Anda di halaman 1dari 18

LAPORAN KEGIATAN USAHA KESEHATAN MASYARAKAT

MINI PROJECT
DETEKSI KASUS KEMATIAN IBU DI KECAMATAN KABILA AKIBAT
HIPEREMESIS GRAVIDARUM
I.

PENDAHULUAN
1. LATAR BELAKANG
Kematian ibu menurut definisi WHO adalah kematian selama kehamilan atau

dalam periode 42 hari setelah berakhirnya kehamilan, akibat semua sebab yang terkait
dengan atau diperberat oleh kehamilan atau penangannya, tetapi bukan disebabkan oleh
kecelakaan/ cedera.
Berdasarkan Survei Demografi dan Kesehatan Indonesia (SDKI) tahun 2012,
angka kematian ibu di Indonesia masih tinggi sebesar 359 per 100.000 kelahiran hidup.
Angka ini sedikit menurun jika dibandingkan dengan SDKI tahun 1991, yaitu sebesar
390 per 100.000 kelahiran hidup. Angka ini sedikit menurun meskipun tidak terlalu
signifikan. Target global MDGs (Millenium Development Goals) ke-5 adalah
menurunkan Angka Kematian Ibu (AKI) menjadi 102 per 100.000 kelahiran hidup pada
tahun 2015. Mengacu dari kondisi saat ini, potensi untuk mencapai target MDGs ke-5
untuk menurunkan AKI adalah off track, artinya diperlukan kerja keras dan sungguhsungguh untuk mencapainya.
Pemerintah bersama masyarakat bertanggung jawab untuk menjamin bahwa
setiap ibu memiliki akses terhadap pelayanan kesehatan ibu yang berkualitas, mulai dari
saat hamil, pertolongan persalinan oleh tenaga kesehatan terlatih, dan perawatan pasca
persalinan bagi ibu dan bayi, perawatan khusus dan rujukan jika terjadi komplikasi, serta
akses terhadap keluarga berencana. Di samping itu, pentingnya melakukan intervensi
lebih ke hulu yakni kepada kelompok remaja dan dewasa muda dalam upaya percepatan
penurunan AKI.

Gambar 1. Angka Kematian Ibu (AKI) Tahun 1991 2012

Pada Gambar 1 dapat diketahui berdasarkan data SDKI, selama periode tahun
1991 2007 angka kematian ibu mengalami penurunan dari 390 menjadi 228 per
100.000 kelahiran hidup. Namun pada SDKI 2012 angka kematian ibu kembali naik
menjadi 359 per 100.000 kelahiran hidup. Meskipun AKI hasil SDKI tahun 1990 dan
2012 tidak jauh berbeda, namun untuk mencapai target 102 pada tahun 2015 diperkirakan
sulit tercapai. Angka tersebut juga semakin jauh dari target MDGs 2015 sebesar 102 per
100.000 kelahiran hidup.

Gambar 2. Penyebab Kematian Ibu Tahun 2010 2013

Berdasarkan Gambar 2 terlihat bahwa penyebab terbesar kematian ibu selama


tahun 2010 2013 masih tetap sama yaitu perdarahan. Sedangkan partus lama
merupakan penyumbang kematian ibu terendah. Sementaraitu, penyebab lain lain juga
berperan cukup besar dalam menyebabkan kematian ibu. Yang dimaksud dengan
penyebab lain lain adalah penyebab kematian ibu secara tidak langsung, seperti kondisi
penyakit kanker, ginjal, jantung, tuberkulosis atau penyakit lain yang diderita ibu.
Tingginya kematian ibu akibat penyebab lain lain menuntut peran besar rumah sakit
dalam menagani penyebab tersebut.
2. PernyataanMasalah
Peningkatankesehatanibu di Indonesia, yang merupakanTujuan Pembangunan
Milenium (MDG) kelima, berjalanlambatdalambeberapatahunterakhir.Rasiokematianibu,
yang diperkirakansekitar 228 per 100.000 kelahiranhidup, tetaptinggi di atas 200
selamadekadeterakhir,

meskipuntelahdilakukanupaya

upayauntukmeningkatkanpelayanankesehatanibu. Hal inibertentangandengan Negara


Negara miskin di sekitar Indonesia yang menunjukkanpeningkatanlebihbesarpada MDG
kelima.

