Anda di halaman 1dari 51

SOAL KEPERAWATAN ANAK

1. Seorang anak perempuan umur 4 tahundi antar orang tuanya ke UGD karena
panas sudah 3 hari dan muntah-muntah . Hasil pengkajian didapatkan data : pasien
tampak lemas, mukosa bibir kering, turgor kulit kurang elastis. Akral dingin, nadi 100
kali permenit, suhu tubuh 38,6C, pernafasan 28 kali permenit, petikie pada
ektremitas .Trombosit 87.000 /mm3 , Hematokrit 40 %.
Manakah rencana tindakan yang utama untuk memperbaiki status cairan pada
anak tersebut ?
A. Kaji tanda-tanda dehidrasi
B. Ukur intake dan out put
C. Beri banyak minum
D. Beri antiemetik sesuai terapi
E. Berikan cairan parenteral sesuai program
2. Seorang anak laki-laki umur 2 tahun di rawat. Menurut ibu klien anaknya sesak dan
batuk batuk , panas, rewel . Hasil pengkajian didapatkan bayi didapatkan sesak,
batuk , retraksi dada, pernafasan 30 kali permenit nadi 100 kali permenit, suhu tubuh
38C, terdapat ronkhi, terpasang O2 1liter/menit dengan nasal kanul
Berapakah konsentrasi oksigen yang di dapatkan?
A. 24 %
B. 44 %
C. 30%
D. 60%
E. 40%
3. Seorang anak laki-laki umur 4 tahun dirawat dirumah sakit. Ibu klien mengatakan
badan anaknya bengkak sejak 2 bulan. Hasil pemeriksaan fisik : edema pada wajah,
abdomen, dan ekstremitas, tekanan darah 140/90 mmHg, nadi 88 x/menit,
pernafasan 28 x/menit,suhu 36.8 o C.
Manakah berikut ini yang merupakan penyebab utama timbulnya gejala tersebut di
atas ?
A. Retensi air dan Natrium
B. Sekresi ADH dan Aldosteron
C. Hipoalbuminemia akibat proteiuria
D. Penurunan Tekanan osmotik koloid
E. Peningkatan Permeabilitas membran glomerolus
4. Seorang bayi laki-laki berusia 1 bulan dibawa oleh ibunya dengan Labiopalatozkisis
dengan keluhan kesulitan menyusu dan berat badan menurun. Berdasarkan kasus
tersebut, diharapkan bayi akan mengkonsumsi nutrisi secara adekuat.
Apa tindakan keperawatan prioritas utama yang diberikan untuk mencapai tujuan
yang diharapkan?
A. Beri diet sesuai usia
B. Sendawakan dengan sering
C. Dorong ibu untuk menyusui sesegera mungkin
D. Gunakan alat makan khusus
E. Pantau berat badan bayi
5. Seorang anak perempuan usia 4 tahun, di rawat dengan diagnosa medis
Bronchopneumonia ibu mengatakan anaknya batuk tapi tidak disertai sesak pada
saat dilakukan pemeriksaan fisik didapatkan frekwensi pernapasan 30x/menit denyut

A.
B.
C.
D.
E.
6.

A.
B.
C.
D.
E.
7.

8.

nadi 100 x/menit temperatur 36 C setelah selesai pemeriksaan TTV anak tersebut
di rencanakan untuk dilakukan fisioterapi dada yang di awali dariPostural
drainage,claping dan vibrating.
Sebelum melaksanakna postural drainage hal pertama yang harus dilakukan oleh
perawat adalah?Pilihan Jawaban
Memberikan air minum hangat
Mengatur posisi klien
Mengauskultasi paru
Memberikan obat ekspektoran
Melakukan perkusi/klaping
Seorang anak laki-laki berumur 1 bulan dengan diare dirawat di rumah sakit. Ibu
klien mengatakan klien buang air sudah 8x, muntah dan tidak mau minum ASI, mata
cekung, mukosa bibir kering,berat badan turun,apatis
Apakah rencana keperawatan utama pada kasus diatas?
Berikan cairan pedialit
Teruskan pemberian ASI saja
Berikan cairan RL dan oralit
Berikan cairan Dekstros dan NaCl
Berikan diet secara bervariasi
Seorang anak laki-laki usia 1 tahun ,Orang tua mengatakan anaknya batuk sejak 14
hari yang lalu, dan kondisi batuknya semakin berat dan sesak nafas,hasil pengkajian
pernafasan 60 x/menit, nafas cuping hidung, retraksi dada, ronkhi terdengar di kedua
lapangan paru dari terafi yang di berikan oleh doter adalah pemberian nebulizer
dengan dosis obat 3x 1 amp ambiven.
Tujuan utama pemberian Nebulizer adalah?
a. Mengurangi batuk
b. Merangsang pengeluaran sekret
c. Mengencerkan sekret
d. Mengurangi dahak
e. Memberikan rasa nyaman.
Seorang anak laki laki berusia 1 tahun, dirawat dengan keluhan: sesak nafas,
panas tinggi dan sering muntah. Dari hasil wawancara dengan ibu An.S ;
sebelumnya anak menderita batuk pilek dan tidak sembuh, tidak mau makan. Hasil
pengkajian diperoleh data ; sesak nafas, retraksi dinding dada, ronchi positif pada
kedua lapang dada. RR: 54 x/ mt, Suhu Tubuh: 39 o C, HR: 110 x/mt. Hasil Ro:
Bronchopneumonia kronik.
Apakah masalah keperawatan utama yang dialami An.S ?
A. Gangguan pola nafas
B. Gangguan nutrisi kurang dari yang dibutuhkan
C. Gangguan pertukaran gas
D. Gangguan keseimbangan cairan
E. Tidak efektifnya bersihan jalan nafas

9. Seorang Perawat anak mendemontrasikan cara pembuatan larutan oralit pada


seorang ibu yang anaknya mengalami diare. Selanjutnya perawat meminta kepada
orang tua anak tersebut untuk memberikan cairan oralit kepada anaknya sampai
habis
Apakah peran perawat anak pada kasus diatas ?
a. Care giver
b. Educator

c. Advocacy
d. Kolaborasi
e. Konseling
10. Pada seorang anak usia toddler yang di rawat diruang anak dengan keluhan diare,
dilakukanl pengkajian berat badan, hasilnya menunjukkan anak memiliki berat
badan 12 kg. Pada hari rawat ketiga saat dikaji berat badan anak menurun menjadi
11 kg.
Apakah derajat dehidrasi yang dialami anak pada kasus diatas ?
A.
Dehidrasi sangan ringan
B.
Dehidrasi ringan
C.
Dehidrasi sedang
D.
Dehidrasi berat
E.
Dehidrasi sangat berat
11. Seorang anak laki-laki berusia 4 bulan dibawa orang tuanya ke rumah sakit dan
dirawat di Ruang Anak karena mengalami BAB mencret dan muntah terus menerus
selama 3 hari. Berdasarkan hasil pemeriksaan diperoleh data anak tampak lemas
dan rewel, terdapat kemerahan di sekitar anus, hasil auskultasi bunyi peristaltik usus
15x/menit, perkusi abdomen hipertimpani (kembung), BAB lebih dari 4x dengan
konsistensi cair berampas, berat badan anak sebelum BAB mencret 5,3 Kg dan
berat badan anak saat BAB mencret 4,9 Kg.
Apa masalah keperawatan utama yang dihadapi oleh anak tersebut?
A. Kekurangan kebutuhan nutrisi
B. Kelebihan kebutuhan nutrisi
C. Kerusakan integritas kulit
D. Kekurangan volume cairan dan elektrolit
E. Kelebihan volume cairan dan elektrolit
12. Seorang anak perempuan berusia 6 bulan dibawa orang tuanya ke Poli Tumbuh
Kembang Rumah Sakit dengan keluhan keterlambatan perkembangan. Pada
pemeriksaan perkembangan dengan menggunakan format DDST (Denver
Development Screening Test) II didapatkan keterlambatan pada sektor bahasa dan
personal sosial, berat badan 18 kg, tinggi badan 90 cm, serta nafsu makan anak
semakin menurun dari hari ke hari.
Apa intervensi keperawatan prioritas yang dilakukan terhadap anak tersebut?
A.
Beri terapi nutrisi
B.
Lakukan deteksi dini perkembangan
C.
Beri terapi cairan
D.
Pantau penurunan berat badan
E.
Beri penkes orang tua tentang perkembangan anak
13. Seorang anak laki-laki berusia 6 tahun dibawa orang tuanya ke rumah sakit dan
dirawat di Ruang Anak dengan keluhan sesak napas. Berdasarkan hasil
pemeriksaan diperoleh data tampak pilek, nafsu makan menurun, batuk berdahak
dengan sputum berwarna hijau, frekuensi napas 35 x/menit cepat dan dangkal,
frekuensi nadi 80 x/menit, tekanan darah 100/70 mmHg, suhu 39oC.
Apa masalah keperawatan prioritaspada anak tersebut?
A.
Ketidakefektifan bersihan jalan napas
B.
Ketidakefektifan pola pernapasan
C.
Risiko aspirasi
D.
Gangguan pertukaran gas
E.
Ketidakefektifan termoregulasi
14. Seorang anak laki-laki berusia 1 tahun dibawa orang tuanya ke rumah sakit dan
dirawat di Ruang Anak dengan keluhan sesak napas. Berdasarkan hasil
pemeriksaan diperoleh data tampak batuk dan pilek, wajah tampak kebiruan jika

menangis, akral dingin, frekuensi napas 50 x/menit cepat dan dangkal, frekuensi nadi
135 x/menit, suhu 38,5oC, hipertrofi ventrikel kanan dan defek pada septum
ventrikel.
Apa intervensi keperawatan yang utama dilakukan pada anak tersebut?
A.
Batasi aktivitas
B.
Berikan oksigen
C.
Cegah anak sering menangis
D.
Lakukan kompres dingin
E.
Beri penkes orang tuanya
15. Seorang anak usia 2 tahun datang ke Unit Gawat Darurat RS. A, dengan keluhan
buang air besar >10 kali perhari. Saat dilakukan pengkajian terhadap anak tersebut
kesadaran compos mentis, terlihat membran mukosa kering, demam, menangis
tanpa keluar air mata, serta selalu merasa kehausan.
Intervensi apakah yang dilakukan perawat terhadap anak tersebut kecuali?
A. Berikan cairan RL atau NaCl
B. Kaji status dehidrasi
C. Berikan minum 2-3 liter/hari
D. Kolaborasi dengan dokter untuk pemberian obat antisekresi
E. Kolaborasi dengan dokter untuk pemberian obat antipiretik
16. Seorang anak laki-laki berusia 4 tahun dibawa oleh ibunyake Rumah Sakit dan
dirawat di ruang anak dengan keluhan sesak napas. Keluhan tersebut di sertai
demam tinggi, dan batuk berdahak. Klien tampak gelisah dan menangis. Hasil dari
pemeriksaan fisik di temukan bahwa Suhu 38,9 0C, frekuensi napas 44 x/menit,
frekuensi nadi 72 x/menit, sianosis pada kulit, terdapat penurunan bunyi napas.
Tindakan apa yang harus dilakukan perawat untuk mengatasi hal tersebut?
a. Berikan kompres pada anak dengan air hangat
b. Monitor TTV
c. Berikan antipiretik
d. Pemantauan saturasi oksigen
e. Berikan terapi oksigen dan lakukan terapi nebulizer
17. Anak A berusia 5 tahun dengan Berat Badan 15 kg dirawat di ruang Kemuning
dengan diagnosa kejang demam. Pada jam 14.30 wib, ibu anak tersebut berteriak
kepada perawat bahwa anaknya kejang kembali. Saat didatangi ke tempat tidurnya,
mata anak tersebut membuka lebar mengarah ke atas, dan giginya terkunci rapat.
Apakah tindakan pertama yang harus dilakukan perawat?
A.
Melonggarkan pakaian dan memiringkan kepala anak
B.
Memasang oropharingeal airway tube
C.
Memberikan oksigenasi nasal kanul
D.
Memberikan suntikan diazepam IV
E.
Memberikan diazepam per rektal
18. Seorang anak perempuan berusia 6 bulan dibawa orang tuanya ke IGD rumah sakit
dengan keluhan lemas. Berdasarkan hasil pemeriksaan diperoleh data mukosa bibir
dan mulut kering dan ubun-ubun cekung, tampak rewel dan menangis serta berontak
bila disentuh perawat, frekuensi napas 26 x/menit, frekuensi nadi 120 x/menit, suhu
37,5oC, mendapatkan terapi infus Dextrose 5%. Perawat pelaksana yang menangani
anak tersebut melakukan pemasangan infus, tetapi setelah dicoba beberapa kali
ternyata gagal. Akhirnya perawat menunda pemasangan infus.
Apakah prinsip etik yang diabaikan oleh perawat?
A.
Eficence
B.
Beneficence
C.
Maleficence
D.
Justice

E.
Fear
19. Seorang bayi berusia 6 bulan dibawa ibunya datang ke posyandu . Dari hasil
pengkajian, ditemukan data bahwa BB lahir 2800 gr, PB lahir 42 cm, BB saat ini 7300
gr, PB saat ini 63 cm, LK saat ini 37 cm, fontanel anterior belum menutup, dan
lingkar dada 35 cm
Manakah data yang harus diwaspadai perawat?
A.
Fontanel anterior belum menutup
B.
Lingkar dada 35 cm
C.
BB 7300 gr
D.
PB 63 cm
E.
LK 37 cm
20. Seorang anak perempuan berusia 1 tahun dibawa orang tuanya ke rumah sakit dan
dirawat di Ruang Anak dengan keluhan BAB mencret selama 3 hari. Berdasarkan
hasil pemeriksaan diperoleh data mukosa bibir dan mulut kering dan ubun-ubun
cekung, kulit sekitar perineal memerah, frekuensi napas 26 x/menit, frekuensi nadi
120 x/menit, suhu 39oC.
Apa bentuk penyuluhan kesehatan yang sesuai untuk orang tua anak tersebut?
A.
Diet TKTP
B.
Perawatan hygiene anak
C.
Penanganan hidrasi
D.
Cara pembuatan oralit
E.
Pencegahan penyakit diare
21. An. M ( 5 thn ) dibawa ke RS dengan keluhan darah keluar dari hidung. Saat
dilakukan pemeriksaan fisik didapatkan memar dan kebiruan di lengan atas dan
disekitar bawah mulut. Ibu klien mengatakan 2 minggu yang lalu anaknya sakit
panas dan pilek. Hasil pemeriksaan darah menunjukkan : trombosit 80.500/mm ;
leukosit 8.300/mm ; Hb 8,7 gr/dl.
Apa masalah keperawatan utama yang terjadi pada An. M ?
A.
Intoleransi aktivitas
B.
Gangguan perfusi jaringan
C.
Resiko perdarahan
D.
Gangguan nutrisi kurang dari kebutuhan tubuh
E.
Resiko tinggi gangguan integritas kulit
22. Klien B, 5 tahun, laki-laki, datangdenganorangtuanyake RS
dengankeluhansesaknafas.
Orangtuaklienmengatakanklienmulaiterlihatsesaksejakperutdan kaki klienbengkak.
Orangtuamengatakan 3 minggu yang lalukliensakitgigidanseringmengorekgiginya.
Saatdiperiksa BB klien 18 kg dari BB sebelumnya 15 kg, TD 160/100 mmHg, RR
40x/menit, HR 110x/menit, CRT < 2 detik, klientampakbengkakdibawahmata, perut,
kaki danskrotum. Saatiniklienmalasmakandanminumsertakadang-kadangmuntah.
Padaklientersebut, apa intervensi yang paling
tepatdilakukanuntukmengatasimasalahkelebihan volume cairan di interstitial ?
A.
Anjurkan klien untuk lebih banyak bergerak dan beraktivitas
B.
Kurangi intake cairan sesuai dengan status edema klien
C.
Anjurkan klien untuk mengkonsumsi cairan yang hipotonis
D.
Berikan diuretic untuk menarik cairan di interstitial
E.
Berikan albumin sebagai pengganti seluruh kebutuhan cairan pada klien
23. Bayi D lahir premature pada usia 36 minggu. Berat badan bayi D 2 kg. bayi D sudah
mulai belajar menuyusui. Bayi D merupakan anak pertama dari ibu A.
Penyuluhan kesehatan apa yang harus disampaikan kepada ibu A ?
A.
Anjurkan ibu untuk menyerahkan perawatan bayinya kepada perawat
berpengalaman

B.

Rekomendasikan ibu untuk menggunakan empeng dor yang lunak, lentur agar
bayi dapat menyedot lebih cepat
C.
Dorong ibu untuk meneruskan menyusui kepada bayinya, diselingi dengan
periode istirahat yang sering
D.
Jelaskan kepada ibu bahwa bayi memerlukan NGT untuk membantu pemberian
makan
E.
Jelaskan kepada ibu bahwa bayi belum mampu minum susu per oral
24. Bayi preterm usia 20 hari, berat 1600 gram, dalam incubator secara konsisten
kehilangan 30-50 gram selama 2 hari setelah 2 minggu mengalami pertambahan
berat badan yang memadai melalui NGT. Suhu lingkungan dalam incubator
meningkat 5o C, sementara suhu aksila bayi berkisar 36,4o-36,5o C
Bagaimana cara mempertahankan suhu ideal untuk bayi tersebut?
A.
Gunakan control suhu udara
B.
Gunakan kain penutup incubator
C.
Bungkus bayi dengan selimut katun dalam inkubatur
D.
Pantau bayi akan adanya kerusakan system saraf
E.
Pantau bayi akan adanya gangguan termoregulasi
25. An. H berusia 18 bulan, dibawa oleh ibunya ke poli tmbuh kembang RSHS. Sebagai
bagian dari pemeriksaan rutin pada umur 18 bulan, perawat melakukan Denver
Developmental Screening Test (DDST) kepada An. A. Perawat mendapatkan hasil
bahwa fungsi anak tersebut tampaknya pada tingkat perkembangan 15-18 bulan,
tetapi ia tidak patuh dan sulit diuji.
Apa yang harus perawat sampaikan kepada ibu berdasarkan hasil pemeriksaan
perkembangan An. H?
A.
Perkembangan sudah lanjut dan mengalami ketegangan pada waktu pengujian
B.
Perkembangan terlambat dan psikologis terganggu
C.
Perkembangan terlambat dan mengalami ketegangan pada waktu pengujian
D.
Perkembangan normal dan ketidakpatuhan umumnya didapati pada umur ini
E.
Perkembangan normal tetapi secara psikologis terganggu
26. An. B (8 tahun) dirawat di RS sejak 4 hari yang lalu. An. B tampak lemah, mengeluh
nyeri pada bagian abdomen dan sakit kepala, An. B demam tinggi terus menerus,
lidah tampak kotor dan kehilangan napsu makan. An. B mengatakan sudah
mengalami demam naik turun sejak seminggu sebelum masuk rumah sakit.
Berdasarkan pemeriksaan Widal diperoleh titer O 1/320 ; leukosit : 4200/mm ;
Eritrosit: 4,2 x 10 /mm ; Trombosit 240.000/mm.
Apa masalah keperawatan yang tidak muncul pada An. B ?
A.
Gangguan nutrisi kurang dari kebutuhan tubuh
B.
Gangguan rasa nyaman : peningkatan suhu tubuh (hipertermi)
C.
Resiko tinggi defisit volume cairan
D.
Intoleransi aktivitas
E.
Resiko tinggi infeksi
27. Bayi A laki-laki berusia 2 hari dibawa ke RS karena mengalami atresia ani.
Berdasarkan hasil pemeriksaan diagnostic didapatkan posisi rectum berada dibawah
m. puborektalis, lekukan anus dan sfingter eksternal berada di posisi yang normal.
Bayi mengalami distensi abdomen dan muntah hijau.
Apa tindakan pembedahan segera yang dapat dilakukan pada bayi A untuk
memperbaiki kondisi bayi secara umum ?
A.
Kolostomi
B.
Post sagital anoplasty
C.
Ileostomi
D.
PSARP
E.
Apendiktomi

