Bierman,ASTable4.MostCommonreasonsforhospitalizations
byagegroups,inHospitalizationintheUnitedStates,1997,Rockville(Md):AgencyforHealthcare
ResearchandQuality,2000,HCUPFactBook;AHRQPublicationNo.000031.
9.Emedicine.medscape.com/article/163062overview.Diakses23Mei2016.
10.FathoniM.PenyakitJantungKoroner.Surakarta:UniversitasSebelasmaretpress.2011.

11.ReidJR,WheelerSF.Hyperthyroidiasm:DiagnosisandTreatment.TheAmericanFamily
Physican.August15,2005:72,4:p.623630
12. Ginsberg J. Review Diagnosis and Management of Graves disease. Canadian Medical
Associationoritslicensors.JAMC.2003:168,5:575584
13.YeungSCJ,HabraMA.Gravesdisease.Uptodate.2010:p.491501
14.Prummel MF,Streider T,WiersingaWM.TheEnvironmentandAutoimunethyroiddisease.
eje.org.2004:150:p.605618
15.AinK,RosenthalS.CompletethyroidBook,TooMuchThyroidHormon. McGrawHill 2005:
p.6170
16

16.PotenzaM,ViaMA,YanagisawaRT.PancreaticoutputofInsulinandtotalBodyinsulinLevel.
EndocrinePracticeAmericanAssociationofClinicalEndocrinologists.2009:15,3:p.254262
17.PearceNE,LewisE.HyperthyroidisminEarlydiagnosisandtreatmentofEndocrineDisorder,
HumanaPress,Totowa,Newjersey2003:p.5360
18.ChiuCH,LamHC,LeeJK,WangMC,LuCC,SunCC,ChuangMJ,LamHC.Changeof
Vistatin,CReactiveproteinconcentration,andinsulinsensitivityinpatientswithhyperthyroidism.
Metabolismjournal.2008:p.13801383

17