Rendahnyakesadaranmasyarakattentangkesehatanibuhamilmenajdi
penentuangkakematian,

meskipunmasihbanyak

harusdiperhatikanuntukmenanganimasalahini.

factor

factor

yang

Persoalankematian

yang

terjadilantaraindikasi yang lazimmuncul.Yaknipendarahan, keracunankehamilan yang


disertaikejang

kejangaborsi,

jugacukuppenting.

daninfeksi.Namun,ternyatamasihadafaktor

Misalnya,

latarbelakangpendidikan,

pemberdayaanperempuan

sosialekonomikeluarga,

kebijakanjugaberpengaruh.

yang

lain

yang

takbegitubaik,

lingkunganmasyarakatdanpolitik,

Kaumlelaki

pun

dintuntutharusberupayaikutaktifdalamsegalapermasalahanbidangreproduksisecaralebihbe
rtanggungjawab.Selainmasalahmedis,
tingginyakematianibujugakarenamasalahketidaksetaraan
perekonomiansertarendahnyaperhatianlaki

gender,

nilaibudaya,

lakiterhadapibuhamildanmelahirkan.

Keadaankesehatanibusaathamiljugasering
misalnyasepertikeadaanmuntah-muntah
berlebihanataudikenaldenganhiperemesisgravidarum,

kali

disepelekan,
yang
seringkalimuntah-

muntahdianggaphal yang lazimdantidakdiberiperhatian.Hiperemesis gravidarum jarang


menyebabkan kematian, tetapi angka kejadiannya masih cukup tinggi. Hampir 25%
pasien hiperemesis gravidarum dirawat inap lebih dari sekali. Terkadang, kondisi
hiperemesis yang terjadi terus-menerus dan sulit sembuh membuat pasien depresi. Pada
kasus-kasus ekstrim, ibu hamil bahkan dapat merasa ingin melakukan terminasi
kehamilan.
3. Tujuan
Meningkatkan pengetahuan ibu hamil maupun petugas kesehatan terutama di
layanan primer pada ibu dengan hiperemesis gravidarum dengan gejala mual muntah
sehingga mengurangi angka kematian ibu.
4. Manfaat
Menurunkan angka kematian ibu akibat hiperemesis gravidarum sehingga secara
tidak langsung akan menurunkan angka kematian ibu khususnya provinsi Gorontalo dan
umumnya pada seluruh Indonesia.

II.

TINJAUAN PUSTAKA
Sekitar 50-90% perempuan hamil mengalami keluhan mual dan muntah. Keluhan

ini biasanya disertai dengan hipersalivasi, sakit kepala, perut kembung, dan rasa lemah
pada badan. Keluhan-keluhan ini secara umum dikenal sebagai morning sickness.
Istilah ini sebenarnya kurang tepat karena 80% perempuan hamil mengalami mual dan
muntah sepanjang hari.
Apabila mual dan muntah yang dialami mengganggu aktivitas sehari-hari atau
menimbulkan komplikasi, keadaan ini disebut hiperemesis gravidarum. Komplikasi yang
dapat terjadi adalah ketonuria, dehidrasi, hipokalemia dan penurunan berat badan lebih
dari 3 kg atau 5% berat badan.
Mual dan muntah pada kehamilan biasanya dimulai pada kehamilan minggu ke-9
sampai ke-10, memberat pada minggu ke-11 sampai ke-13 dan berakhir pada minggu ke12 sampai ke-14. Hanya pada 1-10% kehamilan gejala berlanjut melewati minggu ke-20
sampai ke-22. Pada 0,3-2% kehamilan terjadi hiperemesis gravidarum yang
menyebabkan ibu harus ditata laksana dengan rawat inap.
Beberapa faktor risiko yang berhubungan dengan hiperemesis gravidarum antara
lain hiperemesis gravidarum pada kehamilan sebelumnya, berat badan berlebih,
kehamilan multipel, penyakit trofoblastik, nuliparitas dan merokok.
II.1