28. Anak laki-laki usia 5 tahun, dirawat di RS dengan diagnosis ALL-L3. Menurut ayah
klien, klien sering mengeluh capek, terlihat pucat sejak 3 bulan yang lalu. Saat dikaji
klien terlihat apatis. Hasil pemeriksaan fisik klien terdapat hepatomegali, status gizi
kurang. Hasil pemeriksaan penunjang menunjukkan Hb 9 gr/dl, Trombosit 100.000/dl
dan leukosit 400.000/dl.
Pada klien diatas dengan dapat berisiko terjadi kondisi kegawatan akibat ?
A.
Leukopenia
B.
Hiperleukositosis
C.
Anemia
D.
Perdarahan otak
E.
Trombositopenia
29. Seorang ibu prihatin dengan anak laki-lakinya yang berumur 30 bulan, yang kadangkadang mengulangi kata-kata yang diucapkan kepadanya. Pemeriksaan jasmani dan
neurologic seluruhnya normal, dan tanda-tanda perkembangan anak dalam batasbatas normal.
Apa kemungkinan perkembangan anak laki-laki tersebut ?
A.
Perkembangan tingkah laku verbal premature
B.
Kelainan neurologic yang tidak disadari
C.
Perkembangan bahasa yang kurang
D.
Autism infantile
E.
Perkembangn normal
30. Seorang anak berumur 2 tahun dirawat di rumah sakit. Dalam tiga hari pertama,
ibunya berkunjung sewaktu siang hari, dan anak tampak ketakutan dan menangis
ketika ibu meninggalkannya. Dalam 3 hari berikutnya ibunya tidak mengunjunginya,
anak menangis dan memanggilnya. Pada hari ketujuk, meskipun ibunya tidak
mengunjunginya, anak tampak sangat tenang.
Apa yang sebaiknya perawat lakukan terhadap kondisi anak tersebut ?
a.
Memberitahukan ibu bahwa kunjungannya tampaknya mengganggu anak dan
anak akan lebih mneyesuaikan diri jika ibu tidak melihatnya selama beberapa
hari
b.
Menjelaskan kepada ibu bahwa jika ia tidak dapat tinggal bersama dengan
anaknya, maka paling baik baginya untuk tidak mengunjungi anaknya
c.
Mendorong ibu untuk datang mengunjungi lebih sering dan dalam waktu lebih
lama
d.
Meresepkan obat penenang atau sedative untuk anak
e.
Meminta ibu untuk mengganti orang yang menemani anak jika tidak bisa datang
31. Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke
RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya
mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta
anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus
terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi
128x/menit.
Apakah implementasi untuk mengatasi masalah prioritas kasus di atas?
a.
Pemasangan nasogastric tube
b.
Pemasangan rectal tube
c.
Pemberian infus cairan N4
d.
Pemberian nutrisi yang lunak
e.
Lakukan pemberian oksigen

32. Anak S, laki-laki, 10 tahun, datang ke Poliklinik anak dengan riwayat dua hari
sebelum masuk RS klien mengeluh sakit kepala disertai panas badan yang tinggi,
terdapat perdarahan gusi. Klien dibawa ke balai pengobatan kemudian di anjurkan
untuk dirawat di Rumah Sakit. Hasil pemeriksaan fisik menunjukkan suhu tubuh
38,5C, teraba dingin pada ekstremitas, frekuensi nadi 100x/menit, terapat ptekie
pada ektremitas, uji tourniquet positif. Hasil Laboratorium didapatkan hasil sebagai
berikut: Hb : 11 gr/dl, Ht : 34 %, L : 9500 /mm3, Tr: 36.000 /mm3.
Berapakah derajat DHF yang di alami oleh Anak S tersebut ?
a.
Derajat I
b.
Derajat II
c.
Derajat III
d.
Derajat IV
e.
Derajat V

33. Anak A, perempuan, usia 1 tahun dengan BB 8200 gram (BBL 3200 gram). Menurut
ibunya BB klien semakin menurun karena kurangnya nafsu makan dan klien sudah
lebih dari 3 minggu tampak sesak nafas yang disertai batuk, pilek dan panas. Pada
pemeriksaan fisik kulit tampak pucat, nadi 120 kali/menit, respirasi rate 32x/menit,
suhu 38,7 C, suara nafas terdengar wheezing dan rochi basah, tampak retraksi
interkostal dan epigasrium, terdengar dullness pada area paru, pengembangan paru
kurang maksimal, pemeriksaan laboratorium, Hb 11,2 gr%, leukosit 6900/mm3,
glukosa sewaktu 128 mg/dl.
Apakah diagnosa keperawatan yang prioritas pada kasus di atas ?
a.
Tidak efektifnya jalan nafas berhubungan dengan akumulasi sekret
b.
Gangguan pola nafas berhubungan dengan hipersensitifitas
c.
Gangguan pemenuhan nutrisi kurang dari kebutuhan berhubungan dengan
anoreksia
d.
Gangguan perfusi jaringan berhubungan dengan kurangnya suplai oksigen
e.
Gangguan keseimbangan cairan dan elektrolit berhubungan dengan
peningkatan suhu tubuh

34. Bayi M, perempuan, usia 6 bulan, dirawat di rumah sakit dengan keluhan sesak
nafas. Dari hasil pemeriksaan fisik diperoleh data: panjang badan 62 cm, berat
badan 5,6 kg, frekuensi nadi 140 x/menit, suhu tubuh 38,40C, frekuensi nafas 60
x/menit, terdengar suara nafas ronchi, saat perkusi terdengar dullness dan klien
tampak sianosis. Hasil laboratorium menunjukkan kadar leukosit 21.000/mm3.
Apakah masalah keperawatan yang tepat pada kasus di atas ?
A.
Gangguan oksigenasi berhubungan dengan cyanosis
B.
Gangguan transportasi oksigen berhubungan dengan suplai oksigen yang
kurang
C.
Gangguan pola nafas berhubungan dengan sesak
D.
Gangguan bersihan jalan nafas berhubungan dengan akumulasi sekret
E.
Gangguan oksigenasi berhubungan dengan akumulasi sekret

35. Anak S, 8 bulan, perempuan, tertawa melihat gambar mickey mouse yang
terpampang di dinding ruang perawatan. Setelah puas memandangi gambar dia

a.
b.
c.
d.
e.

kemudian melihat jari-jemari tanggannya sambil mengoceh dan terkadang


memasukan salah satu jarinya ke dalam mulut, kemudian perawat mendekatinya dan
memberikan mainan gantungan yang berbunyi dan dapat berputar, Anak S tampak
menyukainya dan tertawa sambil menggerakan tangan dan kakinya.
Apakah jenis permainan yang diberikan perawat berdasarkan karakteristik sosial
pada anak tersebut ?
a.
Social affective play
b.
Sense of pleasure play
c.
Pararel play
d.
Solitary play
e.
Assosiative play
36. Anak Y, laki-laki, usia 10 bulan datang ke poli anak dibawa ibunya dengan keluhan
anak tampak pucat dan terlihat kurang aktif. Saat dilakukan pengkajian anak tampak
lemah, wajah pucat, conjuctiva tampak anemis, kulit berwarna hitam bersisik, muka
bulat mongoloid, pada perabaan tampak pembesaran hati dan limfa, pada
pemeriksaan CRT lebih dari 3 detik, BB anak 8 kg, Hb 5gr% Ht 22 % , Fe 1500 gr/dl.
Apakah diagnosa keperawatan yang prioritas pada kasus di atas ?
A. Gangguan rasa nyaman berhubungan dengan pembesaran hati
B. Gangguan perfusi jaringan berhubungan dengan penurunan pembentukan
eritrosit
C. Gangguan body image berhubungan dengan kulit berwarna hitam
D. Gangguan pemenuhan nutrisi berhubungan dengan anoreksia
E. Resiko injury berhubungan dengan hemosiderosis
37. Anak A, laki-laki, usia 7 tahun dibawa ibunya datang ke poli anak, menurut ibunya
setiap 2 minggu anaknya rutin datang untuk mendapatkan tranfusi, saat dilakukan
pengkajian tampak lemah, pucat, anak tidak menghabiskan porsi makan, conjuctiva
anemis, kulit berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak
pembesaran hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 13
kg, Hb 8 gr% Ht 24 %.
Apakah perencanaan pendidikan nutrisi yang tepat pada klien di atas?
Anjurkan ibu untuk membatasi anaknya makan sayuran hijau
Anjurkan ibu untuk memberikan multivitamin yang mengandung Fe
Anjurkan ibu untuk memberikan anaknya makan tinggi serat
Anjurkan ibu untuk memberikan makanan tinggi karbohidrat
Anjurkan ibu untuk membatasi pemberian garam
38. Bayi A, perempuan, usia 7 bulan, digendong ibunya ke poli tumbuh kembang, ibu
mengatakan klien sudah mendapatkan imunisasi lengkap dan sekarang dijadwalkan
untuk mendapatkan imunisasi selanjutnya. Berat badan anak 10 kg, panjang badan
110 cm, anak tampak aktif dan pada saat pemeriksaan fisik dalam keadaan sehat
dan bugar.
Apakah jenis imunisasi yang seharusnya sudah didapatkan pada anak tersebut
a.
DPT, Polio, MMR
b.
Hepatitis B, BCG dan Campak
c.
Hepatitis B, Polio dan MMR
d.
BCG, DPT, dan Polio
e.
BCG, Hepatitis B dan Campak
39. Anak S, laki-laki, 12 tahun, datang ke poli anak dengan keluhan sering pusing, dan
mudah lemah, saat pengkajian ditemukan conjunctiva anemis, bibir pucat, BB 25 kg,
TB 138 cm, Hb 9 gr%. Ibunya bertanya kepada perawat jenis makanan yang
sebaiknya diberikan kepada anaknya.

Apakah perencanaan pendidikan nutrisi selain protein yang dibutuhkan oleh anak
tersebut ?
a.
Nutrisi yang mengandung besi, vitamin C dan Calcium
b.
Nutrisi yang mengandung besi, vitamin B12 dan thiamin
c.
Nutrisi yang mengandung besi, vitamin A dan Asam Folat
d.
Nutrisi yang mengandung besi, vitamin B12 dan asam folat
e.
Nutrisi yang mengandung besi, vitamin E dan Riboflavin
40. Anak F, laki-laki, umur 2,5 tahun, BB 10,5 kg (BB asal sebelum diare 13 kg),
mengalami buang air besar (BAB) hampir setiap jam dengan jumlah sekitar setengah
sampai 1 gelas ukuran 200ml, konsistensi encer sejak 2 hari yang lalu. Anak agak
susah minum, menurut ibu dari pagi baru masuk teh manis 1 gelas dan air sup 1
mangkuk. Saat dibawa ke ruang gawat darurat RS, anak dalam keadaan somnolen,
nadi sulit diraba, mata cekung, turgor jelek, CRT > 3.
Apakah analisis masalah pada kasus di atas ?
a.
Diare tanpa dehidrasi
b.
Diare dengan dehidrasi ringan
c.
Diare dengan dehidrasi sedang
d.
Diare dengan dehidrasi berat
e.
Diare dengan dehidrasi berat disertai Shock
41. Seorang anak laki-laki 6 bulan dirawat dengan keluhan langit-langit mulut yang
terbuka. Semenjak lahir klien menderita bibir sumbing dan telah dilakukan operasi di
RS 2 hari yang lalu. Namun langit-langit mulut klien belum dilakukan operasi untuk
penutupan. Menurut ibunya klien sering sulit menelan. Pada pemeriksaan TTV
didapatkan : Nadi 104 x/menit, RR 24 x/menit, Suhu 37,8oc Hb : 9 gr/dL Ht : 28 %
Leukosit 10.700/mm3
Apakah masalah prioritas pada kasus di atas :
a.
Gangguan pemenuhan nutrisi
b.
Gangguan rasa nyaman nyeri
c.
Gangguan perfusi jaringan
d.
Resiko terjadi infeksi
e.
Gangguan thermoregulasi
42. Seorang anak perempuan usia 2 tahun dibawa ke poli rumah sakit dengan keluhan
sudah 2 hari BAB encer. Pada saat dikaji anak tampak lemah, kesadaran lethargik,
turgor kulit sangat jelek, saat menangis air mata tidak keluar. Berat badan anak saat
sebelum diare 10 kg dan saat dikaji 8,2 kg, frekuensi nafas 25x/menit, freuensi nadi
125x/menit
Apakah tingkat dehidrasi pada anak dengan kasus di atas ?
a.
Dehidrasi Ringan
b.
Dehidrasi sedang
c.
Dehidrasi Berat
d.
Dehidrasi Isotonis
e.
Dehidrasi Hipertonis
43. Seorang anak laki-laki usia 8 tahun, berat badan 18 kg, tinggi badan 117 cm. Sejak
lahir orangtua klien mengatakan bahwa klien BAK melalui lubang yang berada di
bawah penis, bila klien BAK kencing yang keluar memancar lurus.. Riwayat
antenatal didapatkan bahwa ibu klien mengatakan saat usia awal kehamilan tidak
dapat mengkonsumsi makanan dengan baik. Menurut orangtua klien belum pernah
melakukan terapi hormon
Apakah data fokus objektif yang diperlukan saat pengkajian pada kasus di atas ?
a.
Kebiasaan cara BAK
b.
Bentuk penis
c.
Frekuensi BAK

d.
Warna Air Kencing
e.
Keberadaan testis
44. Klien perempuan usia 8 tahun keluhan diawali sejak lahir. BAB pertama klien terjadi
2 hari setelah lahir. Klien telah dilakukan colostomy loop, Saat dikaji klien telah 8
hari post colostomy, BAB sedikit-sedikit, banyak gas yang ikut keluar, BAB keras,
berwarna kuning, nyeri perut (-), muntah (-), perut teraba distensi dan cembung.
Perawat merencanakan untuk dilakukan wash out untuk mengatasi kesulitan BAB
pada klien tersebut.
Apakah cairan yang digunakan dalam rencana tindakan tersebut ?
a.
NaCl 0,9% dingin
b.
NaCl 0,9% hangat
c.
Ringer Laktat dingin
d.
Ringer Laktat hangat
e.
Air Kran Biasa hangat
45. Anak perempuan usia 3 tahun sudah 2 hari dirawat di ruang anak dengan keluhan
sulit BAB, ada riwayat menggunakan pencahar semingggu sekali, perutnya
kembung, muntah sudah dua kali sehari, muntah berwarna hijau, pada pemeriksaan
lubang anus teraba menjepit, bibir kering, turgor kulit lambat, BB 12 kg, frekuensi
nafas 25x menit, frekuensi nadi 128x/menit
Apakah rencana tindakan yang tepat untuk mengatasi masalah prioritas kasus di
atas?
a.
Pemasangan nasogastric tube
b.
Pemasangan rectal tube
c.
Pemberian infus cairan N4
d.
Pemberian nutrisi yang lunak
e.
lakukan pemberian oksigen
46. Anak perempuan usia 14 tahun datang ke poli anak dengan keluhan sering pusing,
dan mudah lemah, saat pengkajian ditemukan conjunctiva anemis, bibir pucat dan
kering, BB 25 kg, TB 138 cm, HB 9 gr%, Ibunya bertanya kepada perawat jenis
makanan yang sebaiknya diberikan kepada anaknya.
Apakah perencanaan pendidikan nutrisi selain protein yang dibutuhkan oleh anak
tersebut ?
a.
Nutrisi yang mengandung besi, vitamin C dan Calcium
b.
Nutrisi yang mengandung besi, vitamin B12 dan thiamin
c.
Nutrisi yang mengandung besi, vitamin A dan Asam Folat
d.
Nutrisi yang mengandung besi, vitamin B12 dan asam folat
e.
Nutrisi yang mengandung besi, vitamin E dan Riboflavin
47. Anak perempuan usia 1 tahun dengan dibawa ibunya dengan keluhan sesak nafas.
Sesak nafas yang disertai batuk, pilek dan panas. Pada pemeriksaan fisik kulit
tampak pucat, suara nafas terdengar wheezing (+), rochi (+) tampak retraksi
interkostal pada epigasrium, perkusi area paru terdengar dullness, pergerakan paru
kurang maksimal nadi 120 kali/menit, Respirasi rate 32x/menit, suhu 38,7 C, , BB 8,2
kg (BBL 3200 gr). pemeriksaan laboratorium, HB 11,2 gr%, leukosit 6900/mm3,
glukosa sewaktu 128 mg/dl
Apakah diagnosa keperawatan yang prioritas pada kasus di atas ?
a.
Tidak efektifnya jalan nafas berhubungan dengan akumulasi sekret
b.
Gangguan pola nafas berhubungan dengan hipersensitifitas
c.
Gangguan pemenuhan nutrisi kurang dari kebutuhan berhubungan dengan
anoreksia
d.
Gangguan perfusi jaringan berhubungan dengan kurangnya suplai oksigen

e.