Etiopatogenesis Emesis dan Hiperemesis Gravidarum


Etiologi dan patogenesis emesis dan hiperemesis gravidarum berkaitan erat

dengan etiologi dan patogenesis mual dan muntah pada kehamilan. Penyebab pasti mual
dan muntah yang dirasakan ibu hamil belum diketahui, tetapi terdapat beberapa teori
yang mengajukan keterlibatan faktor- faktor biologis, sosial dan psikologis. Faktor
biologis yang paling berperan adalah perubahan kadar hormon selama kehamilan.
Menurut teori terbaru, peningkatan kadar human chorionic gonadotropin (hCG) akan
menginduksi ovarium untuk memproduksi estrogen, yang dapat merangsang mual dan
muntah.Perempuan dengan kehamilan ganda atau mola hidatidosa yang diketahui
memiliki kadar hCG lebih tinggi daripada perempuan hamil lain mengalami keluhan
mual dan muntah yang lebih berat.Progesteron juga diduga menyebabkan mual dan
muntah dengan cara menghambat motilitas lambung dan irama kontraksi otot-otot polos
lambung.Penurunan kadar thyrotropin-stimulating hormone (TSH) pada awal kehamilan

juga berhubungan dengan hiperemesis gravidarum meskipun mekanismenya belum


jelas.Hiperemesis gravidarum merefleksikan perubahan hormonal yang lebih drastis
dibandingkan kehamilan biasa.
II.2

Langkah-Langkah Diagnosis

II.2.1 Menegakkan Diagnosis Kehamilan dan Hiperemesis Gravidarum


Penegakan diagnosis hiperemesis gravidarum dimulai dengan menegakkan
diagnosis kehamilan terlebih dahulu. Pada anamnesis dapat ditemukan keluhan
amenorea, serta mual dan muntah berat yang mengganggu aktivitas sehari- hari.
Pemeriksaan obstetrik dapat dilakukan untuk menemukan tanda-tanda kehamilan, yakni
uterus yang besarnya sesuai usia kehamilan dengan konsistensi lunak dan serviks yang
livid. Pemeriksaan penunjang kadar -hCG dalam urin pagi hari dapat membantu
menegakkan diagnosis kehamilan.

Tabel 1 menjelaskan hal-hal yang perlu diperhatikan untuk membedakan beberapa


kondisi mual dan muntah dalam kehamilan.
Keluhan muntah yang berat dan persisten tidak selalu menandakan hiperemesis
gravidarum. Penyebab-penyebab lain seperti penyakit gastrointestinal, pielonefritis dan
penyakit metabolik perlu dieksklusi.Satu indikator sederhana yang berguna adalah awitan

mual dan muntah pada hiperemesis gravidarum biasanya dimulai dalam delapan minggu
setelah hari pertama haid terakhir. Karena itu, awitan pada trimester kedua atau ketiga
menurunkan kemungkinan hiperemesis gravidarum. Demam, nyeri perut atau sakit
kepala juga bukan merupakan gejala khas hiperemesis gravidarum. Pemeriksaan
ultrasonografi perlu dilakukan untuk mendeteksi kehamilan ganda atau mola hidatidosa.
Diagnosis banding hiperemesis gravidarum antara lain ulkus peptikum, kolestasis
obstetrik, perlemakan hati akut, apendisitis akut, diare akut, hipertiroidisme dan infeksi
Helicobacter pylori. Ulkus peptikum pada ibu hamil biasanya adalah penyakit ulkus
peptikum kronik yang mengalami eksaserbasi sehingga dalam anamnesis dapat
ditemukan riwayat sebelumnya. Gejala khas ulkus peptikum adalah nyeri epigastrium
yang berkurang dengan makanan atau antasid dan memberat dengan alkohol, kopi atau
obat antiinflamasi nonsteroid (OAINS). Nyeri tekan epigastrium, hematemesis dan
melena dapat ditemukan pada ulkus peptikum
Pada kolestasis dapat ditemukan pruritus pada seluruh tubuh tanpa adanya ruam.
ikterus, warna urin gelap dan tinja berwarna pucat disertai peningkatan kadar enzim hati
dan bilirubin.Pada perlemakan hati akut ditemukan gejala kegagalan fungsi hati seperti
hipoglikemia, gangguan pembekuan darah, dan perubahan kesadaran sekunder akibat
ensefalopati hepatik.Keracunan parasetamol dan hepatitis virus akut juga dapat
menyebabkan gambaran klinis gagal hati.
Pasien dengan apendisitis akut biasanya mengalami demam dan nyeri perut kanan
bawah. Nyeri dapat berupa nyeri tekan maupun nyeri lepas dan lokasi nyeri dapat
berpindah ke atas sesuai usia kehamilan karena uterus yang semakin membesar.
Apendisitis akut pada kehamilan memiliki tanda-tanda yang khas, yaitu tanda Bryan
(timbul nyeri bila uterus digeser ke kanan) dan tanda Alder (apabila pasien berbaring
miring ke kiri, letak nyeri tidak berubah).
Meskipun jarang, penyakit Graves juga dapat menyebabkan hiperemesis. Oleh
karena itu, perlu dicari apakah terdapat peningkatan FT4 atau penurunan TSH. Kadar
FT4 dan TSH pada pasien hiperemesis gravidarum dapat sama dengan pasien penyakit
Graves, tetapi pasien hiperemesis tidak memiliki antibodi tiroid atau temuan klinis
penyakit Graves, seperti proptosis dan pembesaran kelenjar tiroid. Jika kadar FT4
meningkat tanpa didapatkan bukti penyakit Graves, pemeriksaan tersebut perlu diulang

pada usia gestasi yang lebih lanjut, yaitu sekitar 20 minggu usia gestasi, saat kadar FT4
dapat menjadi normal pada pasien tanpa hipertiroidisme.Pemberian propiltiourasil pada
pasien hipertiroidisme dapat meredakan gejala-gejala hipertiroidisme, tetapi tidak
meredakan mual dan muntah.
Sebuah studi lain yang menarik menemukan adanya hubungan antara infeksi
kronik Helicobacter pylori dengan terjadinya hiperemesis gravidarum. Pada studi
tersebut,

sebanyak

61,8%

perempuan

hamil

dengan

hiperemesis

gravidarum

menunjukkan hasil tes deteksi genom H. pylori yang positif,namun studi tersebut masih
kontroversial. Sebuah studi lain di Amerika Serikat mendapatkan tidak terdapat hubungan
antara hiperemesis gravidarum dengan infeksi H. pylori.
II.2.2 Deteksi Komplikasi Hiperemesis Gravidarum
Muntah yang terus-menerus disertai dengan kurang minum yang berkepanjangan
dapat menyebabkan dehidrasi. Jika terus berlanjut, pasien dapat mengalami syok.
Dehidrasi yang berkepanjangan juga menghambat tumbuh kembang janin.Oleh karena
itu, pada pemeriksaan fisik harus dicari apakah terdapat abnormalitas tanda-tanda vital,
seperti peningkatan frekuensi nadi (>100 kali per menit), penurunan tekanan darah,
kondisi subfebris, dan penurunan kesadaran. Selanjutnya dalam pemeriksaan fisis
lengkap dapat dicari tanda-tanda dehidrasi, kulit tampak pucat dan sianosis, serta
penurunan berat badan.
Selain dehidrasi, akibat lain muntah yang persisten adalah gangguan
keseimbangan elektrolit seperti penurunan kadar natrium, klor dan kalium, sehingga
terjadi keadaan alkalosis metabolik hipokloremik disertai hiponatremia dan hipokalemia.
Hiperemesis gravidarum yang berat juga dapat membuat pasien tidak dapat makan atau
minum sama sekali, sehingga cadangan karbohidrat dalam tubuh ibu akan habis terpakai
untuk pemenuhan kebutuhan energi jaringan. Akibatnya, lemak akan dioksidasi. Namun,
lemak tidak dapat dioksidasi dengan sempurna dan terjadi penumpukan asam asetonasetik, asam hidroksibutirik, dan aseton, sehingga menyebabkan ketosis. Salah satu
gejalanya adalah bau aseton (buah-buahan) pada napas.Pada pemeriksaan laboratorium
pasien dengan hiperemesis gravidarum dapat diperoleh peningkatan relatif hemoglobin
dan hematokrit, hiponatremia dan hipokalemia, badan keton dalam darah dan proteinuria.