Gangguan keseimbangan cairan dan elektrolit berhubungan dengan


peningkatan suhu tubuh
48. Seorang anak laki-laki usia 10 bulan datang ke poli Anak dengan keluhan lemah.
Pada saat dikaji klien tampak lemah, pucat, conjuctiva tampak ikterus, kulit berwarna
hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran hati dan
limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 8 kg, HB 5gr% Ht 22 % ,
Fe 1500 gr/dl
Apakah diagnosa keperawatan yang prioritas pada kasus di atas ?
A.
Gangguan rasa nyaman berhubungan dengan
B.
Gangguan perfusi jaringan berhubungan dengan anemia
C.
Gangguan body image berhubungan dengan kulit berwarna hitam
D.
Gangguan pemenuhan nutrisi berhubungan dengan anoreksia
E.
Resiko injury berhubungan dengan hemosiderosis
49. Anak laki-laki usia 7 tahun dibawa ibunya datang ke poli anak, , menurut ibunya
setiap 2 minggu anaknya rutin datang untuk mendapatkan tranfusi, saat dilakukan
pengkajian tampak lemah, pucat anak sulit makan, conjuctiva tampak ikterus, kulit
berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran
hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 13 kg, HB 8 gr%
Ht 24 %
Apakah perencanaan pendidikan nutrisi yang tepat pada klien di atas?
a. Anjurkan ibu untuk membatasi anaknya makan sayuran hijau
b Anjurkan ibu untuk memberikan multivitamin yang mengandung Fe
c Anjurkan ibu untuk memberikan anaknya makan tinggi serat
d Anjurkan ibu untuk memberikan makanan tinggi karbohidrat
e. Anjurkan ibu untuk membatasi pemberian garam

50. Anak perempuan usia 2 bulan dibawa oleh ibunya untuk dilakulan imunisasi, ibu
mengatakan anaknya akan dilakukan imunisasi selanjutnya, Hasil pengkajian anak
telah diimunisasi Hepatitis B1 dan Polio 1
Apakah jenis imunisasi dasar yang selanjutnya diberikan ?
a. DPT 1, Polio 2,
b. Hepatitis B 2, Polio 2
c. Campak, Polio-2
d. Hepatitis B-2, DPT 1
e . DPT 2, Hepatitis B2

51. Seorang bayi laki-laki lahir dengan BB 2 Kg, proporsi kepala Nampak lebih besar
daripada badan, kulit tipis transparan, lanugo banyak terutama pada dahi, pelipis,
telinga dan lengan, lemak kulit kurang, ekstremitas Nampak kebiruan, genitalia

a.
b.
c.
d.
e.

teraba testis belum turun. Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60
x/menit, frekuensi nadi 100 x/menit, suhu 35,80C
Apakah diagnose keperawatan prioritas dari kasus diatas ?
Gangguan keseimbangan suhu tubuh; hypotermi s.d proses adaptasi dengan
lingkungan luar rahim
Resti kekurangan volume cairan dan elektrolit s.d efek dari inkubator
Gangguan pola nafas s.d imaturitas organ pernafasan
Inefektifitas jalan nafas s.d penumpukan sekret
Infeksi s.d imaturitas imonoglobulin

52. Seorang anak usia 3 tahun sedang di rawat di RS. Anak nampak ketakutan, terus
menangis dan tidak mau ditinggal ibunya.
Apakah Intervensi keperawatan yang dapat diberikan untuk mengurangi dampak
hospitalisasi pada anak tersebut?
a.
Memaksimalkan manfaat hospitalisasi
b.
Meminimalkan sressor atau penyebab stres.
c.
Memberikan permainan sesuai dengan usianya
d.
Memberikan dukungan pada anggota keluarga lain
e.
Mempersiapkan anak untuk mendapat perawatan di RS

53. Seorang anak laki-laki berusia 6 tahun datang bersama ibunya ke RS dengan
keluhan sejak 2 minggu yang lalu badannya panas menggigil, keluhan disertai
pusing, mual, nafsu makan menurun. Pada pemeriksaan fisik diperoleh BB turun
hingga 20%, klien tampak pucat, mukosa bibir kering, nyeri ulu hati skala 4, kadang
disertai diare, muntah 4x/hr.Pada pemeriksaan tanda vital diperolehSuhu= 380C.
TD= 90/60, frekuensi nadi = 104x/mnt.Hasil Pemeriksaan Diagnostik: Pemeriksaan
darah tepi (DDR) plasmodium fositif.
Apakah Masalah keperawatan utama yang mungkin muncul?
a.
Gangguan perfusi jaringan otak
b.
Deficit cairan dan elektrolit
c.
Inefektif jalan nafas
d.
Hipotermi
e.
Mual

54. Seorang bayi berusia 3 hari datang dengan keluhan dari ibunya kuning. Pada
pemeriksaan fisik diperoleh BB 2 Kg, bayi tidak mau menetek, perut tampak buncit.
Pada pemeriksaan tanda-tanda vital diperoleh frekuensi nadi 120 x/menit, frekuensi
nafas 50 x/menit, suhu 370. Pada pemeriksaan laboratorium diperoleh kadar bilirubin
serum 13 mg%.
Apakah tindakan perawat yang harus dilakukan pada pasien diatas?
a.
Melakukan fototherapy
b.
Memberikan therapy cairan
c.
Mengobservasi tanda-tanda vital
d.
Memasukkan klien ke dalam inkubator
e.
Menjaga keseimbangan suhu tubuh klien

55. Seorang bayi usia 10 hari dibawa oleh ibunya ke RS dengan keluhan kejang-kejang
dan tidak dapat menetek. Pada hasil pemeriksaan ditemukan ada trismus pada otot
mulut, leher kaku, terjadi opistotonus, kadang terjadi kejang pada otot pernafasan,
bayi nampak sianosis. Pemeriksaan tanda-tanda vital diperoleh suhu 390C, frekuensi
pernafasan 65x/menit, frekuensi nadi 100 x/menit.
Apakah tindakan pertama yang harus dilakukan perawat untuk mengatasi gangguan
fungsi pernafasan pada bayi tersebut?
a.
Atur posisi bayi dengan kepala ekstensi
b.
Berikan oksigen 1-2 liter/menit
c.
Observasi tanda-tanda vital setiap setengah jam
d.
Bersihkan jalan nafas
e.
Pasangkan sudip lidah

56. Bayi A usia 6 hari di rawat di ruang cempaka rumah sakit harapan anak. Saat ini bayi
a tidak mau meneteki ke ibunya. Reflek menghisap kurang. Bayi sering terlihat tidur.
Berat badan 1900 gram bilirubin 15 mg/dl
Apakah Intervensi keperawatan yang tepat untuk mengatasi masalah nutrisi bayi
tersebutt?
A. Memberikan ASI lewat sendok 10 ml tiap 2 jam
B. Memasang Nasogastric tube.
C. Mengganti ASI dengan susu formula
D. Memberikan dukungan pada ibu untuk terus meneteki
E. Mempersiapkan anak untuk mendapat perawatan di NICU

57. Anak A 6 tahun datang bersama ibunya ke puskesmas dengan keluhan sejak 3 hari
yang lalu anak nya diare BAB 5x/hari, disertai adanya muntah. Pada pemeriksaan
fisik diperoleh BB turun hingga 20%, klien tampak pucat dan lemah, mukosa bibir
kering,Cubitan kulit perut kembali sangat lambat ( 2 detik). Pada pemeriksaan tanda
vital diperolehSuhu= 380C. TD= 90/60 mmHg, frekuensi nadi = 104x/mnt. BB : 20 kg
Apakah intervensi keperawatan utama yang harus dilakukan?
a. Berikan infuse cairan ringer laktat sebanyak 600 ml dalam 1 jam pertama
b. Siapkan rujukan ke rumah sakit terdekat
c. Berikan oksigen 3 l/mnt lewat nasal canule
d. Berikan tablet zinc 20 mg/hari selama 10 hari
e. Berikan larutan oralit menggunakan pipa nasogastrik

58. Seorang bayi berusia 3 hari dirawat di rumah sakit. Ketika perawat mau
memandikan keluarga pasien menolak dengan alas an memegang kepercayaan
bahwa selama sakit pasien jangan dimandikan sampai benar benar sembuh.
Apakah tindakan perawat yang harus dilakukan pada pasien diatas?
a. Tidak jadi memandikan pasien dengan alasan menghargai kepercayaan
keluarga
b. Memandikan klien dengan alasan menjaga kebersihan di lingkungan rumah sakit
c. Memberikan pendidikan kesehatan tentang personal higiene kepada keluarga
pasien
d. Hanya mencuci muka pasien
e. Mengganti baju pasien

59. Seorang anak usia 14 tahun hari dirawat di ruang mawar rs. Harapan anak. Pasca
operasi apendictomi hari ke-2. Pasien mengeluh lapar dan haus. Pada hasil
pemeriksaan ditemukan Bising usus 6 x/ mnt suhu 37.80C, frekuensi pernafasan
28x/menit, frekuensi nadi 100 x/menit pasien mengaku belum buang angin (flatus)
Apakah tindakan pertama yang harus dilakukan perawat terkait keluhan anak
tersebut?
a. Tetap dipuasakan sampai pasien flatus
b. Berikan bubur saring
c. Berikan minum air putih secara bertahap.
d. Berikan makanan hangat sedikit tapi sering
e. Berikan jus buah lewat sedotan

60. Seorang anak usia 14 tahun telah dirawat di rumah sakit selama 8 hari diagnose
typoid. Pasien saat ini ada rencana pulang Pasien tampak lemas dan dianjurkan
bedrest selama di rumah. Ibu Pasien bertanya kepada perawat tentang perawatan di
rumah. nutrisi apa yang sebaiknya diberikan terhadap pasien selain bubur saring .
Diagnosa keperawatan yang muncul pada keluarga pasien diatas?
a.
Kesiapan keluarga pasien meningkatkat pengetahuan tentang nutrsi pasien
b.
Cemas sehubungan dengan kurang pengetahuan
c.
Gangguan komunikasi verbal
d.
Gagguan nutrsi kurang dar kebutuhan tubuh
e.
Gangguan pola pemenuhan nutrisi.

61. Ibu dari seorang bayi preterm 35 minggu yang sudah dirawat selama 6 hari.
Menyatakan kekahwatiran tentang pemberian asi. Ia mengatakan bayi mengalami
episode apneu sekali sampai dua kali selama menyusui. Bb bayi meningkat 15002000 mg tiap hari respirasi : 30 x/menit
intervensi keperawatan apa yang akan dilakukan pada ibu diatas?
a.
Menganjurkan ibu jangan dulu meneteki
b.
Menganjurkan ibu untuk memberikan asi lewat dot
c.
Menjelaskan kepada ibu bahwa bayi perlu dipasang ngt
d.
Dorong ibu untuk terus memberikan makan kepada bayinya dengan periode
istirahat dan jeda yang sering
e.
Memberitahukan kepada ibu bahwa apneu sesuatu yang biasa terjadi untuk bayi
preterm
62. Bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk melakukan
imunisasi. Pada pemeriksaan didapatkan hasil yaitu berat badan 9 kg, suhu tubuh
36,8C, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi BCG, DPT
I dan Polio 2.
Imunisasi apa yang sekarang harus diberikan?
A.
DPT II Polio II
B.
DPT II Polio III
C.
DPT II Polio IV
D.
DPT III Polio III
E.
DPT III Polio IV

63. Anak perempuan umur 1 tahun, dibawa oleh orangtuanya ke RS karena mengalami
pembesaran kepala sejak 1 bulan yang lalu, kemudian perawat melakukan
pemeriksaan fisik, didapatkan hasil: lingkar kepala 59 cm, berat badan 8 kg, tinggi
badan 72 cm, terdapat sunset sign, belum bisa berjalan, aktifitas fisik hanya di
tempat tidur atau digendong oleh orangtuanya.
Apa masalah keperawatan utama pada kasus diatas?
A.
Gangguan pertumbuhan dan perkembangan
B.
Gangguan nutrisi kurang dari kebutuhan
C.
Resiko tinggi gangguan integritas kulit
D.
Resiko gangguan cairan dan elektrolit
E.
Kurangnya pengetahuan orangtua
64. Seorang anak laki-laki yang berusia 11 bulan dibawa oleh ibunya ke Poli Thalasemia
dengan keluhan mudah sakit, wajah yang pucat, sklera anemis. Hasil pemeriksaan
laboratorium 3 gr/dl, diagnosa medis Thalasemia
Apakah implementasi utama yang dilakukan?
A.
Memberikan cairan infus
B.
Memberikan transfusi darah
C.
Memberikan nutrisi yang adekuat
D.
Memberikan informasi yang benar
E.
Memberikan Penyuluhan kesehatan tentang penyakit Thalasemia.
65. Bayi baru lahir akan mengeluarkan tinja pertamanya (mekonium) dalam 24 jam
pertama, namun pada bayi yang menderita penyakit Hisprung (akibat dari
kelumpuhan usus besar dalam menjalankan fungsinya), maka tinja tidak dapat
keluar, tinja akan keluar terlambat atau bahkan tidak dapat keluar sama sekali.
Selain itu perut bayi juga akan terlihat menggembung, disertai muntah. Jika dibiarkan
lebih lama, berat badan bayi tidak akan bertambah dan akan terjadi gangguan
pertumbuhan.
Apakah tindakan bedah sementara pada Bayi tesebut ?
A.
Kolostomi
B.
Colok dubur
C.
Atresia ani
D.
Operasi besar
E.
Laparatomi
66. An. C laki-laki, berumur 2 tahun mengalami diare sejak 2 hari yang lalu, dibawa ke
rumah sakit dalam kondisi dehidrasi dengan penurunan kesadaran.
Apa penyebab utama penurunan kesadaran An.C?
A.
Hipoperfusi jaringan serebral karena penurunan volume vaskuler
B.
Penurunan fungsi hemodinamik dan kelelahan jantung
C.
Penekanan pada pusat vital dan kesadaran di otak
D.
Mekanisme diuresis pada kerusakan jaringan ginjal
E.
Kondisi dehidrasi
67. Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak
dengan keluhan sejak 2 minggu terakhir bayi BAB 4 5 x/hari dengan keluaran sisa
makanan yang belum tercerna dengan baik. Ibu bekerja sebagai guru, memberikan
asi 1 x sebelum bekerja dan 3 4 kali sepulang bekerja. Sehari-hari bayi diurus oleh
neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk
peras 2 x/hari, susu buatan 3x/hari.
Apakah anjuran yang paling tepat saudara berikan pada ibu bayi?
A.
Pemberian bubur susu dihentikan
B.
Pemberian sari jeruk peras dihentikan
C.
Pemberian susu buatan dihentikan
D.
Pemberian asi dilanjutkan dengan frekuensi ditambah

E.

Pemberian asi dihentikan karena tidak efektif

68. Seorang ibu sedang cemas melihat bayinya (8 bln) sesak dan nafas bunyi grokgrok. Setelah dilakukan pemeriksaan fisik didapatkan : Nadi 92 kali/mnt, Suhu 38.5
C, Pernapasan 52 kali/mnt, tampak tarikan dinding dada kedalam dan pernapasan
cuping hidung.
Apakah tindakan keperawatan yang utama pada bayi tersebut
A.
Lakukan physiotherapi dada
B.
Beri oksigen 2 ltr/mnt
C.
Posisikan bayi trendelenburg
D.
Posisikan bayi semi fowler
E.
Gunakan baju yang tipis dan longgar
69. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir
setelah dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung
88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan
usaha bernafas lambat/lemah
Berapa nilai APGAR Score pada bayi tersebut ?
A.
4
B.
5
C.
6
D.
7
E.
8
70. Seorang anak laki-laki umur 3 th dibawa ke UGD RS dengan keluhan demam. Hasil
pengkajian ditemukan anak panas sudah 4 hari yang lalu, badan panas suhu 39,50
c, bibir kering, ada perdarahan hidung, mual muntah, anak tidak mau makan dan
minum.
Pengkajian kulit apa yang perlu di kaji pada kasus diatas ?
A.
Ruam
B.
Lesi
C.
Petekhie
D.
Bula
E.
Vesikula
71. An.A, usia 2 tahun dibawa orangtuanya ke poliklinik anak, dengan keluhan utama
sering BAB 3-4 x sehari, dengan konsistensi cair, dan ada darah berwarna merah
marun. Anak rewel, lesu, suhu tubuhnya 380 C, turgor kulit kembali lambat.
Apakah diagnosa medis yang paling tepat pada kasus diatas?
A.
Diare.
B.
Disentri.
C.
Demam berdarah.
D.
Influenza .
E.
Dehidrasi.
72. An.F berumur 8 tahun datang ke UGD di bawa oleh orang tuanya,orang tua An F
mengatakan bahwa setelah pulang sekolah, an. F mengatakan sesak nafas dan
batuk batuk pada saat d kaji didapatkan riwayat keluarga astma, dan respirasi pada
saat itu 32 x/ menit dan terdapat suara wheezing, terdapat penggunaan otot nafas
tambahan dan terdapat retraksi intercostal
Apakah masalah keperawatan yang tepat pada kasus diatas ?
a.
Bersihan jalan nafas tidak efektif
b.
Kerusakan pertukaran gas
c.
resiko aspiksia

d.
e.

Intoleransi aktifitas
resiko asidosis respiratorik

73. Seorang ibu yang memiliki anak berumur 4 bulan datang ke poliklinik anak, ibu
terlihat bingung dan cemas, ibu mengatakan bahwa bayinya sejak kemarin panas,
tapi dia tetap datang ke poliklinik karena hari ini adalah jadwal imunisasi DPT dan
polio, pada saat di kaji suhu badan An C adalah 40C
Bagaimana respon Saudara menanggapi kasus di atas ?
A.
Anjurkan ibu untuk mengimunisasi anaknya setelah demamnya turun dan
kolaborasi untuk pemberian Antipiretik
B.
perawat kolaborasi dengan dokter untuk pemberian antibiotic
C.
menganjurkan kepada ibu karena anak ibu sedang sakit sekarang, jadi dia tidak
boleh mendapatkan imunisasi
D.
Menganjurkan datang pada jadwal berikutnya dan memberikan doble dosis
pada an.F
E.
Pemberian imunisasi tetap dianjurkan walaupun pasien panas tinggi
74. Seoarang bayi berusia 8 bulan diantar oleh orang tuanya ke UGD, dengan keluhan
orang tuanya mengatakan bahwa sudah dari sehari yang lalu anaknya BAB per hari
lebih dari 5 kali dengan konsistensi encer, di sertai muntah dan demam. Hasil
pengkajian menunjukkan terlihat anak sangat lemas dan pucat, membran mukosa
kering, turgor kulit jelek, ubun ubun cekung
Apakah masalah keperawatan yang tepat pada kasus diatas ?
a.
gangguan rasa nyaman nyeri
b.
kekurangan cairan dan elektrolit
c.
gangguan integritas kulit
d.
hipertemi
e.
perubahan nutrisi kurang dari kebutuhan tubuh
75. Seorang anak laki laki usia 9 tahun datang ke IGD RS diantar ibunya, dengan
keluhan mual, muntah dan BAB cair sudah 5 kali dalam sehari, hasil pemeriksaan
tanda vital : TD 90/70 mmhg,Suhu 38,5,Nadi 90 x/meit Pernapasan 30x/mnt turgor
kulit jelek, .mucosa bibir tampak kering an wajah pucat, mata cekung.
Apakah intervensi keperawatan yang tepat pada kasus tersebut ?
a.
Berikan terapi cairan perparentral
b.
Kaji tanda-tanda dehedrasi
c.
Berikan makan sedikit tapi sering
d.
Kaji tanda-tanda vital
e.
kolaborasi pemberian obat
76. Seorang anak usia 4 tahun dirawat ruang Anak, dengan keluhan buang buang air
sudah sejak 3 hari yg lalu, Hasil pemeriksaan didapatkan anak mengalami
dehidrasi sedang. terpasang infuse RL makro. Advis dokter infuse diberikan selama
24 jam
Berapakah jumlah tetesan infus dalam satu menit selama 24 jam ?
a.
16 tts/mnt
b.
19 tts/mnt
c.
22 tts/mnt
d.
32 tts/mnt
e.
33 tts/mnt
77. Seorang bayi laki-laki berusia 8 bulan dibawa ibunya ke UGD RS dengan keluhan
utama BAB cair 4 kali dan muntah 2 kali. Pemeriksaan fisik : BB 6,5 kg. Suhu :

A.
B.
C.
D.
E.

38,5C, Nadi : 90x/menit, Respirasi : 30x/menit. Turgor kulit kembali lebih dari 3
detik, bibir agak kering, area perianal kemerah-merahan, perut kembung.
Apakah diagnosa keperawatan prioritas pada kasus diatas?
Kerusakan integritas kulit area perianal berhubungan dengan seringnya terpapar
feces yang cair.
Hyperthermia berhubungan dengan proses inflamasi; dehidrasi
Kekurangan volume cairan berhubungan dengan kehilangan cairan yang aktif;
diare
Perubahan nutrisi kurang dari kebutuhan tubuh berhubungan dengan anoreksia.
Gangguan rasa nyaman berhubungan dengan peningkatan motilitas usus.

78. Seorang anak perempuan usia 10 tahun mengeluh lemas dan cepat lelah. Dari
hasil pengkajian terlihat konjungtiva anemis, mukosa bibir pucat, dan hasil
pemeriksaan BB 15 kg, HB : 9 gr/dl. Pasien tersebut telah diberikan terapi sulfa
ferous 3 mg/hari.
Apakah masalah keperawatan pada pasien di atas?
a.
Resiko terjadi cedera
b.
Kebutuhan nutrisi
c.
Gangguan psikososial
d.
Kurangnya pengetahuan
e.
Gangguan rasa aman dan nyaman
79. Seorang anak perempuan berusia 12 tahun dengan BB 26 Kg terkulai lemas di poli
thalasemia , perut klien terlihat buncit,kulit pucat kekuning-kuningan, klien tampak
murung,tidak kooperatif dan membatasi kontak dengan orang lain.
Apakah prioritas masalah keperawatan yang muncul pada kasus diatas?
a.
Nutrisi kurang dari kebutuhan
b.
Gangguan perfusi jaringan
c.
Gangguan psikososial
d.
Gangguan nyaman nyeri
e.
Kurang cairan tubuh

80. Seorang ibu dari anak laki-laki berusia 6 tahun yang menderita penyakit defek
jantung kongenital menanyakan pada perawat, mengapa anaknya harus mengambil
posisi jongkok saat tampak lelah setelah melakukan aktivitas.
Apa yang dapat perawat jelaskan mengenai hal tersebut?
A.
Memudahkan aliran pernafasan
B.
Mengurangi sakit pada otot kaki
C.
Meningkatkan efisiensi kerja jantung
D.
Menurunkan aliran volume darah pada ekstremitas
E.
Mencegah terjadinya gagal jantung
81. Seorang bayi perempuan berusia 9 bulan dirawat di ruang perawatan intensif
dengan distress pernafasan karena bronkhopneumonia. Pengkajian saat ini
menunjukkan kesadaran anak apatis, banyak sekret di hidung dan mulut, terdapat
retraksi interkosta, terdengar stridor, reflek batuk lemah, akral teraba dingin, suhu
36,8C, nadi 144x/menit, frekuensi pernapasan 68x/menit, dan tekanan darah 100/70
mmHg.
Apakah masalah keperawatan utama yang dialami anak tersebut ?
A.
Perfusi jaringan perifer tidak efektif
B.
Bersihan jalan nafas tidak efektif
C.
Gangguan pertukaran gas

D.
Pola nafas tidak efektif
E.
Hipotermi
82. Seorang anak laki-laki berusia 24 bulan, datang ke klinik tumbuh kembang, perawat
yang mengkaji melihat perkembangan motorik kasar menunjukkan dia sudah dapat
mengikuti perintah untuk berdiri dan jongkok, mulai dapat mengungkapkan
keinginannya pada orang lain, dan mulai tertarik untuk bermain bersama teman
sebayanya.
Hal apa terkait bimbingan antisipasi yang harus dijelaskan pada orangtua?
A.
Mengenalkan mainan baru untuk mengembangkan kemampuan motorik dan
sosial
B.
Mendiskusikan untuk kebutuhan anak untuk dilibakan pada setiap kegiatan
C.
Menyiapkan orangtua untuk mengantisipasi adanya perubahan perilaku
D.
Mendiskusikan kesiapan fisik dan psikologis untuk toilet training
E.
Mempersiapkan kehadiran adik baru
83. Seorang anak perempuan, berusia 4 tahun, dibawa ke unit gawat darurat,
didiagnosis mengalami dengue syok sindrom, pengkajian menunjukkan adanya
penurunan kesadaran, tekanan darah 63/39 mmHg, frekuensi pernapasan 61
x/menit, pusing, muntah 5 kali, perut kembung, kelopak mata bengkak, edema
palpebra, mukosa bibir kering, sesak, terlihat pernafasan cuping hidung, ada ronkhi,
berat badan 16 Kg, saat ini masih dipuasakan.
Data prioritas apakah yang harus dikaji untuk melengkapi data diatas?
A.
Suhu tubuh menurun
B.
Nadi teraba kecil dan cepat
C.
Terjadi retraksi dinding dada
D.
Cairan lambung berwarna kecoklatan
E.
Suara napas menurun di salah satu sisi paru
84. Seorang anak laki-laki berusia 8 tahun, di rawat di ruang perawatan anak dengan
diagnosa medis nefrotik sindrom, dari pengkajian fisik didapatkan oedema di sekitar
wajah terutama palpebra, pembengkakan di abdomen. Perawat yang bertanggung
jawab merawat anak tersebut melakukan penghitungan berapa cairan yang
diperbolehkan untuk diminum setiap harinya, pengukuran asupan dan haluaran
dengan akurat, mengkaji perubahan lingkar perut setiap hari, dan mengobservasi
derajat oedema.
Apakah sasaran yang ingin dicapai dari tindakan perawat tersebut?
a.
Akumulasi cairan pada tubuh pasien tidak terjadi
b.
Pasien tidak mengalami kehilangan cairan intravaskuler
c.
Pasien mendapatkan rasa nyaman dan aman
d.
Kebutuhan nutrisi pasien terpenuhi
e.
Pasien terhindar dari rasa nyeri
85. Seorang anak laki-laki berusia 2 tahun dengan diagnosa medis hydrocephlus, 5 hari
yang lalu telah menjalani operasi VP shunt, saat ini kondisi tand-tanda vital stabil, VP
shunt berfungsi dengan baik, lingkar kepala berkurang 1,5 cm, dan asupan-haluaran
seimbang. Anak ini esok hari sudah diperbolehkan pulang dan melanjutkan
perawatan di rumah.
Pendidikan kesehatan yang paling tepat diberikan pada orangtuanya hari ini adalah
A.
Cara mengganti balutan VP shunt
B.
Bagaimana perkembangan anak saat ini
C.
Bagaimana tanda dan gejala jika shunt tidak berfungsi
D.
Menerangkan prosedur VP shunt
E.
Menerangkan hasil operasi VP shunt

86. Seorang anak perempuan berusia 3 tahun lahir pada usia kandungan 30 minggu
dengan berat lahir 2000 gr, setelah satu minggu di rumah tiba-tiba bayi menolak
minum dan selalu dimuntahkan lagi, saat pengkajian fisik ditemukan distensi
abdomen dan mekonium yang tercampur dengan darah.
Mengapa bayi prematur berpotensi mengalami masalah seperti bayi dalam kasus
diatas ?
a.
Lapisan lemaknya tipis sehingga memicu kondisi iskemi
b.
Kemampuan menghisap yang belum baik
c.
Imaturitas saluran cerna dan imun respon yang rendah
d.
Volume lambung minimal
e.
Dampak pemberian susu formula terlalu dini
87. Bayi berusia 5 hari dengan NEC dirawat di ruang NICU, pada pengkajian fisik
ditemukan data diameter rongga thoraks meningkat, suara paru redup, hasil
laboratorium menunjukkan asidosis respiratori
Apa yang menyebabkan adanya perubahan anatomi thoraks pada bayi tersebut?
a.
Akibat pemberian oksigen tekanan positif
b.
Efek samping penggunaan ambubag
c.
Karena aspirasi ringan
d.
Karena frekuensi nafas meningkat
e.
Akibat retraksi interkostal untuk kompensasi

88. Seorang anak laki-laki berusia 6 tahun dibawa oleh ibunya ke rumah sakit dengan
keluhan sudah 5 hari mengalami demam, lemah, tidak nafsu makan. Hasil
pemeriksaan terdapat papula dan vesikel di sekitar punggung dan dadanya
Menurut ciri-ciri yang ada, apa yang dialami oleh anak tersebut ?
a.
Morbili stdium prodormal
b.
Morbili stadium erupsi
c.
Morbili stadium konvalensi
d.
Varicella stadium prodormal
e.
Varicella stadium erupsi
89. Seorang laki-laki berusia 10 hari dengan datang ke bagian IGD suatu rumah sakit
dengan keluhan sering muntah saat diberi ASI, kondisi bayi tersebut lemah dan
terlihat distensi abdomen. Petugas medis yang memeriksa mencurigai bayi tersebut
mengalami nekrosis enterokolitis.
Intervensi pertama yang tepat dilakukan untuk kondisi tersebut adalah ?
a.
Memasang NGT
b.
Memasang OGT
c.
Menghentikan pemberian ASI
d.
Cek gula darah
e.
Cek leukosit
90. By A dibawa ke rumah sakit karena ada penonjolan pada ubun-ubunnya. Ubun-ubun
belum mengeras dan ukuran kepala yang lebih besar dari ukuran kepala sebayanya.
Dan terdapat benjolan lunak dibagian hidungnya. Ibu bayi A mengatakan bayi A
sukar untuk menetek, By A semakin hari semakin rewel dan tangisannya semakin
keras ketika digendong. Menurut ibunya By A jarang berganti posisi tidur. Lingkar
kepala 60 cm,dahi tampak mengkilat dengan pelebaran vena kulit kepala. Sunset
phenomenon +, letargik, HR 109x/menit, RR 35 x/menit.
Berdasarkan kasus di atas, sebagai deteksi dini dapat dilakukan pemeriksaan berikut
ini
a.
Pemeriksaan darah

b.
Pemeriksaan CT Scan
c.
Pemeriksaan lingkar kepala
d.
Pemeriksaan teksturkepala
e.
Pemeriksaan system syaraf cranial
91. By A dibawa ke rumah sakit karena ada penonjolan pada ubun-ubunnya. Ubun-ubun
belum mengeras dan ukuran kepala yang lebih besar dari ukuran kepala sebayanya.
Dan terdapat benjolan lunak dibagian hidungnya. Ibu bayi A mengatakan bayi A
sukar untuk menetek, By A semakin hari semakin rewel dan tangisannya semakin
keras ketika digendong. Menurut ibunya By A jarang
berganti posisi tidur. Lingkar kepala 60 cm,dahi tampak mengkilat dengan pelebaran
vena kulit kepala. Sunset phenomenon +, letargik, HR 109x/menit, RR 35 x/menit
Diagnosa keperawatan yang muncul pada kasus di atas
a. Resiko tinggi peningkatan tekanan intracranial bd peningkatan jumlah cairan
serebrospinal
b. Perubahan nutrisi:kurang dari kebutuhan bd inadekutnya asupan nutrisi
c. Immobilitas fisik berhubungan dengan pembesaran kepala
d. Nyeri bd peningkatan intrakranial
92. An.X dikaji terdengar suara murmur, sesak apabila sedang beraktivitas, anak
mengeluh lelah, anak terlihat pucat, ujung-ujung jari hiperemik
masalah keperawatan utama yang muncul, adalah
a.
Gangguan perfusi jaringan
b.
Gangguan aktivitas
c.
Resiko tinggi gangguan pertumbuhan dan perkembangan
d.
Resiko tinggi gagal jantung
93. An. X, 16 tahun, datang ke RS dengan keluhan menorraghia, dan sering mengalami
perdarahan di hidung dan gusi.selain itu jika terdapat laserasi maka selalu
mengalami perdarahan yang cukup lama, fatigue, dan mengeluh sulit untuk
konsentrasi, Terdapat melena. Hasil pemeriksaan fisik terdapat petechie di
ekstremitas, terdapat hematom di daerah mulut. Hati, limfa dan getah bening tidak
membesar. Hasil lab : trombosit 9.600 per l, terjadi leukositosis, Hb 12 mg/dl.
Masa perdarahan memanjang, masa pembekuan normal, retraksi bekuan
abnormal,prothrombin consumption time memendek. Tes Rumple-Leed positif.
Apakah yang menyebabkan melena pada anak X?
A. Adanya petechie
B. Leukositosis
C. Trombosit 9600 per l
D. Tes rumple- Lees positif
E. Limfa dan hati membesar
94. An. X 8 bulan dibawa ibunya ke RS untuk ditransfusi darah, menurut ibunya, an.x
sdh 2 bulan ini di transfuse darah. Program tranfusi darah yang regular ini diberikan
karena kadar HB yang cukup rendah,
Apakah tujuan dari transfuse darah pada an. X?

A.
B.
C.
D.
E.

Mengganti eritrosit yang pecah


Memelihara kadar Hb minimum 9,5-10,5 g/dl
Meningkatkan kadar Hb sampai normal 12,5-13 g/dl
Mengganti rantai beta pada hemoglobin
Menambah sel darah merah yang kurang

95. An. X 13 tahun datang ke RS bersama ayahnya untuk dilakukan transfuse darah,
transfuse darah sudah dilakukan sejak berusia 8 bulan. hasil pemeriksaan fisik :
perut buncit, jantung berdebar, dan gambaran EKG aritmia. Gangguan jantung pada
kasus diatas disebabkan karena
Apakah penyebab gangguan jantung pada an.
A.
Peningkatan erithropoisis
B.
Peningkatan kadar besi
C.
Stimulasi erithropoitin di bone marrow
D.
Kadar Hb yang cukup rendah
E.
Adanya virus di dalam darah transfuse
96. Hasil pemeriksaan radiologis pada anak thalasemia didapatkan : medulla yang lebar,
korteks yang tipis, trabekulla kasar, hemosiderosis pada kelenjar endokrin, hair-onend pada tulang kepala. Hasil pemeriksaan darah terdapat penurunan Hb yang
cukup besar. An. X mendapat terapi khelasi dengan disperal. Hasil wawancara
ternyata kakeknya mengalami penyakit yang sama.
Apakah tujuan diberikan terapi khelasi ?
A.
Untuk mengurangi infeksi di dalam darah
B.
Untuk mengurangi peningkatan zat besi
C.
Untuk meningkatkan produksi hemoglobin
D.
Untuk memperbaiki rantai globin yang rusak
E.
Untuk mengurangi pembesaran pada hati
97. Seorang anak laki-laki berusia 5 tahun penderita TB paru mengalami kesulitan
bernafas, hasil pemeriksaan fisik pernafasan : 35 x/menit, auskultasi paru rocnhi di
kedua lobus paru.
Apakah prioritas tindakan yang harus dilakukan untuk mengatasi masalah tersebut ?
a.
Berikan hidrasi
b.
Lakukan suction
c.
Lakukan nebulasi
d.
Lakukan postural drainase
e.
Lakukan clapping, vibrasi, dan batuk efektif
98. Seorang bayi laki-laki usia 1 bulan dirawat di ruang anak mengalami diare, hasil
pemeriksaan fisik di dapatkan hasil BAB lebih dari 10 kali, konsistensi cair, suhu
tubuh : 38oC, bayi tampak lemas, ubun-ubun tampak cekung
Apakah prioritas tindakan keperawatan yang harus dilakukan?
a.
Berikan diet lunak
b.
Berikan terapi cairan
c.
Berikan terapi analgetik
d.
Berikan terapi antibiotic
e.
Berikan terapi antipiretik
99. Seorang anak perempuan usia 10 tahun menderita gizi buruk di rawat di ruang anak
rumah sakit umum daerah. Hasil pemeriksaan fisik di dapatkan pernafasn : 30
x/menit, suhu : 38oC, ronchi positif di lobus kanan. Hasil pemeriksaan laboratorium
Hb : 10, hasil biakan sputum positif TB paru.
Apakah masalah keperawatan utama pada kasus di atas ?
a.
Pola nafas tidak efektif
b.
Peningkatan suhu tubuh
c.
Perfusi jaringan inefektif
d.
Bersihan jalan nafas tidak efektif
e.
Nutrisi kurang dari kebutuhan tubuh
100.
Seorang bayi laki-laki usia 3 bulan belum pernah di imunisasi dengan alasan
jika di imunisasi akan menimbulkan sakit dan cacat, ayah bayi tersebut menderita
TBC. saat petugas kesehatan datang kerumah sang ibu sangat cemas dengan

memegang erat bayinya dan mengatakan tidak ingin di imunisasi, Saat di berikan
pengarahan oleh petugas orangtua mau bayinya di imunisasi.
Apakah tindakan yang harus dilakukan petugas sebelum imunisasi dilakukan?
a.
Menyiapkan vaksin
b.
Memberikan vaksin
c.
Melakukan tes mantuk
d.
Memberikan penjelasan
e.
Memberikan pendidikan kesehatan
101. Seorang bayi perempuan berusia 3 bulan sudah waktunya datang ke posyandu
untuk di berikan imunisasi, namun orangtua bayi tidak datang ke posyandu, akhirnya
para kader mendatangi kediaman orangtua bayi tersebut. Saat dilakukan wawancara
dengan ibu, ibu mengatakan tidak tahu kalau anaknya harus di imunisasi lagi, status
imunisasi bayi telah mendapatkan imunisasi BCG, HB 0, POLIO 1, DPT/HB 1
Apakah Diagnosa keperawatan utama yang muncul pada kasus tersebut?
a.
Resiko tertular penyakit berhubungan dengan ketidaklengkapan status
imunisasi
b.
Kurang pengetahuan orangtua tentang jadwal imunisasi berhubungan
dengan kurang terpaparnya informasi
c.
Kurang pengetahuan orangtua tentang manfaat imunisasi berhubungan
dengan kurang terpaparnya informasi
d.
Cemas orangtua berhubungan dengan kurangnya pengetahuan orangtua
e.
Ketidaklengkapan status imunisasi berhubungan dengan kurang terpapar
dengan informasi

102. Seorang anak perempuan usia 10 tahun mengalami gangguan pernafasan, pada
saat diauskultasi terdapat suara ronchi di kedua paru dan mengalami retensi sekresi
dan gangguan oksigenasi yang memerlukan bantuan untuk mengencerkan atau
mengeluarkan sekresi.
Apakah Intervensi yang tepat dilakukan pada kasus tersebut?
a.
Suction
b.
Inhalasi
c.
Nebulasi
d.
Batuk efektif
e.
Fisioterapi dada
103. Seorang bayi usia 3 bulan dirawat di ruang rawat anak dengan diagnose medis
hirschprung diseases. Hasil pemeriksaan diperoleh distensi abdomen, suhu 37,3oC,
nadi 110 x/menit dan pernafasan : 42 x/menit. Pasien sering mengalami kesulitan
BAB, Dokter menyarankan pasien dioperasi, orang tua menolak karena faktor biaya.
Perawat dan Dokter menyerahkan keputusan tindakan pada anak kepada orang
tuanya.
Apakah bentuk aspek etik yang diperhatikan oleh perawat dan dokter dalam kasus
tersebut ?
a.
Justice
b.
Fidelity
c.
Beneficience
d.
Non Maleficience
e.
Respect for Autonomy
104. Seorang Anak Laki-laki berumur 16 tahun dengan diagnose medis Appendiksitis akut
perforasi. Pasien post appendiktomy cyto dirawat di ruang rawat anak. Hasil
pemeriksaan pasien bedrest, menolak berubah posisi, pasien mengeluh nyeri pada

105.

106.

107.