Robekan pada selaput jaringan esofagus dan lambung dapat terjadi bila muntah
terlalu sering. Pada umumnya robekan yang terjadi kecil dan ringan, dan perdarahan yang
muncul dapat berhenti sendiri. Tindakan operatif atau transfusi darah biasanya tidak
diperlukan.
Perempuan hamil dengan hiperemesis gravidarum dan kenaikan berat badan
dalam kehamilan yang kurang (<7 kg) memiliki risiko yang lebih tinggi untuk melahirkan
bayi dengan berat badan lahir rendah, kecil untuk masa kehamilan, prematur, dan nilai
APGAR lima menit kurang dari tujuh.
II.2.3 Menentukan Derajat Hiperemesis Gravidarum
Hiperemesis gravidarum dapat diklasifikasikan secara klinis menjadi hiperemesis
gravidarum tingkat I, II dan III. Hiperemesis gravidarum tingkat I ditandai oleh muntah
yang terus-menerus disertai dengan penurunan nafsu makan dan minum. Terdapat
penurunan berat badan dan nyeri epigastrium. Pertama-tama isi muntahan adalah
makanan, kemudian lendir beserta sedikit cairan empedu, dan dapat keluar darah jika
keluhan muntah terus berlanjut. Frekuensi nadi meningkat sampai 100 kali per menit dan
tekanan darah sistolik menurun. Pada pemeriksaan fisis ditemukan mata cekung, lidah
kering, penurunan turgor kulit dan penurunan jumlah urin.
Pada hiperemesis gravidarum tingkat II, pasien memuntahkan semua yang
dimakan dan diminum, berat badan cepat menurun, dan ada rasa haus yang hebat.
Frekuensi nadi berada pada rentang 100-140 kali/menit dan tekanan darah sistolik kurang
dari 80 mmHg. Pasien terlihat apatis, pucat, lidah kotor, kadang ikterus, dan ditemukan
aseton serta bilirubin dalam urin.
Hiperemesis gravidarum tingkat III sangat jarang terjadi. Keadaan ini merupakan
kelanjutan dari hiperemesis gravidarum tingkat II yang ditandai dengan muntah yang
berkurang atau bahkan berhenti, tetapi kesadaran pasien menurun (delirium sampai
koma). Pasien dapat mengalami ikterus, sianosis, nistagmus, gangguan jantung dan dalam
urin ditemukan bilirubin dan protein.

II.3

Tata Laksana Emesis Gravidarum

II.3.1 Tata Laksana Awal

Tata laksana awal dan utama untuk mual dan muntah tanpa komplikasi adalah
istirahat dan menghindari makanan yang merangsang, seperti makanan pedas, makanan
berlemak, atau suplemen besi.Perubahan pola diet yang sederhana, yaitu mengkonsumsi
makanan dan minuman dalam porsi yang kecil namun sering cukup efektif untuk
mengatasi mual dan muntah derajat ringan.Jenis makanan yang direkomendasikan adalah
makanan ringan, kacang-kacangan, produk susu, kacang panjang, dan biskuit kering.
Minuman elektrolit dan suplemen nutrisi peroral disarankan sebagai tambahan untuk
memastikan terjaganya keseimbangan elektrolit dan pemenuhan kebutuhan kalori. Menu
makanan yang banyak mengandung protein juga memiliki efek positif karena bersifat
eupeptic dan efektif meredakan mual.Manajemen stres juga dapat berperan dalam
menurunkan gejala mual.
II.3.2 Tata Laksana Farmakologis
Pada emesis gravidarum, obat-obatan diberikan apabila perubahan pola makan
tidak mengurangi gejala, sedangkan pada hiperemesis gravidarum, obat-obatan diberikan
setelah rehidrasi dan kondisi hemodinamik stabil.Pemberian obat secara intravena
dipertimbangkan jika toleransi oral pasien buruk.Obat-obatan yang digunakan antara lain
adalah vitamin B6 (piridoksin), antihistamin dan agen-agen prokinetik. American
College of Obstetricians and Gynecologists (ACOG) merekomendasikan 10 mg
piridoksin ditambah 12,5 mg doxylamine per oral setiap 8 jam sebagai farmakoterapi lini
pertama yang aman dan efektif.Dalam sebuah randomized trial, kombinasi piridoksin dan
doxylamine terbukti menurunkan 70% mual dan muntah dalam kehamilan. Suplementasi
dengan tiamin dapat dilakukan untuk mencegah terjadinya komplikasi berat hiperemesis,
yaitu Wernickes encephalopathy. Komplikasi ini jarang terjadi, tetapi perlu diwaspadai
jika terdapat muntah berat yang disertai dengan gejala okular, seperti perdarahan retina
atau hambatan gerakan ekstraokular.
Antiemetik konvensional, seperti fenotiazin dan benzamin, telah terbukti efektif
dan aman bagi ibu. Antiemetik seperti proklorperazin, prometazin, klorpromazin
menyembuhkan mual dan muntah dengan cara menghambat postsynaptic mesolimbic
dopamine receptors melalui efek anti-kolinergik dan penekanan reticular activating
system.Obat-obatan tersebut dikontraindikasikan terhadap pasien dengan hipersensitivitas