108.

area luka post operasi seperti ditusuk-tusuk. Tekanan Darah 130/90 mmHg, suhu
38oC, pernafasan 30x/menit dan nadi 116 x/menit.
Apakah intervensi utama yang akan anda lakukan untuk kasus tersebut?
a.
Melakukan kompres hangat
b.
Mengajarkan latihan mobilisasi post operasi
c.
Melakukan kolaborasi pemberian obat penurun panas (antipiretik)
d.
Melakukan pengelolaan manajemen nyeri non farmakologis dan
farmakologis
e.
Memberikan pendidikan kesehatan pentingnya nutrisi untuk
penyembuhan luka operasi
Seorang baayi perempuan berumur 4 bulan, dirawat di ruang rawat bedah anak
dengan diagnose atresia ani post colostomy 2 bulan yang lalu. Orang tua
mengatakan setelah pernah diajarkan perawatan luka operasi colostomy 2 bulan
yang lalu sebelum pulang. Hasil pemeriksaan, stoma terlihat kotor, kulit sekitar stoma
berwarna kemerahan, iritasi, timbul fistula, perawatan di rumah menggunakan
popok , suhu 37,6oC, RR 31 x/menit nadi 118 x/menit.
Apakah diagnosa keperawatan yang tepat berdasarkan kasus tersebut?
a.
Resiko infeksi berhubungan dengan kolostomi
b.
Nyeri berhubungan dengan adanya luka kolostomi
c.
Hipertermi berhubungan dengan infeksi local kolostomi
d.
Gangguan intergritas kulit berhubungan dengan perawatan kolostomi
e.
Deficit knowledge orang tua berhubungan dengan kurangnya paparan
informasi
Seorang Anak Laki-laki berumur 2 tahun masuk RS 3 hari yang lalu dengan keluhan
batuk disertai dahak, suhu 39oC, pernafasan 48 x/menit nadi : 120 x/menit,
terdengar ronchi basah, hasil rontgen terdapat area konsolidasi pada jaringan
bronchus kiri dan kanan, klien tampak rewel dan sulit untuk didekati.
Apakah prioritas masalah keperawatan yang tepat untuk kasus tersebut?
a.
Peningkatan suhu berhubungan dengan respon inflamasi
b.
Kecemasan anak berhubungan dengan dampak hospitalisasi
c.
Kekurangan volume cairan berhubungan dengan peningkatan suhu tubuh
d.
Tidak efektif bersihan jalan nafas berhubungan dengan akumulasi sekret
e.
Kurang pengetahuan orang tua berhubungan dengan kurangnya
informasi
Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke
RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya
mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta
anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus
terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi
128x/menit.
Apakah implementasi untuk mengatasi masalah prioritas kasus di atas?
a.
Pemasangan rectal tube
b.
Pemberian infus cairan N4
c.
Lakukan pemberian oksigen
d.
Pemberian nutrisi yang lunak
e.
Pemasangan naso gastric tube
Seorang bayi perempuan berumur 4 hari dibawa ke Instalasi gawat darurat oleh
ibunya dalam keadaan lemah, hasil pemeriksaan fisik BB 2092 gram dan BB lahir
2200 gram, bayi malas minum dan terlihat kuning pada wajah dan matanya, reflek
menghisap lemah, nadi : 138 x/menit, pernafasan 44 x/menit, suhu : 36,7oC, hasil
pemeriksaan laboratorium kadar bilirubin total 16 gr/dl.

Apakah intervensi yang dapat dilakukan untuk menurunkan kadar bilirubin


berdasarkan kasus tersebut?
a.
Pemberian Oksigen
b.
Pemeriksaan foto rontgen
c.
Pemberian terapi sinar UV
d.
Pemberian fototherapi bluelight
e.
Pemberian cairan dan elektrolit
109. Seorang anak perempuan berusia 3 tahun dibawa orang tuanya ke poliklinik anak.
Orang tua mengatakan anaknya batuk berdahak dan muntah saat diberi makan.
Hasil pengkajian didapatkan suhu 38C, Frekuensi pernapasan 30 x/menit, Nadi 90
x/menit, terdapat pernapasan cuping hidung dan suara nafas ronchi .
Apakah masalah keperawatan prioritas pada kasus diatas?
a.
Pola nafas tidak efektif
b.
Peningkatan suhu tubuh
c.
Gangguan pertukaran gas
d.
Perubahan kebutuhan nutrisi
e.
Bersihan jalan nafas tidak efektif
110. Seorang perawat anak yang sedang melakukan observasi di ruang perinatologi
mendengar salah satu bayi yang sedang menjalani fototerapi menangis tiba-tiba
dengan keras. Setelah di periksa popok bayi bersih dan kering, suhu tubuh bayi
normal dan bayi telah diberikan minum sejumlah 60 cc 2 jam yang lalu
Apakah tindakan yang tepat yang harus dilakukan perawat pada kasus di atas?

a.
b.
c.
d.
e.

Melakukan pemeriksaan fisik lengkap (head to toe)


Melakukan pemeriksaan kadar bilirubin
Membersihkan tali pusat
Memberikan minum
Memberikan selimut

111. Seorang bayi perempuan usia 6 bulan terlihat aktif dan sehat karena ibu bayi selalu
memperhatikan pertumbuhan dan perkembangan bayinya. Saat membawa kontrol
bayinya ke poliklinik anak, hasil pemeriksaan perawat didapatkan sebagai berikut :
BB meningkat 0,8 kg dari bulan lalu, panjang badan sesuai standard, anak aktif,
tetapi terdapat ruam kemerahan di bokong dan lipatan paha bayi
Bagaimana komunikasi yang tepat dilakukan oleh perawat kepada ibu tentang
kondisi bayinya tersebut?
A. Wah pertumbuhan bayi ibu sangat bagus ya, tapi kok pinggang dan
bokongnya jadi kemerahan begini?
B. Apakah ibu tidak pernah memperhatikan kebersihan bokong bayi
ibu?
C. Wah ibu sangat perhatian dengan kesehatan bayinya, tapi kayaknya
ibu salah pake pempers deh
D. Wah hebat ya bu, berat badan bayinya naik lagi, tetapi dibagian
pinggang dan bokongnya ini kenapa ya bu?

E. Ibu, jika menggunakan pempers harus diperhatikan kelembabannya.


Jangan pake pempers basah dalam waktu yang lama
112. Seorang anak usia 13 tahun masuk ruang perawatan karena muntah sebanyak 5 kali
dan harus mendapat terapi cairan 360 ml dalam waktu 4 jam.
Berapa teteskah yang harus diberikan dalam satu menit?
a.
22 tetes per menit
b.
24 tetes per menit
c.
26 tetes per menit
d.
28 tetes per menit
e.
30 tetes per menit
113. Satu keluarga kehilangan anaknya yang terseret banjir 6 bulan yang lalu. Ibu yang
kehilangan anak tersebut tidak mau makan, menangis setiap hari, merasa gagal
menyelamatkan anak dan tidak memperhatikan kebersihan diri
Apakah fase berduka yang dialami oleh ibu tersebut?
a.
Denial
b.
Anger
c.
Bargaining
d.
Depresi
e.
Acceptance
114. Seorang kepala ruangan rawat anak bertugas memimpin kegiatan diskusi kasus
setiap minggu diruang yang di pimpinnya. Dalam setiap diskusi, kepala ruangan
selalu memaksakan bahwa pendapat dia yang paling benar karena ia selalu merasa
memiliki pendidikan paling tinggi diantara perawat yang ada di ruangan dan tidak
mau menerima saran dari perawat lain.
Apakah penyebab konflik pada kasus diatas?
a.
Perbedaan nilai sikap dan kepercayaan
b.
Perbedaan kebutuhan dan kepribadian
c.
Perbedaan tanggungjawab
d.
Perbedaan persepsi
e.
Perbedaan status
115. Seorang anak berumur 2 tahun dibawa ke UGD karena paha kiri bengkak, rewel dan
menangis kesakitan. Orangtua kelihatan sangat cemas, mengatakan mereka
meninggalkan anak dengan pembantu rumah tangga selama 2 hari. Selain nyeri
tekan dipaha, pada pemeriksaan sinar X tampak retak pada tibia dextra.
Apakah jenis penganiayaan yang terjadi pada anak tersebut?
a.
Penganiayaan fisik
b.
Penganiayaan emosional
c.
Penelantaran fisik
d.
Pemukulan
e.
Kelalaian fisik
116. Seorang anak usia 12 tahun dirawat dengan keluhan lemah, lesu, pucat, tidak nafsu
makan, CRT >3 detik, dan cenderung ingin tidur. Ibu mengatakan bahwa anak
seperti ini sejak 1 minggu yang lalu
Apakah masalah keperawatan yang utama pada anak diatas?
a.
Mobilitas
b.
Kesadaran
c.
Nutrisi
d.
Sirkulasi
e.
Oksigenasi

117. Seorang anak usia 2 tahun dirawat dengan leukemia. Anak tampak pucat dan tidak
ada semangat. Hb 8mg/dl dan leukosit 3000.
Manakah hal utama dan oksigen yang harus perawat perlukan untuk anak ini?
a.
Membatasi pengunjung
b.
Menyiapkan ruangan khusus
c.
Menggunakan masker
d.
Menggunakan baraksot khusus

118. Anak usia 2 tahun, berat badan 7,8 kg, sesak, batuk dan pilek, T=38,5C, wajah
tampak kebiruan saat menangis, akral dingin, P= 135/menit, R= 50/menit. Hasil
pemeriksaan penunjang menunjukkan hipertropi ventrikel kanan dan defek pada
septum ventrikel. Ibu anak tersebut bertanya: Mengapa anak saya perlu dibatasi
aktifitasnya agar tidak sering menangis?
Apakah jawaban yang tepat untuk pertanyaan tersebut?
a.
Menurunkan ekspansi paru.
b.
Meningkatkan metabolisme basal.
c.
Menurunkan konsumsi oksigen.
d.
Meningkatkan kekuatan otot jantung.
e.
Memberikan emotional support.

119. Seorang anak berusia 6 tahun akan dilakukan operasi perbaikan katup jantung.
Kondisi sadar penuh terlihat ceria bersama pengasuhnya dan orangtuanya.
Manakah tindakan keperawatan yang harus dilakukan untuk persiapan adaptasi
stress sampai dengan rencana operasi anak tersebut?
a.
Jelaskan secara lengkap tentang proses operasi melalui gambar.
b.
Dorong anak untuk mengekspresikan perasaan kecemasannya pada
perawat.
c.
Hadirkan saudara kandung dan teman sebaya agar mereka saling
berinteraksi.
d.
Jelaskan hal-hal yang berkaitan dengan tindakan operasi melalui teknik
bermain.

120. Linda adalah seorang perawat dibangsal anak. Di ruangan ada seorang pasien umur
10 tahun dengan sakit DHF yang dikirim dari UGD.
Hal yang pertama kali yang seharusnya dilakukan perawat Linda adalah?
a.
Menentukan masalah klien
b.
Menganalisis data
c.
Mengevaluasi data
d.
Mendiagnosis klien
e.
Melakukan pengkajian keperawatan

121. Nurul datang ke RS untuk memeriksakan adiknya yang berumur 3 tahun. Nurul
memberi tahu perawat bahwa adiknya BAB cair 8x/hari sudah 3 hari, tidak mau
minum dan lemas. Dari pemeriksaan fisik S=38,5C, HR; 110x/menit.
Masalah keperawatan yang muncul adalah:

a.
b.
c.
d.
e.

Pola napas tidak efektif


Cemas
Diare
Kekurang volume cairan
Hipertermi

122. Seorang gadis berusia 14 tahun memiliki BMI 18. Gadis tersebut mengeluh tidak bisa
makan, mual, dan mengalami konstipasi.
Dari keterangan diatas diagnosa mana yang paling tepat?
a.
Multiple sclerosis
b.
Anorexia nervosa
c.
Bulimia
d.
Sclerosis sistemik
e.
Hipotensi

123. Pasien usia 5 tahun datang ke ER dengan keluhan sesak napas, batuk dan demam.
Posisi pasien yang paling tepat di tempat tidur adalah
a.
Posisi Sims
b.
Posisi Trendelenderg
c.
Posisi dorsal recumben
d.
Posisi pronasi
e.
Posisi fowler

124. Seorang anak berumur 9 tahun datang ke ER diantar orang tuanya dengan
gangguan demam 4 hari di rumah, mual, muntah, dan diare. Hasil lab platelet:
13.000, ada mimisan 2x dirumah
Diagnosa keperawatan yang paling tepat untuk kasus diatas adalah
a.
Resiko terjadinya perdarahan s/d trombositopenia
b.
Shock hypovolemik s/d perdarahan
c.
Hipertermi s/d proses infeksi virus dengue
d.
Kurangnya pengetahuan keluarga s/d kurangnya informasi
e.
Kekurangan volume cairan s/d muntah & diare

125. An. Iqbal mempunyai diagnosa keperawatan; bersihan jalan napas tidak efektif s/d
batuk yang tidak efektif.
Tujuan utama manakah yang paling tepat untuk diagnosa diatas?
a.
Individu tidak mengalami aspirasi
b.
Tidak ada spotum
c.
Eskpansi dada baik
d.
Nyeri berkurang
e.
BGA Normal

126. Seorang bayi telah lahir dengan cukup bulan, pervagina, ketuban jernih. Bayi
menangis spontan, tonus otot kuat dan bergerak aktif. Bayi dikeringkan dan tali pusat
telah dipotong.
Manakah tindakan yang tepat yang akan dilakukan selanjutnya?
a.
Letakkan bayi diatas perut ibu.
b.
Keringkan vermix bayi.
c.
Bedong bayi dengan gurita.
d.
Tempelkan mulut bayi di payudara ibu.
e.
Meletakkan bayi di dada ibu, biarkan bayi mencari payudara ibu.

127. Anak perempuan umur 1 tahun, dibawa oleh orangtuanya ke RS karena mengalami
pembesaran kepala sejak 1 bulan yang lalu, setelah di lakukan pemeriksaan fisik,
didapatkan hasil: lingkar kepala 59 cm, berat badan 6,5 kg, tinggi badan 67 cm,
terdapat sunset sign, belum bisa berjalan, aktifitas fisik hanya di tempat tidur atau
digendong oleh orangtuanya.
Apakah masalah keperawatan utama pada kasus diatas?
a.
Gangguan pertumbuhan dan perkembangan
b.
Gangguan nutrisi kurang dari kebutuhan
c.
Resiko tinggi gangguan integritas kulit
d.
Resiko gangguan cairan dan elektrolit
e.
Kurangnya pengetahuan orangtua
128. Seorang anak umur 2 tahun dibawa orang tuanya ke poli anak dengan keluhan BAB
4 kali dalam 1 hari, muntah 3 kali dalam satu hari, tidak ada napsu makan dan tidak
bisa tidur. Hasil pengkajian didapatkan suhu 38 c, turgor jelek, mukosa kering.
Apakah masalah keperawatan utama pada kasus tersebut?
a.
Gangguan cairan dan elektrolit
b.
Gangguan Nutrisi
c.
Gangguan rasan nyaman
d.
Gangguan istirahat
e.
Gangguan hospitalisasi

129. Seorang ibu sedang cemas melihat bayinya (8 bln) sesak dan nafas bunyi grokgrok. Setelah dilakukan pemeriksaan fisik didapatkan : Nadi 92 kali/mnt, Suhu
38.5C, Pernapasan 52 kali/mnt, tampak tarikan dinding dada kedalam dan
pernapasan cuping hidung.
Apakah tindakan kolaboratif yang utama pada bayi tersebut ?
a.
Lakukan physiotherapi dada
b.
Beri oksigen 2 ltr/mnt
c.
Posisikan bayi trendelenburg
d.
Posisikan bayi semi fowler
e.
Gunakan baju yang tipis dan longgar

130. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir
setelah dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung
88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan
usaha bernafas lambat/lemah.
Berapa nilai APGAR Score pada bayi tersebut ?
a.

b.

c.

d.

e.

131. An.M Umur 1 Tahun, Laki-laki dengan keluhan 8 jam sebelum masuk RS klien
mengalami panas tinggi di sertai kejang terjadi 1 kali dengan waktu 2 menit setelah
itu klien muntah dan batuk yang berulang dan di sertai penurunan kesadaran.
keluaraga memutuskan untuk membawa klien ke RSUD kota Bandung hasil TTV
suhu 38 c, Hasil lab leukosit 14200 mm3
Apakah diagnosa keperawatan yang utama pada anak tersebut ?
a.
Gangguan termogulasi
b.
Resiko gangguan nutrisi
c.
Gangguan personal hygiene
d.
Gangguan rasa aman
e.
Gangguan istirahat

132. An. D di rawat di RSU usia 1 tahun dengan diagnose keperawatan Ganguan
pemenuhan kebutuhan nutrisi kurang dari kebutuhan tubuh, dimana dari hasil
pemeriksaan fisik Konjungtiva anemis, klien muntah 3 kali, klien makan habis 3
sendok, HB 10,3 gr/dl, Ht 39%, BB sebelum sakit 8,5 kg, BB saat ini 7 kg, BB ideal
anak 1 tahun : 10 kg, nafsu makan klien menuru?
Tentukan intervensi apakah yang paling tepat?
a.
Memberikan pendekatan setiap akan melakukan prosedur
b.
Anjurkan klien untuk makan dalam porsi kecil tapi sering
c.
Observasi TTV
d.
Diskusikan dengan orang tua klien cara pencegahan penyakit Diare
e.
Diskusikan dengan klien tentang pola makan yang hegiene

133. Diminggu ke-2 bulan Februari 2014 Bayi N usia 6 bulan dibawa ke posyandu oleh
ibunya, bayi tersebut rencananya akan diberikan kapsul vitamin A, dari hasil
pemeriksaan fisik tidak ada kelainan pada bayi tersebut. Ada 2 jenis kapul Vitamin A
yang perlu diberikan.
Kapsul Vitamin A dengan warna apakah yang akan diberikan pada bayi N?
a.
Merah
b.
Kuning

c.
Hijau
d.
Biru
e.
Putih
134. Apakah yang anda anjurkan kepada ibu untuk pengobatan pertama yang paling tepat
pada anak tersebut?
a.
Berikan sayuran hangat
b.
Berikan ASI secukupnya
c.
Berikan kecap manis atau madu yang dicampur dengan jeruk nipis
d.
Berikan air tajin
e.
Berikan asupan nutrisi lebih banyak

135. Seorang ibu merasa cemas dikarenakan anaknya D berusia 3 bulan akan dioperasi
karena tidak bisa BAB selama 6 hari dan menurut dokter ada kelainan pada system
pencernaanya, datang seoarang perawat A memberikan penyuluhan dan penjelasan
tentang penyakit dan tindakan yang akan dilakukan.
Apakah tujuan yang diharapkan dari tindakan yang dilakukan oleh perawat A?
a.
Ibu anak D membatalkan tindakan operasi karena semakin cemas
b.
Ibu anak D merasa tidak cemas lagi, mengerti dengan penyakit dan
tindakan yang harus dilakukan serta menyerahkan segala kemungkinan
yang terjadi pada yang diatas
c.
Ibu anak D merasa ragu terhadap tindakan yang akan dilakukan akan
berhasil
d.
Ibu anak D tidak mengerti dengan penjelasan perawat A
e.
Ibu anak D merasa tidak mampu merawat dan menjaga anaknya

136. Perawat M dinas di poli orthopedi RSU, datang seorang ibu dengan anaknya D
berusia 5 bulan, perempuan, dari hasil pengkajian didapatkan ada kelainan pada
kaki anak D yaitu clubfoot menurut diagnose dokter orthopedi, telapak kaki anak D
sudah keras dan kaku, sebagai seorang perawat kita bisa mengkomunikasikan
kepada dokter untuk melakukan therapy pada anak D.
Therapy apakah yang kita komunikasikan kepada dokter orthopedi untuk penangan
awal pada anak D?
a.
Melakukan bedah orthopedi ringan pada kaki anak D
b.
Melakukan serangkaian therapy gips selama periode 3 s.d 6 minggu
c.
Menganjurkan penggunaan sepatu khusus
d.
Tidak melakukan therapy apapun karena anak D masih 5 bulan
e.
Menganjurkan kekeluarga untuk menjaga anak D agar jangan sampai
cidera
137. Perawatan yang dilakukan pada pasein anak seorang laki-laki berumur 5 tahun
dirawat dirumah sakit. Pada saat dilakukan anamnesa Ibunya mengatakan badan
anaknya bengkak sejak 4 bulan. Pada hasil pemeriksaan fisik didapat adanya
edema pada wajah,pada abdomen, dan pada ekstremitas bagian bawah, serta
tekanan darah 150/80 mmHg, nadi 87 x/menit, pernafasan 28 x/menit,suhu 37.8 o C.
Dari penuturan diatas pada hasil pemeriksaan ditemukan penyebabnya adalah
A.
Eksresi air dan Natrium
B.
Peningkatan Sekresi ADH dan Aldosteron
C.
Penurunan Tekanan osmotik koloid
D.
Peningkatan Permeabilitas membran glomerolus

E.

Hipoalbuminemia akibat proteiuria

138. Penanganan perawatan yang dilakukan pada seorang anak umur 3 tahun , dilakukan
perawatan di Puskesmas dengan diagnosa medis Faringitis sedangkan dari hasil
anamnesa Ibu mengatakan anaknya filek dan batuk tapi tidak disertai sesak
pernafasan. pada pemeriksaan fisik didapatkan frekwensi pernapasan 33x/menit
denyut nadi 90 x/menit temperatur 36,5 C. lalu direncanakan untuk dilakukan
fisioterapi dada yang di awali dari postural drainage,claping dan vibrating.
Pertama kali perawat sebelum melakukan postural drainage adalah?
a.
Mengauskultasi paru
b.
Menentukan posisi klien
c.
Minum air hangat
d.
Kolaborasi dalam pemberian obat ekspektoran
e.
Melakukan perkusi/klaping
139. Seorang bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk
melakukan imunisasi. Pada hasil pemeriksaan didapatkan yaitu berat badan 9 kg,
suhu tubuh 36,8C, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi
Polio 2, BCG, dan DPT I.
Dari kasus diatas Imunisasi apa yang sekarang harus diberikan?
A.
BCG dan Polio II
B.
DPT II dan Polio III
C.
DPT II dan Polio IV
D.
Hepatitis dan Polio III
E.
DPT III dan Polio IV
140. Seorang anak laki-laki usia 1 tahun, dibawa oleh orangtuanya ke Puskesmas karena
mengalami pembesaran kepala penuturan orang tuanya sejak usia 2 bulan yang lalu,
kemudian perawat melakukan pemeriksaan fisik, didapatkan hasil: lingkar kepala 59
cm, berat badan 7 kg, tinggi badan 62 cm, terdapat sunset sign, pada motorik kasar
anak belum bisa berjalan, anak sering digendong oleh orangtuanya.
hasil penanganan diatas apa yang menjadi masalah utama dalam keperawatan?
A. Gangguan pemenuhan kebutuhan nutrisi
B. Frekwensi nutrisi kurang dari kebutuhan
C. Gangguan pertumbuhan dan perkembangan
D. Resiko gangguan cairan dan elektrolit
E. Ketidak tahuan dalam penanganan penyakit
141. Seorang anak usia 2 tahun dia adalah anak pertama dan oleh Ibunya dibawa
kepuskesmas dengan keluhan anak belum bisa berjalan dari hasil pemeriksaan
didapat berat badan 7 kilo gram, tinggi 65 Cm dan anak hanya bisa merangkak
sewaktu di lakukan pemeriksaan oleh perawat
Dari hasil pemeriksaan anak mengalami keterlambatan ?
a.
Gangguan prilaku
b.
Gangguan social
c.
Gangguan motorik kasar
d.
Gangguan motorik halus
e.
Gangguan wicara
142. Seorang anak usia 4 tahun datang ke poli klinik dengan frekuensi nafas lebih dari
30x/ menit,iramanya kadang dangkal dan dalam,suara nafas ronchi basah, pada
faring terlihat sekret kental .
Apakah diagnose keperawatan yang tepat untuk kasus diatas ?

A.

143.

144.

145.

146.

Resiko gangguan perfusi jaringan berhubungan dengan


penurunan asupan oksigen dari luar.
B.
Tidak efektifnya bersihan jalan nafas berhububgan dengan
penumpukan sekret ditrakheobronchial.
C.
Gangguan pertukaran gas berhubungan dengan peningkatan
tekanan pembuluh kapiler paru.
D.
Tidak efektifnya pola nafas berhubungan dengan meningkatnya
volume darah balik dalam paru.
E.
Intoleransi aktivitas berhubungan dengan ketidakseimbangan
antara suplai dan kebutuhan oksigen.
Seorang anak usia 10 tahun, mengalami penambahan berat badan ,edema, wajah
sembab disekitar mata timbul saat pagi berkurang saat siang hari, asites,kesulitan
bernafas,pembengkakan scrotal.
Apakah intervensi keperawatan yang tepat untuk masalah kasus diatas ?
A.
Kaji masukan yang relative terhadap keluaran
B.
Atur masukan cairan dengan cermat
C.
Pantau infuse intra vena
D.
Pantau tanda vital
E.
Berikan perawatan kulit
Seorang anak usia 3 tahun , mengalami serangan kejang yang berulang, setelah
dilakukan pemeriksaan suhu rectal hasilnya 39,5 C.
Apakah tindakan awal dirumah pada anak yang mengalami kejang berulang tersebut
?
A.
Berikan diazepam intravena secara perlahan.
B.
Pembebasan jalan nafas dengan cara kepala dalam posisi
hyperekstensi miring, pakaian dilonggarkan dan penghisapan
lender.
C.
Segera pindahkan anak ketempat yang aman seperti lantai yang
diberi alas lunak tapi tipis dan jauhkan dari benda benda
berbahaya seperti gelas ,pisau.
D.
Pemberian oksigen untuk membantu kecukupan perfusi jaringan
E.
Pemberian kompres es untuk membantu menurunkan suhu
tubuh
Seorang anak usia 10 tahun, sesak nafas setelah berpaparan dengan bahan alergen
dan menetap beberapa saat. Repirasinya 36 kali / menit, kadang disertai batuk
sehingga terlihat pucat.
Apakah yang harus dihindari anak untuk mengurangi sesaknya ?
A.
Terapi inhalasi bronchodilator kombinasi dengan mukolitik.
B.
Mengurangi anak dari kelelahan yang berlebihan tetapi jangan
over proteksi.
C.
Jauhkan anak dari paparan alergen seperti debu, hawa dingin.
D.
Pemberian oksigen sesuai advis
E.
Pemberian antibiotik untuk mencegah penyakit sekunder.
Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak
dengan keluhan sejak 2 minggu terakhir bayi BAB 4 5 x/hari dengan keluaran sisa
makanan yang belum tercerna dengan baik. Ibu bekerja sebagai guru, memberikan
asi 1 x sebelum bekerja dan 3 4 kali sepulang bekerja. Sehari-hari bayi diurus oleh
neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk
peras 2 x/hari, susu buatan 3x/hari.
Apakah anjuran yang paling tepat saudara berikan pada ibu bayi?
A.
Pemberian bubur susu dihentikan

147.

148.

149.

150.

151.

B.
Pemberian sari jeruk peras dihentikan
C.
Pemberian susu buatan dihentikan
D.
Pemberian asi dilanjutkan dengan frekuensi ditambah
E.
Pemberian asi dihentikan karena tidak efektif
Anak A berumur 7 tahun masuk rumah sakit dengan marasmus. Ibu klien
mengatakan klien tidak mau makan,lemah,berat badan menurun hingga 60%,perut
cekung,kulit keriput,atropi otot,cengeng,apatis
Rencana keperawatan apa yang harus dilakukanpada kasus diatas ?
a.
Berikan makan setiap 2 jam
b.
Hangatkan anak dengan selimut
c.
Observasi tanda inflamasi
d.
Berikan penjelasan perlunya kebersihan mulut
e.
Berikan minum sebanyak mungkin
Seorang anak laki-laki berumur 1 bulan dengan diare dirawat di rumah sakit. Ibu
klien mengatakan klien buang air sudah 8x, muntah dan tidak mau minum ASI, mata
cekung, mukosa bibir kering,berat badan turun,apatis
Apakah rencana keperawatan utama pada kasus diatas?
a.
Berikan cairan oralit
b.
Teruskan pemberian ASI saja
c.
Berikan cairan RL dan oralit
d.
Berikan cairan Dekstros dan NaCl
e.
Berikan diet secara bervariasi
Seorang bayi berusia 6 tahunmasuk rumah sakit dengan hidrocephalus.Ibu klien
mengatakan anaknya sering muntah dan tidak nafsu makan,lemah,konjungtiva
anemis,berat badan turun,distensi vena supervisialis,kesadaran apatis
Apakah diagnosakeperawatan utama pada kasus diatas?
a.
Gangguan pemenuhan kebutuhan nutrisi kurang dari kebutuhan b/d
muntah
b.
Nyeri b/d peningkatan tekanan intrakranial
c.
Devisit volume cairan dan elektrolit kurang dari kebutuhan tubuh b/d
output cairan yang berlebihan
d.
Keterbatasan mobilitas fisik b/d peningkatan berat kepala
e.
Kurang pengetahuan b/d kurang informasi tentang penyakit
Seorang anak usia 2 tahun dengan hipospadia baru dilakukan tindakan operasi
rekonstruksi leher bleder. Operasi sudah dilakukan 6 hari yang lalu dan kondisi klien
semakin membaik, tanda-tanda vital stabil, dipasang kateter, drainage sudah
diangkat,urine sudah mulai jernih
Apakah rencanakeperawatanuntuk pemulangan klienpada kasus diatas?
a.
Ajarkan tehnik distraksi untuk mengurangi nyeri
b.
Ajarkan perawatan kateter
c.
Menganjurkan banyak minum
d.
Menyanjurkan untuk tidak banyak beraktivitas
e.
Menganjurkan selalu mengobservasi keluaran urine
Anak Y berusia 1 tahun masuk RS dengan diare. Ibu klien mengatakan klien BAB
sudah 6x/ hari sejak 4 hari yang lalu,berat badan klien sebelum sakit 11,5 kg dan
sesudah sakit 10 kg, mata cekung, mukosa bibir kering, turgor kulit> 3 dtk,apatis
Berapa jumlah kehilangan cairan dilihat dari berat badan pada kasus diatas?

a.
b.
c.

5%
10%
13%

152.

153.

154.

155.

156.

d.
14%
e.
15%
Seorang anak perempuan berusia 36 bulan datang ke puskesmas diantar oleh
ibunya, ibu mengeluh bahwa anaknya selalu rewel tidak mau pisah dari
gendongannya sejak adiknya yang baru lahir dibawa pulang dua hari yang lalu,
makan selalu habis, hasil pemeriksaan terkesan cari perhatian, berat badan 14 kilo
gram, tinggi badan 89 cm, hasil pemeriksaan fisik yang lain menunjukkan kondisi
normal.
Apakah masalah utama pada kasus tersebut ?
A.
Cemas
B.
Tidak nyaman
C.
Kurang perhatian
D.
Resiko gangguan sosialisasi
E.
Resiko gangguan pertumbuhan dan perkembangan.
Seorang anak laki-laki berusia 30 bulan datang ke Poli Anak dengan ibunya, ibu
mengeluh bahwa anaknya selalu rewel tidak mau pisah dari gendongannya sejak
adiknya yang baru lahir dibawa pulang tiga hari yang lalu, hasil pemeriksaan
terkesan cari perhatian, berat badan 13,5 kilo gram, tinggi badan 88,4 cm, hasil
pemeriksaan fisik yang lain menunjukkan kondisi normal.
Apakah intervensi utama untuk mengatasi permasalahan pada kasus tersebut ?
A.
Pantau perilaku sehari-hari
B.
Tanamkan kehidupan mandiri
C.
Ajarkan untuk makan sendiri
D.
Berikan mainan yang disukai dan ajak bermain
E.
Ajak dalam perawatan bayi dan berikan hadiah kecil
Seorang anak laki-laki usia 24 bulan dibawa ibunya ke puskesmas untuk
memeriksakan kesehatannya, ibu mengeluh bahwa anak tersebut suka mainan
faesesnya jika tidak ketahuan, hasil pemeriksaan berat badan 12 kilo gram, tinggi
badan 80 cm, lingkar kepala 38 cm, anak kooperatif tetapi pemalu.
Apakah pendidikan kesehatan utama kepada orang tua untuk mengatasi
permasalahan kasus tersebut?
A.
Bersosialisasi
B.
Kebersihan diri
C.
Toilet training
D.
Bermain cilokba
E.
Berbahasa sederhana
Seorang anak perempuhan usia 30 bulan dibawa ibunya ke Posyandu
memeriksakan kesehatan, ibu mengeluh bahwa anaknya suka membantah jika
disuruh makan atau yang lainnya, ibu anak teesebut menanyakan apakah anaknya
ada kelainan, hasil pemeriksaan berat badan 12 kilo gram, tinggi badan 87 cm,
lingkar kepala 38,5 cm, anak kooperatif ,memalingkan muka jika diajak bicara dan
mengatakan tidak mau.
Apakah pendidikan kesehatan yang tepat saat ini pada orang tua anak tersebut ?.
A.
Pertumbuhan anak usia todler
B.
Perkembangan usia todler
C.
Bersosialisasi usia todler
D.
Pengalihan perhatian
E.
Permainan
Seorang anak laki-laki usia 13 tahun, duduk di kelas VII, anak tersebut lari lima kali
keliling lapangan, sedang mendapatkan panism karena tidak mengerjakan pekerjaan
rumah yang ditugaskan oleh guru, anak tersebut berjanji tidak akan mengulang
kesalahan lagi.

157.

158.

159.

160.

Pada tahap perkembangan apa yang sedang terjadi sesuai data kasus tersebut ?
A.
Moral
B.
Kognitif
C.
Bahasa
D.
Psikososial
E.
Temperamen
Seorang bayi laki-laki lahir dengan BB 2 Kg, proporsi kepala Nampak lebih besar
daripada badan, kulit tipis transparan, lanugo banyak terutama pada dahi, pelipis,
telinga dan lengan, lemak kulit kurang, ekstremitas Nampak kebiruan, genitalia
teraba testis belum turun. Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60
x/menit, frekuensi nadi 100 x/menit, suhu 35,80C
Apakah diagnose keperawatan prioritas dari kasus diatas ?
a.
Gangguan keseimbangan suhu tubuh; hypotermi s.d proses adaptasi
dengan lingkungan luar rahim
b.
Resti kekurangan volume cairan dan elektrolit s.d efek dari inkubator
c.
Gangguan pola nafas s.d imaturitas organ pernafasan
d.
Inefektifitas jalan nafas s.d penumpukan sekret
e.
Infeksi s.d imaturitas imonoglobulin
Seorang anak usia 3 tahun sedang di rawat di RS. Anak nampak ketakutan, terus
menangis dan tidak mau ditinggal ibunya.
Apakah Intervensi keperawatan yang dapat diberikan untuk mengurangi dampak
hospitalisasi pada anak tersebut?
a.
Memaksimalkan manfaat hospitalisasi
b.
Meminimalkan sressor atau penyebab stres.
c.
Memberikan permainan sesuai dengan usianya
d.
Memberikan dukungan pada anggota keluarga lain
e.
Mempersiapkan anak untuk mendapat perawatan di RS
Seorang anak laki-laki berusia 6 tahun datang bersama ibunya ke RS dengan
keluhan sejak 2 minggu yang lalu badannya panas menggigil, keluhan disertai
pusing, mual, nafsu makan menurun. Pada pemeriksaan fisik diperoleh BB turun
hingga 20%, klien tampak pucat, mukosa bibir kering, nyeri ulu hati skala 4, kadang
disertai diare, muntah 4x/hr.Pada pemeriksaan tanda vital diperoleh Suhu= 380C.
TD= 90/60, frekuensi nadi = 104x/mnt. Hasil Pemeriksaan Diagnostik: Pemeriksaan
darah tepi (DDR) plasmodium fositif
Apakah Masalah keperawatan utama yang mungkin muncul?
a.
Gangguan perfusi jaringan otak
b.
Deficit cairan dan elektrolit
c.
Inefektif bersihan jalan nafas
d.
Ketidakseimbangan nutrisi
e.
Hipotermi
Seorang bayi berusia 3 hari datang ke RS dengan keluhan dari ibunya kuning. Pada
pemeriksaan fisik diperoleh BB 2 Kg, bayi tidak mau menetek, perut tampak buncit.
Pada pemeriksaan tanda-tanda vital diperoleh frekuensi nadi 120 x/menit, frekuensi
nafas 50 x/menit, suhu 370. Pada pemeriksaan laboratorium diperoleh kadar bilirubin
serum 13 mg%.
Apakah tindakan perawat yang harus dilakukan pada pasien diatas?
a.
Melakukan fototherapy
b.
Memberikan therapy cairan
c.
Mengobservasi tanda-tanda vital
d.
Memasukkan klien ke dalam inkubator
e.
Menjaga keseimbangan suhu tubuh klien

161. Seorang bayi usia 10 hari dibawa oleh ibunya ke RS dengan keluhan kejang-kejang
dan tidak dapat menetek. Pada hasil pemeriksaan ditemukan ada trismus pada otot
mulut, leher kaku, terjadi opistotonus, kadang terjadi kejang pada otot pernafasan,
bayi nampak sianosis. Pemeriksaan tanda-tanda vital diperoleh suhu 390C, frekuensi
pernafasan 65x/menit, frekuensi nadi 100 x/menit.
Apakah tindakan pertama yang harus dilakukan perawat untuk mengatasi gangguan
fungsi pernafasan pada bayi tersebut?
a.
Atur posisi bayi dengan kepala ekstensi
b.
Berikan oksigen 1-2 liter/menit
c.
Observasi tanda-tanda vital setiap setengah jam
d.
Bersihkan jalan nafas
e.
Pasangkan sudip lidah
162. By X dibawa ke klinik tumbuh kembang, usianya 8 bulan, ibu bayi mengatakan
bahwa bayinya belum bisa melakukan kegiatan-kegiatan hal nya bayi-bayi yang lain.
Apakah kegiatan-kegiatan yang dimaksud oleh ibu bayi X?
A.
Belajar mengatakan dua kata
B.
Merangkak meraih benda
C.
Menirukan suara
D.
berdiri sendiri
E.
mengikuti objek dengan mata
163. Setelah di kaji ternyata anak X mampu berbicara didepan umum, dan memahami
apa yang dijelaskan oleh orang dewasa.
Apakah jenis kecerdasan yang dialami oleh anak X?
A.
Verbal linguistic
B.
Logical mathematical
C.
Visual spatial
D.
Bodily kinestic
E.
Musical

164. an. X 6 bulan dibawa ibunya ke RS dengan keluhan sesak dan pucat, tidak mau
menyusu, dan diare. Menurut ibunya an. X rewel dan sering menangis tapi lemah,
hasil pemeriksaan fisik an. X mengalami splenomegali.
Apakah diagnosa medis yang dialami an. X ?
A.
Thalasemia mayor
B.
Thalasemia intermedia
C.
Thalasemia minor
D.
Thalasemia
E.
Leukemia
165. An. X 8 bulan dibawa ibunya ke RS untuk ditransfusi darah, menurut ibunya, an.x
sdh 2 bulan ini di transfuse darah. Program tranfusi darah yang regular ini diberikan
karena kadar HB yang cukup rendah.
Apakah Tujuan pemberian transfuse darah yang regular ?
A.
Mengganti eritrosit yang pecah
B.
Memelihara kadar Hb minimum 9,5-10,5 g/dl
C.
Meningkatkan kadar Hb sampai normal 12,5-13 g/dl
D.
Mengganti rantai beta pada hemoglobin
E.
Menambah sel darah merah yang kurang
166. An. X 13 tahun datang ke RS bersama ayahnya untuk dilakukan transfuse darah,
transfuse darah sudah dilakukan sejak berusia 8 bulan. hasil pemeriksaan fisik :
perut buncit, jantung berdebar, dan gambaran EKG aritmia.
Apakah penyebab Gangguan jantung pada kasus diatas ?