terhadap golongan fenotiazin, penyakit kardiovaskuler berat, penurunan kesadaran berat,


depresi sistem saraf pusat, kejang yang tidak terkendali, dan glaukoma sudut tertutup.
Namun, hanya didapatkan sedikit informasi mengenai efek terapi antiemetik terhadap
janin.
Fenotiazin atau metoklopramid diberikan jika pengobatan dengan antihistamin
gagal. Prochlorperazine juga tersedia dalam sediaan tablet bukal dengan efek samping
sedasi yang lebih kecil. Dalam sebuah randomized trial, metoklopramid dan prometazin
intravena memiliki efektivitas yang sama untuk mengatasi hiperemesis, tetapi
metoklopramid memiliki efek samping mengantuk dan pusing yang lebih ringan.Studi
kohort telah menunjukkan bahwa penggunaan metoklopramid tidak berhubungan dengan
malformasi kongenital, berat badan lahir rendah, persalinan preterm, atau kematian perinatal.Namun, metoklopramid memiliki efek samping tardive dyskinesia, tergantung
durasi pengobatan dan total dosis kumulatifnya. Oleh karena itu, penggunaan selama
lebih dari 12 minggu harus dihindari.
Antagonis reseptor 5-hydroxytryptamine3 (5HT3) seperti ondansetron mulai
sering digunakan, tetapi informasi mengenai penggunaannya dalam kehamilan masih
terbatas. Seperti metoklopramid, ondansetron memiliki efektivitas yang sama dengan
prometazin, tetapi efek samping sedasi ondansetron lebih kecil.Ondansetron tidak
meningkatkan risiko malformasi mayor pada penggunaannya dalam trimester pertama
kehamilan.
Droperidol efektif untuk mual dan muntah dalam kehamilan, tetapi sekarang
jarang digunakan karena risiko pemanjangan interval QT dan torsades de pointes.
Pemeriksaan elektrokardiografi sebelum, selama dan tiga jam setelah pemberian
droperidol perlu dilakukan.Untuk kasus-kasus refrakter, metilprednisolon dapat menjadi
obat pilihan. Metilprednisolon lebih efektif daripada promethazine untuk penatalaksanaan
mual dan muntah dalam kehamilan, namun tidak didapatkan perbedaan dalam tingkat
perawatan rumah sakit pada pasien yang mendapat metil- prednisolon dengan plasebo.
Hanya sedikit bukti yang menyatakan kortikosteroid efektif.Dalam dua RCT kecil, tidak
didapatkan kegunaan metilprednisolon ataupun plasebo, tetapi kelompok steroid lebih
sedikit mengalami re-admission.Efek samping metilprednisolon sebagai sebuah
glukokortikoid juga patut diperhatikan. Dalam sebuah metaanalisis dari empat studi,

penggunaan glukokortikoid sebelum usia gestasi 10 minggu berhubungan dengan risiko


bibir sumbing dan tergantung dosis yang diberikan. Oleh karena itu, penggunaan
glukokortikoid direkomendasikan hanya pada usia gestasi lebih dari 10 mingguObat-obat
yang dapat digunakan untuk tatalaksana hiperemesis gravidarum dapat dilihat pada Tabel
2.

II.4

Tata Laksana Hiperemesis Gravidarum


Penatalaksanaan utama hiperemesis gravidarum adalah rehidrasi dan penghentian

makanan peroral. Pemberian antiemetik

dan vitamin

secara intravena

dapat

dipertimbangkan sebagai terapi tambahan. Penatalaksanaan farmakologi emesis


gravidarum dapat juga diterapkan pada kasus hiperemesis gravidarum.

II.4.1 Tata Laksana Awal


Pasien hiperemesis gravidarum harus dirawat inap di rumah sakit dan dilakukan
rehidrasi dengan cairan natrium klorida atau ringer laktat, penghentian pemberian
makanan per oral selama 24-48 jam, serta pemberian antiemetik jika dibutuhkan.
Penambahan glukosa, multivitamin, magnesium, pyridoxine, atau tiamin perlu
dipertimbangkan.Cairan dekstrosa dapat menghentikan pemecahan lemak.Untuk pasien
dengan defisiensi vitamin, tiamin 100 mg diberikan sebelum pemberian cairan dekstrosa.
Penatalaksanaan di- lanjutkan sampai pasien dapat mentoleransi cairan per oral dan
didapatkan perbaikan hasil laboratorium.
II.4.2 Pengaturan Diet
Untuk pasien hiperemesis gravidarum tingkat III, diberikan diet hiperemesis I.
Makanan yang diberikan berupa roti kering dan buah-buahan. Cairan tidak diberikan
bersama makanan tetapi 1-2 jam setelah makan. Diet hiperemesis kurang mengandung
zat gizi, kecuali vitamin C, sehingga diberikan hanya selama beberapa hari.
Jika rasa mual dan muntah berkurang, pasien diberikan diet hiperemesis II.
Pemberian dilakukan secara bertahap untuk makanan yang bernilai gizi tinggi. Minuman
tidak diberikan bersama makanan. Diet hiperemesis II rendah dalam semua zat gizi,
kecuali vitamin A dan D.
Diet hiperemesis III diberikan kepada penderita dengan hiperemesis ringan.
Pemberian minuman dapat diberikan bersama makanan. Diet ini cukup dalam semua zat
gizi, kecuali kalsium.
II.4.3 Terapi Alternatif
Terapi alternatif seperti akupunktur dan jahe telah diteliti untuk penatalaksanaan
mual dan muntah dalam kehamilan. Akar jahe (Zingiber officinale Roscoe) adalah salah
satu pilihan nonfarmakologik dengan efek yang cukup baik. Bahan aktifnya, gingerol,
dapat menghambat pertumbuhan seluruh galur H. pylori, terutama galur Cytotoxin
associated gene (Cag) A+ yang sering menyebabkan infeksi. Empat random- ized trials
menunjukkan bahwa ekstrak jahe lebih efektif daripada plasebo dan efektivitasnya sama

dengan vitamin B6. Efek samping berupa refluks gastroesofageal dilaporkan pada
beberapa penelitian, tetapi tidak ditemukan efek samping signifikan terhadap keluaran
kehamilan.Dosisnya adalah 250 mg kapsul akar jahe bubuk per oral, empat kali sehari.
Terapi akupunktur untuk meredakan gejala mual dan muntah masih menjadi
kontroversi. Penggunaan acupressure pada titik akupuntur Neiguan P6 di pergelangan
lengan menunjukkan hasil yang tidak konsisten dan penelitiannya masih terbatas karena
kurangnya uji yang tersamar. Dalam sebuah studi yang besar didapatkan tidak terdapat
efek yang menguntungkan dari penggunaan acupressure,namun The Systematic
Cochrane Review mendukung penggunaan stimulasi akupunktur P6 pada pasien tanpa
profilaksis antiemetik. Stimulasi ini dapat mengurangi risiko mual.Terapi stimulasi saraf
tingkat rendah pada aspek volar pergelangan tangan juga dapat menurunkan mual dan
muntah serta merangsang kenaikan berat badan.
II.5