A.
Peningkatan erithropoisis
B.
Peningkatan kadar besi
C.
Stimulasi erithropoitin di bone marrow
D.
Kadar Hb yang cukup rendah
E.
Adanya virus di dalam darah transfuse
167. Hasil pemeriksaan radiologis pada anak thalasemia didapatkan : medulla yang lebar,
korteks yang tipis, trabekulla kasar, hemosiderosis pada kelenjar endokrin, hair-onend pada tulang kepala. Hasil pemeriksaan darah terdapat penurunan Hb yang
cukup besar. An. X mendapat terapi khelasi dengan disperal. Hasil wawancara
ternyata kakeknya mengalami penyakit yang sama.
Apakah Tujuan Terapi khelasi diberikan ?
A.
Untuk mengurangi infeksi di dalam darah
B.
Untuk mengurangi peningkatan zat besi
C.
Untuk meningkatkan produksi hemoglobin
D.
Untuk memperbaiki rantai globin yang rusak
E.
Untuk mengurangi pembesaran pada hati

168. An. 16 tahun, datang ke RS dengan keluhan menorraghia, dan sering mengalami
perdarahan di hidung dan gusi.selain itu jika terdapat laserasi maka selalu
mengalami perdarahan yang cukup lama, fatigue, dan mengeluh sulit untuk
konsentrasi, Terdapat melena. Hasil pemeriksaan fisik terdapat petechie di
ekstremitas, terdapat hematom di daerah mulut. Hati, limfa dan getah bening tidak
membesar. Hasil lab : trombosit 9.600 per l, terjadi leukositosis, Hb 12 mg/dl.
Masa perdarahan memanjang, masa pembekuan normal, retraksi bekuan
abnormal,prothrombin consumption time memendek. Tes Rumple-Leed positif.
apakah penyebab Adanya melena pada kasus diatas?
A.
Adanya petechie
B.
Leukositosis
C.
Trombosit 9600 per l
D.
Tes rumple- Lees positif
E.
Limfa dan hati membesar
169. An. X 5 tahun dibawa ke RS oleh ibunya karena edema. An. X mengeluh sakit
kepala dan terlihat gampang letih. Hasil pemeriksaan fisik Edema terlihat di daerah
periorbital, sacrum, skrotum dan abdomen. Pitting edema +,urine output sedikit.
hasil pemeriksaan laboratorium : terdapat protein di dalam urin . albumin 1,8 gr/dl,
kolesterol 265 mg/dl. Beberapa bulan terakhir ini an.x mengalami kenaikan BB cukup
besar.
Apakah penyebab Edema pada kasus ?
A.
Kolesterol 265 mg/dl
B.
Albumin 1,8 gr/dl
C.
Protein dalam urin
D.
Urin output yang sedikit
E.
Berat badan yang bertambah
170. An. X 5 tahun dibawa ke RS oleh ibunya karena edema. An. X mengeluh sakit
kepala dan terlihat gampang letih. Hasil pemeriksaan fisik Edema terlihat di daerah
periorbital, sacrum, skrotum dan abdomen. Pitting edema +,urine output sedikit.
hasil pemeriksaan laboratorium : terdapat protein di dalam urin . albumin 1,8 gr/dl,
kolesterol 265 mg/dl. Beberapa bulan terakhir ini an.x mengalami kenaikan BB cukup
besar.
apakah masalh keperawatan yang muncul pada kasus di atas?

171.

172.

173.

174.

A.
Kelebihan volume cairan (tubuh total)
B.
Peningkatan kebutuhan nutrisi
C.
Infeksi
D.
Intoleran aktivitas
E.
Resiko tinggi cedera
An.B memilikiriwayatpenyakitpadasaluranpernafasanwaktuberusia 5
tahun.Saatiniiaberusia 15 tahundanmengeluhbatukberdahak yang
tidakkunjungsembuhselama 7 hariminumobatbatuk.
Kondisilingkunganrumahsangatpadat,
danIbuklienmengatakansedikitnyaventilasicahaya yang masuk di rumahnya.
Pemeriksaandiagnostik yang dilakukanuntukAn.Btersebutadalah?
a.
Skin test
b.
Rontgen dada
c.
Tesuji tuberculin
d.
Pemeriksaandarah
e.
Pemeriksaan sputum
An.A laki-laki usia 4 th bersamadenganibunyadatangkerumahsakit.
Ibunyamengeluhkananaknya yang mengatakannyeritenggorokansejak 3 hari yang
lalu.Hasilpemeriksaanfisikdidapatkanadanyanyeripadapalpasiringan di leher,
tenggorokankemerahanagakbau, danadasedikitpembengkakanpadanoduslimph
submandibular.
Apakah tindakan keperawatan utama yang perlu dilakukan perawat?
a.
Kompreshangat
b.
Memantau tanda-tanda vital
c.
Menyarankanpasienistirahat
d.
Kolaborasipemberiananalgesik
e.
Membantu teknik hygiene padamulut
An.P perempuan 5 th mengalamilukabakarakibatrumahnyakebakaran. Luka
bakarpada area kepala, lengankanandankiri, serta area dada
danperut.Setelahdilakukanpengkajiandiadapatkanlukabakarderajat I
danklienmengeluhnyeri yang terutamapada area dada.
BerapakahpeersentaselukabakarpadaAn.Ptersebutadalah?
a.
35 %
b.
40 %
c.
45 %
d.
50 %
e.
55 %
An.J (10 th) mengalamilukabakarderajat III. Setelahmendapatperawatan di RS
selama 7 hari, kondisilukaklienbelummengalamiperbaikan, berwarnakehitaman di
semua area lukabakar.Belumadatanda-tandapemisahaneskaralami.
Apakahtindakankolaborasi yang harusdilakukanuntukAn.Jtersebut?
a.
Graft
b.
Wound care
c.
Debridemenbedah
d.
Debridemenmekanis
e.
Pemberianantibiotiktopikal

175. Ners C melakukan anamnesa pada Ny. B tanggal 19 Oktober 2002 di poliklinik
Tumbuh Kembang RS Mitra Ibu. Ny. B mengatakan bahwa anaknya belum bisa

berjalan sendiri saat ini. Anaknya lahir tanggal 27 Desember 1998 dengan usia
kehamilan 38 minggu.
Berapakah usia anak Ny. B saat dikaji Ners C pada kasus diatas?
A.
3 tahun 9 bulan 8 hari
B.
3 tahun 9 bulan 22 hari
C.
3 tahun 10 bulan 8 hari
D.
3 tahun 10 bulan 22 hari

176. An. L laki-laki usia 17 bulan berada di ruang Radiologi RS Mitra kasih untuk
dilakukan pemeriksaan rontgen. An. L menangis meronta-ronta dan berpegangan
erat pada ibunya. Menurut ibunya, An. L pertama kali dilakukan pemeriksaan ini.
Apakah yang harus dilakukan pada An.L pada kasus diatas ?
a.
Memberikan mainan kesukaannya
b.
Memberikan music atau film anak-anak
c.
Memberikan minuman dan makanan kesukaannya
d.
Mengatakan ibu akan menemani dan disampingmu
e.
Menjelaskan bahwa prosedur tindakan tidak akan menyakiti
177. Seorang ibu membawa Anaknya, An. O perempuan usia 15 bulan ke poliklinik
tumbuh kembang RS Mitra Ibu. An O tampak bermain sendiri dengan bonekanya dan
tidak menghiraukan pemeriksa.
Apakah stimulasi yang diberikan pada An. O diatas ?
a.
Bermain cilukba
b.
Puzzle sederhana
c.
Mennyusun kubus
d.
Memanggil dan tersenyum
e.
Bermain lempar-tangkap bola
178. Nn. V usia 16 tahun mengalami anemia sel sabit sejak usia 5 tahun. Hasil pengkajian
diperoleh bibir pucat, konjungtiva anemis, membrane mukosa mulut dan kulit pucat,
kapilari refill time 6 detik, dan clubbing finger
Apakah diagnosa keperawatan prioritas pada kasus diatas ?
a.
Gangguan pembentukan eritrosit berhubungan dengan anemia sel sabit
b.
Gangguan transportasi oksigen berhubungan dengan menurunnya
viskositas darah
c.
Risiko perdarahan berhubungan dengan menurunnya ikatan O2 dalam
hemoglobin
d.
Gangguan perfusi jaringan berhubungan dengan menurunnya ikatan O2
dalam hemoglobin
179. Ners Z sedang memberikan imunisasi campak pada By. H perempuan usia 12 bulan,
anak tersebut meronta-ronta, menangis dan menjerit dengan keras.
Apakah tindakan keperawatan pada kasus tersebut diatas?
a.
Terus melanjutkan penyuntikan imunisasi
b.
Meminta ibu dari anak tersebut untuk menyusui anaknya
c.
Meminta bantuan ibunya/perawat lain untuk mengambilkan benda
kesayangan anak
d.
Tersenyum pada anaknya, mengelus kepala dan menghentikan kegiatan
sementara
e.
Berhenti sejenak dan meminta bantuan ibunya untuk memegangi tangan
dan kaki anak tersebut
180. Bayi A perempuan usia 6 bulan mengalami Club foot dan akan dipasang cast.
Apakah yang harus diwaspadai dan dilaporkan segera oleh orang tua pada kasus
diatas?

A.
B.
C.
D.
E.

181.

182.

183.

184.

185.

Kapiler refill 6 detik di jari-jari kaki yang terkena.


Mati rasa jari-jari kaki yang terkena.
Kulit hangat di kaki distal yang terkena
terasa gatal dan panas di bawah cast
Edema di jari-jari kaki yang terkena dan membaik dengan
elevasi.
Seorang bayi baru lahir berjenis kelamin laki-laki, lahir secara spontan dengan
kondisi badan berwarna merah namun ekstremitasnya kebiruan dan fleksi. Bayi
tampak menyeringai. Pulse 86 kali/menit dan pernafasan tidak teratur
Apakah masalah yang terjadi pada bayi tersebut ?
a.
Asfiksia
b.
Tidak asfiksia
c.
Asfiksia berat
d.
Asfiksia sedang
e.
Asfiksia ringan
Seorang bayi baru lahir berjenis kelamin laki-laki, dilakukan pemeriksaan fisik oleh
perawat di ruang Perinatologi. Saat pemeriksaan reflex, perawat meletakkan jarinya
pada telapak tangan bayi
Apakah nama refleks yang dimaksud pada kasus di atas ?
a.
Moro
b.
Babinsky
c.
Tonic neck
d.
Crawling
e.
Palmar Graps
Anak perempuan, usia 9 tahun, BB 25 kg, TB 122 cm. Datang ke poliklinik anak
dengan keluhan perut kembung. Keluhan diawali sejak lahir BAB pertama pasien
terjadi 2 hari setelah lahir, BAB tiap 5 hari sekali, sedikit-sedikit, banyak gas yang ikut
keluar, BAB seperti pita, berwarna kuning. Hasil pemeriksaan fisik didapatkan
abdomen cembung, distensi abdomen (+), bising usus (+) terdengar lemah, frekuensi
nadi 92 x/menit, Frekuensi nafas 24 x/menit, TD 100/70 mmHg dan Suhu 36,8oc.
Apakah masalah keperawatan utama pada kasus diatas?
a.
Resiko infeksi
b.
Gangguan pola nafas
c.
Gangguan body image
d.
Gangguan pola eliminasi BAB : konstipasi
e.
Resiko gangguan pertumbuhan dan perkembangan
Anak laki-laki, usia 1 tahun, BB 12 kg, TB 82 cm. Datang ke poliklinik anak dengan
keluhan perut kembung. Keluhan diawali sejak lahir BAB pertama pasien terjadi 3
hari setelah lahir, BAB seminggu sekali, sedikit-sedikit, banyak gas yang ikut keluar,
BAB seperti pita, berwarna kuning. Hasil pemeriksaan fisik didapatkan abdomen
cembung, distensi abdomen (+), bising usus (+) terdengar lemah, frekuensi nadi 102
x/menit, Frekuensi nafas 28 x/menit, dan suhu 36,8oc.
Apakah tindakan keperawatan utama pada pasien tersebut ?
a.
Melakukan washout
b.
Memasang NGT dekompresi
c.
Kolaborasi pemberian laksatif
d.
Melakukan massage I Love You
e.
Menganjurkan pasien untuk banyak minum
Seorang bayi laki-laki, usia 1 hari, datang ke rumah sakit dengan keluhan langitlangit mulut yang terbuka. Pasien lahir di paraji, cukup bulan, BBL 2800 gram. Ibu
pasien mengatakan pasien tidak bisa menyusui dan sulit menelan. Hasil
pemeriksaan pasien tampak rewel, terus menangis, ubun-ubun teraba datar dan

186.

187.

188.

189.

lembut, mukosa mulut lembab, perut teraba lembut, bising usus (+). Frekuensi nadi
122 x/menit, frekuensi nafas 43 x/menit, suhu 36,80c.
Apakah intervensi keperawatan yang utama pada pasien tersebut ?
a.
Lakukan pemasangan infus
b.
Rawat bayi dalam inkubator
c.
Anjurkan ibu memberikan ASI sesuai permintaan bayi
d.
Tutupi kepala bayi dengan topi dan jaga suhu ruangan
e.
Pasang oral gastric tube untuk membantu pemberian ASI
Seorang anak perempuan, usia 1 tahun, datang ke poliklinik anak untuk
memeriksakan post operasi penutupan palatum satu bulan yang lalu. Sebelumnya
pada usia 6 bulan pasien telah mendapatkan operasi bibir sumbing. Pada saat
pemeriksaan BB 11 kg, frekuensi nadi 108 x/menit, frekuensi nafas 28 x/menit, suhu
36,80c.
Apakah data yang harus dikaji sebagai tindak lanjut dari program operasi pada
pasien tersebut ?
a.
Apa jenis makanan serta frekuansi makan anak
b.
Bagaimana perkembangan kemampuan bicara anak
c.
Apakah masih terdapat kesulitan menelan pada anak
d.
Bagaimana cara orang tua memberikan makan pada anak
e.
Apakah terdapat tanda-tanda infeksi pada luka post operasi
Anak perempuan, usia 5 tahun, BB 12 kg, TB 105 cm. Sejak lahir pasien tidak
mempunyai anus dan telah dilakukan operasi colostomy saat berusia 5 hari. BAB
lancar melalui colostomy tersebut. Pasien mengeluh perih pada daerah sekitar
stoma. Hasil pemeriksaan didapatkan abdomen datar, lembut, bising usus (+) 7
x/menit, di sekeliling stoma tampak kemerahan dan terdapat bintik-bintik merah,
frekuensi nadi : 100x/menit, frekuensi nafas : 24 x/menit, Suhu : 36,8oc.
Apakah diagnosa keperawatan yang utama pada pasien tersebut ?
a.
Nyeri
b.
Ansietas
c.
Risiko infeksi
d.
Kerusakan integritas kulit
e.
Gangguan pola eliminasi BAB
Anak perempuan, usia 5 tahun, datang ke poliklinik anak untuk melakukan kontrol
post operasi anoplasty. Orang tua pasien mengatakan anaknya sulit BAB dan
merasa bahwa anus anaknya mulai menyempit. Hasil pemeriksaan didapatkan
abdomen datar, lembut, bising usus (+) 8 x/menit, pada pemeriksaan rectal toucher
terasa adanya kontraksi dari spincter ani externa, `frekuensi nadi 100x/menit,
frekuensi nafas 24 x/menit, Suhu 36,5oc.
Apakah intervensi keperawatan utama pada pasien tersebut ?
a.
Lakukan prosedur washout
b.
Kolaborasi pemberian obat pencahar
c.
Anjurkan ibu pasien mengajari toilet training
d.
Ajarkan pada ibu pasien cara melakukan anal dilatasi
e.
Anjurkan ibu pasien untuk memberi pasien makanan tinggi serat
Anak perempuan, usia 7 tahun datang ke rumah sakit dengan keluhan bengkok pada
siku tangan kanan. Sejak 1 tahun yang lalu pasien terjatuh pada saat bermain dan
menurut orangtua siku pasien semakin hari menjadi semakin bengkok dan sulit
melakukan aktivitas. Pada pemeriksaan didapatkan hasil adanya angulasi ke lateral,
deformitas (+), Swelling (-), distal neurovascular (+), ROM pada ekstremitas atas
sinistra terbatas, frekuensi nadi 80 x/menit, frekuensi nafas 22 x/menit, suhu 36,7oc.
Apakah masalah keperawatan yang utama pada pasien tersebut ?
a.
Nyeri

b.
Ansietas orangtua
c.
Intoleransi aktifitas
d.
Hambatan mobilitas fisik
e.
Kerusakan integritas jaringan
190. Anak laki-laki, usia 14 tahun datang ke rumah sakit dengan keluhan keluar darah dari
hidung hidung setelah terkena lemparan bola basket temannya. Pasien mengeluh
pusing dan nyeri pada bagian hidung dengan skala nyeri subjektif 4 (0-10). Pada
pemeriksaan didapatkan adanya deformitas pada os nasal, terdapat perdarahan,
tekanan darah 120/80 mmHg, frekuensi nadi 86 x/menit, frekuensi nafas 25 x/menit,
suhu 36,8oc.
Apakah tindakan keperawatan yang utama pada pasien tersebut ?

a.
Memberikan kompres es
b.
Kolaborasi pemberian analgetik
c.
Mengatur posisi pasien semi fowler
d.
Memberikan cairan melalui intravena
e.
Menutup lubang hidung dengan kapas
191. Anak perempuan, usia 2 tahun. TB 85 cm, BB 13 kg. Datang ke poliklinik anak
dengan keluhan berjalan tertatih. Orangtua mengatakan pasien pernah terjatuh saat
berusia 9 bulan. Pada saat pemeriksaan didapatkan bagian ektremitas bawah
sinistra klien lebih pendek daripada dekstra. Pasien tampak kesulitan dan tertatih
saat berjalan. frekuensi nadi 115 x/menit, frekuensi nafas 28 x/menit, suhu 36,5oc.
Hasil pemeriksaan rontgen didapatkan adanya dislocation of hip.
Apakah masalah keperawatan yang utama pada pasien tersebut ?
a.
Nyeri
b.
Intoleransi aktifitas
c.
Hambatan mobilitas fisik
d.
Kerusakan integritas jaringan
e.
Risiko keterlambatan perkembangan
192. Bayi laki-laki, usia 1 bulan, lahir spontan, letak bokong. Sesaat setelah proses
kelahiran pasien didiagnosa dislocation of hip. Saat ini pasien dalam perawatan dan
terpasang gips. Orangtua pasien mengeluh pasien tampak rewel dan gelisah. Pada
saat dilakukan pemeriksaan didapatkan palpasi bagian distal yang terpasang gips
teraba dingin, tampak pucat, CRT 4 detik, frekuensi nadi 130 x/menit, frekuensi nafas
36 x/menit, suhu 37,2oc.
Apakah masalah keperawatan yang utama pada pasien tersebut ?
a.
Nyeri
b.
Hambatan mobilitas fisik
c.
Risiko kerusakan integritas kulit
d.
Risiko keterlambatan perkembangan
e.
Risiko disfungsi neurovascular perifer
193. Seorang anak laki-laki berusia 30 bulan, datang ke klinik tumbuh kembang, perawat
yang mengkaji melihat perkembangan motorik kasar menunjukkan dia sudah dapat
mengikuti perintah untuk berdiri dan jongkok, mulai dapat mengungkapkan
keinginannya pada orang lain, dan mulai tertarik untuk bermain bersama teman
sebayanya.
Hal apa terkait bimbingan antisipasi yang harus dijelaskan pada orangtua?
A.
Mengenalkan mainan baru untuk mengembangkan kemampuan
motorik dan sosial

B.

194.

195.

196.

197.

198.

Mendiskusikan untuk kebutuhan anak untuk dilibakan pada


setiap kegiatan
C.
Menyiapkan orangtua untuk mengantisipasi adanya perubahan
perilaku
D.
Mendiskusikan kesiapan fisik dan psikologis untuk toilet training
E.
Mempersiapkan kehadiran adik baru
Seorang bayi perempuan berusia 5 bulan, dibawa oleh ibunya ke klinik anak untuk
tujuan imunisasi, riwayat kelahirannya normal dengan BB lahir 3,2 Kg, PB 49 cm.
Sebelum diimunisasi, perawat melakukan pengkajian pada bayi tersebut.
Berapa berat badan minimal yang seharusnya dicapai pada usia tersebut ?
A.
5,7 Kg
B.
6,4 Kg
C.
7,2 Kg
D.
7,4 Kg
E.
8 Kg
Seorang anak laki-laki berusia 9 tahun, sudah mulai mampu berkompetisi dengan
orang lain dan belajar bagaimana cara meraih suatu prestasi.
Perkembangan psikososial apa yang ditunjukkan dengan kemampuan tersebut ?
A.
Percaya VS tdk percaya
B.
Industri VS inferiority
C.
Otonomi VS rasa ragu
D.
Inititive VS rasa bersalah
E.
Preoperasional
Seorang anak perempuan berusia 14 bulan 20 hari, datang ke klinik tumbuh
kembang, hari ini anak tersebut akan dievaluasi tumbuh kembangnya menggunakan
format Kuesioner Pra Screening Perkembangan (KPSP). Dari 10 pertanyaan, anak
tersebut mampu mengerjakan 7 pertanyaan dengan baik.
Berdasarkan interpretasinya, intervensi apa yang harus dilakukan pada anak
tersebut ?
A.
Terus memberikan stimulasi untuk anak usia 15 bulan
B.
Lakukan stimulasi intensif selama 2 minggu dan dites ulang
C.
Memberikan terapi perkembangan di bawah pengawasan
spesialis
D.
Lanjutkan mengikuti progrm posyandu
E.
Menganjurkan orang tua untuk mengikuti sekolah anak
berkebutuhan khusus
Seorang bayi perempuan dengan usia 10 bulan, dibawa ke klinik tumbuh kembang
oleh ibunya untuk berkonsultasi terkait perkembangan kemampuan motorik.
Stimulasi kinetik yang sesuai untuk bayi tersebut adalah ?
A.
Melambungkan badannya naik dan turun
B.
Menggunakan ayunan atau stroller
C.
Menyokong untuk duduk sendiri
D.
Memberikan mainan besar yang dapat didorong-dorong
E.
Menempatkan mainan diluar jangkauannya dan minta ia
mengambilnya.
Seorang bayi laki-laki umur 3 hari, lahir dengan berat badan 2200 gram, usia gestasi
34 minggu, pengkajian saat ini terdapat banyak lanugo terutama di punggung, posisi
testis satu masih dicanalis inguinalis, temperatur 35,50 C, APGAR score menit
pertama 6, dan terpasang NGT.
Termasuk kedalam kondisi apakah pasien tersebut?
a.
Prematur- tanpa asfiksia
b.
Prematur- asfiksia ringan

c.
d.
e.

Prematur- asfiksia sedang


Prematur- asfiksia berat
Prematur- asfiksia sangat berat

199. Seorang bayi, usia 4 hari dengan diagnosis palato schizis di rawat di ruang rawat
inap. Hasil pengkajian saat ini kesadaran compos mentis, tanda-tanda vital :
temperatur 36,6 0C denyut nadi 120x/m, frekuensi napas 40x/m, berat badan 2690
gr, terdapat celah dilangit-langit mulut, reflek rooting (+), reflek sucking (+), sesak (-).
Pasien direncanakan akan dilakukan pemasangan obturator (langit-langit mulut
buatan)
Apakah masalah keperawatan utama pada pasien tersebut?
A. Risiko nutrisi : kurang dari kebutuhan
B. Risiko tinggi terjadinya aspirasi
C. Risiko tinggi terjadinya infeksi
D. Cemas pada orangtua
E. Gangguan oksigenasi
200. An X usia laki-laki 8 tahun mengalami penganiayaan fisik, dilakukan pengkajian
dengan data terdapat luka pada kepala, dan lebam pada muka dada dan tangan,
ekspresi anak tampak ketakutan dan menangis dengan menutupi mukanya, badan
anak tampak kurus dan baju kotor tidak terawat, tetangga membawa anak ke RS dan
didapatkan data bahwa anak sering dipukul, tidak diberi makan dan ditelantarkan
oleh bapaknya.
Kondisi apakah yang terjadi pada anak berdasarkan kasus diatas
a.
Penganiayaan fisik
b.
Penelatara atau Neglect
c.
Emotional Abuse
d.
Physical Abuse
e.
Child abuse
201. An. X usia 13 bulan dengan diagnosa medis kejang demam, dilakukan pengkajian S
39,10C, extremitas teraba dingin dan tampak cyanosis, tidak terdapat sesak, ibu
anak mengatakan sudah melakukan pemberian kompres, anak baru pertama
mengalami kejang, kejang terjadi pada tangan dan wajah kurang lebih 10 menit,
anak sebelumnya mengalami batuk pilek, anak dan keluarga tidak mempunyai
riwayat epilepsi
Apakah implementasi yang dapat dilakukan pada anak berdasarkan kasus diatas
a.
Pemberian kompres ulang
b.
Memberikan oksigen
c.
Melakukan observasi TTV tiap 4 jam
d.
Melakukan pemasangan infus
e.
Melakukan kolaborasi pemberian antipiretik
202. By. X, BBL , dengan BB 1500 kg, badan klien masih terdapat vernik caseosa, RR
88x/menit, terdapat pernafasan cuping hidung dan retraksi dada O2 1 L/menit
terdengar ronchi dan wheezing pada lapang paru, klien mendapat therapy antibiotic
130 mg dan therapy atrovent 1 cc + bisolvon 1 cc + 1 cc NaCl
Apakah tindakan pertama yang dapat dilakukan pada bayi berdasarkan kasus diatas
a.
Melakukan mandi minyak
b.
Melakukan pemberian nebulezer
c.
Melakukan pemberian antibiotik
d.
Memasukan bayi ke dalam inkubator
e.
Melakukan pembedongan pada bayi

203. Seorang anak laki-laki berusia 5 tahun penderita TB paru mengalami kesulitan
bernafas, hasil pemeriksaan fisik pernafasan : 35 x/menit, auskultasi paru rocnhi di
kedua lobus paru.
Apakah prioritas tindakan yang harus dilakukan untuk mengatasi masalah tersebut ?
a.
Berikan hidrasi
b.
Lakukan suction
c.
Lakukan nebulasi
d.
Lakukan postural drainase
e.
Lakukan clapping, vibrasi, dan batuk efektif
204. Seorang bayi laki-laki usia 1 bulan dirawat di ruang anak mengalami diare, hasil
pemeriksaan fisik di dapatkan hasil BAB lebih dari 10 kali, konsistensi cair, suhu
tubuh : 38oC, bayi tampak lemas, ubun-ubun tampak cekung.
Apakah prioritas tindakan keperawatan yang harus dilakukan?
a.
Berikan diet lunak
b.
Berikan terapi cairan
c.
Berikan terapi analgetik
d.
Berikan terapi antibiotic
e.
Berikan terapi antipiretik
205. Seorang anak perempuan usia 10 tahun menderita gizi buruk di rawat di ruang anak
rumah sakit umum daerah. Hasil pemeriksaan fisik di dapatkan pernafasn : 30
x/menit, suhu : 38oC, ronchi positif di lobus kanan. Hasil pemeriksaan laboratorium
Hb : 10, hasil biakan sputum positif TB paru.
Apakah masalah keperawatan utama pada kasus di atas ?
a.
Pola nafas tidak efektif
b.
Peningkatan suhu tubuh
c.
Perfusi jaringan inefektif
d.
Bersihan jalan nafas tidak efektif
e.
Nutrisi kurang dari kebutuhan tubuh
206. Seorang bayi laki-laki usia 3 bulan belum pernah di imunisasi dengan alasan jika di
imunisasi akan menimbulkan sakit dan cacat, ayah bayi tersebut menderita TBC.
saat petugas kesehatan datang kerumah sang ibu sangat cemas dengan memegang
erat bayinya dan mengatakan tidak ingin di imunisasi, Saat di berikan pengarahan
oleh petugas orangtua mau bayinya di imunisasi.
Apakah tindakan yang harus dilakukan petugas sebelum imunisasi dilakukan?
a.
Menyiapkan vaksin
b.
Memberikan vaksin
c.
Melakukan tes mantuk
d.
Memberikan penjelasan
e.
Memberikan pendidikan kesehatan
207. Seorang bayi perempuan berusia 3 bulan sudah waktunya datang ke posyandu
untuk di berikan imunisasi, namun orangtua bayi tidak datang ke posyandu, akhirnya
para kader mendatangi kediaman orangtua bayi tersebut. Saat dilakukan wawancara
dengan ibu, ibu mengatakan tidak tahu kalau anaknya harus di imunisasi lagi, status
imunisasi bayi telah mendapatkan imunisasi BCG, HB 0, POLIO 1, DPT/HB 1
Apakah Diagnosa keperawatan utama yang muncul pada kasus tersebut?
a.
Resiko tertular penyakit berhubungan dengan ketidaklengkapan status
imunisasi
b.
Kurang pengetahuan orangtua tentang jadwal imunisasi berhubungan
dengan kurang terpaparnya informasi
c.
Kurang pengetahuan orangtua tentang manfaat imunisasi berhubungan
dengan kurang terpaparnya informasi
d.
Cemas orangtua berhubungan dengan kurangnya pengetahuan orangtua

e.

208.

209.

210.

211.

Ketidaklengkapan status imunisasi berhubungan dengan kurang terpapar


dengan informasi
Seorang anak perempuan usia 10 tahun mengalami gangguan pernafasan, pada
saat diauskultasi terdapat suara ronchi di kedua paru dan mengalami retensi sekresi
dan gangguan oksigenasi yang memerlukan bantuan untuk mengencerkan atau
mengeluarkan sekresi.
Apakah Intervensi yang tepat dilakukan pada kasus tersebut?
a.
Suction
b.
Inhalasi
c.
Nebulasi
d.
Batuk efektif
e.
Fisioterapi dada
Seorang bayi usia 3 bulan dirawat di ruang rawat anak dengan diagnose medis
hirschprung diseases. Hasil pemeriksaan diperoleh distensi abdomen, suhu 37,3oC,
nadi 110 x/menit dan pernafasan : 42 x/menit. Pasien sering mengalami kesulitan
BAB, Dokter menyarankan pasien dioperasi, orang tua menolak karena faktor biaya.
Perawat dan Dokter menyerahkan keputusan tindakan pada anak kepada orang
tuanya.
Apakah bentuk aspek etik yang diperhatikan oleh perawat dan dokter dalam kasus
tersebut ?
a.
Justice
b.
Fidelity
c.
Beneficience
d.
Non Maleficience
e.
Respect for Autonomy
Seorang Anak Laki-laki berumur 16 tahun dengan diagnose medis Appendiksitis akut
perforasi. Pasien post appendiktomy cyto dirawat di ruang rawat anak. Hasil
pemeriksaan pasien bedrest, menolak berubah posisi, pasien mengeluh nyeri pada
area luka post operasi seperti ditusuk-tusuk. Tekanan Darah 130/90 mmHg, suhu
38oC, pernafasan 30x/menit dan nadi 116 x/menit.
Apakah intervensi utama yang akan anda lakukan untuk kasus tersebut?
a.
Melakukan kompres hangat
b.
Mengajarkan latihan mobilisasi post operasi
c.
Melakukan kolaborasi pemberian obat penurun panas (antipiretik)
d.
Melakukan pengelolaan manajemen nyeri non farmakologis dan
farmakologis
e.
Memberikan pendidikan kesehatan pentingnya nutrisi untuk
penyembuhan luka operasi
Seorang baayi perempuan berumur 4 bulan, dirawat di ruang rawat bedah anak
dengan diagnose atresia ani post colostomy 2 bulan yang lalu. Orang tua
mengatakan setelah pernah diajarkan perawatan luka operasi colostomy 2 bulan
yang lalu sebelum pulang. Hasil pemeriksaan, stoma terlihat kotor, kulit sekitar stoma
berwarna kemerahan, iritasi, timbul fistula, perawatan di rumah menggunakan
popok , suhu 37,6oC, RR 31 x/menit nadi 118 x/menit.
Apakah diagnosa keperawatan yang tepat berdasarkan kasus tersebut?
a.
Resiko infeksi berhubungan dengan kolostomi
b.
Nyeri berhubungan dengan adanya luka kolostomi
c.
Hipertermi berhubungan dengan infeksi local kolostomi
d.
Gangguan intergritas kulit berhubungan dengan perawatan kolostomi
e.
Deficit knowledge orang tua berhubungan dengan kurangnya paparan
informasi

212. Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke
RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya
mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta
anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus
terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi
128x/menit.
Apakah implementasi untuk mengatasi masalah prioritas kasus di atas?
a.
Pemasangan rectal tube
b.
Pemberian infus cairan N4
c.
Lakukan pemberian oksigen
d.
Pemberian nutrisi yang lunak
e.
Pemasangan naso gastric tube
213. Seorang bayi perempuan berumur 4 hari dibawa ke Instalasi gawat darurat oleh
ibunya dalam keadaan lemah, hasil pemeriksaan fisik BB 2092 gram dan BB lahir
2200 gram, bayi malas minum dan terlihat kuning pada wajah dan matanya, reflek
menghisap lemah, nadi : 138 x/menit, pernafasan 44 x/menit, suhu : 36,7oC, hasil
pemeriksaan laboratorium kadar bilirubin total 16 gr/dl.
Apakah intervensi yang dapat dilakukan untuk menurunkan kadar bilirubin
berdasarkan kasus tersebut?
a.
Pemberian Oksigen
b.
Pemeriksaan foto rontgen
c.
Pemberian terapi sinar UV
d.
Pemberian fototherapi bluelight
e.
Pemberian cairan dan elektrolit

214. Perawat Y sedang berdiskusi dengan psikolog, terapis, dan dokter spesialis anak
dalam merawat An. B dengan autis untuk menentukan tindakan yang tepat pada
kliennya
Saat ini perawat Y sedang berperan sebagai
a.
Advocasi
b.
Pendidik
c.
Restorative role
d.
Kolaboratif
e.
Pengambil keputusan
215. An.A, usia 2 tahun dibawa orangtuanya ke poliklinik anak, dengan keluhan utama
sering BAB 3-4 x sehari, dengan konsistensi cair, dan ada darah berwarna merah
marun. Anak rewel, lesu, suhu tubuhnya 380 C, turgor kulit kembali lambat.
Apakah diagnosa medis yang paling tepat pada kasus diatas?
a.
Diare.
b.
Disentri.
c.
Demam berdarah.
d.
Influenza .
e.
Dehidrasi.
216. Bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk melakukan
imunisasi. Pada pemeriksaan didapatkan hasil yaitu berat badan 9 kg, suhu tubuh
36,8C, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi BCG, DPT
I dan Polio 2.
Apa imunisasi yang harus diberikan sekarang?
a.
DPT II Polio II
b.
DPT II Polio III

217.

218.

219.

220.

221.

c.
DPT II Polio IV
d.
DPT III Polio III
e.
DPT III Polio IV
Seorang anak laki-laki yang berusia 11 bulan dibawa oleh ibunya ke Poli Thalasemia
dengan keluhan mudah sakit, wajah yang pucat, sklera anemis. Hasil pemeriksaan
laboratorium Hb 5 gr/dl, diagnosa medis Thalasemia
Apakah implementasi utama yang dilakukan?
a.
Memberikan cairan infus
b.
Memberikan transfusi darah
c.
Memberikan nutrisi yang adekuat
d.
Memberikan informasi yang benar
e.
Memberikan Penyuluhan kesehatan tentang penyakit Thalasemia.
Bayi baru lahir akan mengeluarkan tinja pertamanya (mekonium) dalam 24 jam
pertama, namun pada bayi yang menderita penyakit Hisprung (akibat dari
kelumpuhan usus besar dalam menjalankan fungsinya), maka tinja tidak dapat
keluar, tinja akan keluar terlambat atau bahkan tidak dapat keluar sama sekali.
Selain itu perut bayi juga akan terlihat menggembung, disertai muntah. Jika dibiarkan
lebih lama, berat badan bayi tidak akan bertambah dan akan terjadi gangguan
pertumbuhan.
Apakah tindakan bedah sementara pada Bayi tesebut ?
a.
Kolostomi
b.
Colok dubur
c.
Atresia ani
d.
Operasi besar
e.
Laparatomi
Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak
dengan keluhan sejak 2 minggu terakhir bayi BAB 4 5 x/hari dengan keluaran sisa
makanan yang belum tercerna dengan baik. Ibu bekerja sebagai guru, memberikan
asi 1 x sebelum bekerja dan 3 4 kali sepulang bekerja. Sehari-hari bayi diurus oleh
neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk
peras 2 x/hari, susu buatan 3x/hari.
Apakah anjuran yang paling tepat saudara berikan pada ibu bayi?
a.
Pemberian bubur susu dihentikan
b.
Pemberian sari jeruk peras dihentikan
c.
Pemberian susu buatan dihentikan
d.
Pemberian asi dilanjutkan dengan frekuensi ditambah
e.
Pemberian asi dihentikan karena tidak efektif
Seorang anak umur 2 tahun dibawa orang tuanya ke poli anak dengan keluhan BAB
4 kali dalam 1 hari, muntah 3 kali dalam satu hari, tidak ada napsu makan dan tidak
bisa tidur. Hasil dari pengkajian didapatkan suhu 38 0 c, turgor jelek, mukosa kering
Apakah masalah keperawatan utama pada kasus tersebut?
a.
Gangguan cairan dan elektrolit
b.
Gangguan Nutrisi
c.
Gangguan rasan nyaman
d.
Gangguan istirahat
e.
Gangguan hospitalisasi
Seorang ibu membawa anaknya yang berusia 2 tahun periksa di UGD karena Diare
sudah 2 hari. Hari ini b.a.b cair sudah 5 kali. Hasil pemeriksaan didapatkan :
Anaknya tampak lemah, mata cekung, mukosa bibir kering, turgor kembali lambat,
dan agak rewel. Pada saat ditimbang BB ; 12 Kg.
Berapakah kebutuhan cairan Anak tersebut ?
a.
1100 cc

b.
1210 cc
c.
1232 cc
d.
1344 cc
e.
1050 cc
222. Seorang anak laki-laki berusia 24 bulan dirawat di rumah sakit dengan keluhan
sering rewel. Pada pemeriksaan fisik diketahui badan kurus dan perut buncit.
Pemeriksaan antopometri menunjukkan berat badan 7 kg dan panjang badan 75 cm.
Berapa kilogram penambahan berat anak tersebut agar mencapai berat ideal ?
a.
2,8 kg
b.
3 kg
c.
3,5 kg
d.
5 kg
e.
6,5 kg
223. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir
setelah dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung
88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan
usaha bernafas lambat/lemah.
Berapa nilai APGAR Score pada bayi tersebut ?
a.
4
b.
5
c.
6
d.
7
e.
8

Anda mungkin juga menyukai