Penatalaksanaan pada Kasus Refrakter


Jika muntah terus berlangsung (persisten) pada tata laksana yang maksimal, kita

harus kembali ke proses diagno sis dan mencari adanya penyebab lain seperti
gastroenteritis, kolesistitis, pankreatitis, hepatitis, ulkus peptikum, pielonefritis dan
perlemakan hati.
Nutrisi enteral harus dipikirkan jika terdapat muntah yang berkepanjangan, namun
harus diingat bahwa total parenteral nutrition (TPN) selama kehamilan meningkatkan
risiko sep- sis dan steatohepatitis, terutama akibat penggunaan emulsi lipid. Oleh karena
itu, TPN sebaiknya hanya diberikan pada pasien dengan penurunan berat badan
signifikan (>5% berat badan) yang tidak respon dengan antiemetik dan tidak dapat
ditatalaksana dengan nutrisi enteral.

II.6

Evaluasi Keberhasilan Terapi


Tujuan terapi emesis atau hiperemesis gravidarum adalah untuk mencegah

komplikasi seperti ketonuria, dehidrasi, hipokalemia dan penurunan berat badan lebih
dari 3 kg atau 5% berat badan.Jika sudah terjadi komplikasi, perlu dilakukan tata laksana
terhadap komplikasi tersebut.

Penilaian keberhasilan terapi dilakukan secara klinis dan laboratoris. Secara


klinis, keberhasilan terapi dapat dinilai dari penurunan frekuensi mual dan muntah,
frekuensi dan intensitas mual, serta perbaikan tanda-tanda vital dan dehidrasi. Parameter
laboratorium yang perlu dinilai adalah perbaikan keseimbangan asam-basa dan elektrolit.
II.7

Penutup
Diagnosis dan penatalaksanaan mual dan muntah dalam kehamilan yang tepat

dapat mencegah komplikasi hiperemesis gravidarum yang membahayakan ibu dan janin.
Ketepatan diagnosis sangat penting, karena terdapat sejumlah kondisi lain yang dapat
menyebabkan mual dan muntah dalam kehamilan. Tata laksana komprehensif dimulai
dari istirahat, modifikasi diet dan menjaga asupan cairan. Jika terjadi komplikasi
hiperemesis gravidarum, penatalaksanaan utama adalah pemberian rehidrasi dan
perbaikan elektrolit. Terapi farmakologi dapat diberikan jika dibutuhkan, seperti
piridoksin, doxylamine, prometazin, dan metoklopramin dengan memperhatikan
kontraindikasi dan efek sampingnya. Beberapa terapi alternatif sudah mulai diteliti untuk
penatalaksanaan hiperemesis gravidarum, seperti ekstrak jahe dan akupuntur, dengan
hasil yang bervariasi.
III.

Metode
Langkah-langkah yang dapat dilakukan untuk mencegah terjadinya kematian

ibukarenahiperemesisgravidarumdiantarnayaadalahdenganmemberikanpenyuluhankepada
ibu-ibubaik

yang

sedanghamilatau

yang

sedangberencanamempunyaianakmengenaikeadaanhiperemesisgravidarum, sertabahaya
bahaya

yang

dapat

ibuhamilmaupun

di

yang

muntahberlebihan

timbulkansecaralangsungmaupuntidaklangsung.

Ibu

berencanahamilharusmengetahuikapansaatnyamuntah
yang

dialamimemerlukantindakansegera.

Selainitupetugaskesehatanjugaharusjelidalammenggaliinformasisejakkapanterjadinyamun
tah

muntah

yang

berlebihansehinggadapatsegeramengambiltindakan

diperlukanuntukmencegahdehidrasidansyokakibatdehidrasi.

Oleh

karena

itu,

yang
pada

pemeriksaan fisik harus dicari apakah terdapat abnormalitas tanda-tanda vital, seperti
peningkatan frekuensi nadi (>100 kali per menit), penurunan tekanan darah, kondisi

subfebris, dan penurunan kesadaran. Hiperemesis gravidarum yang berat juga dapat
membuat pasien tidak dapat makan atau minum sama sekali, sehingga cadangan
karbohidrat dalam tubuh ibu akan habis terpakai untuk pemenuhan kebutuhan energi
jaringan,

petugaskesehatan

di

tingkatpertamadalamhalinipuskesmasjugaharusjelimemperhatikankapansaatdimanaibu
ibuhamilharussegeradirujukkarenakeadaanhiperemsisgravidarumnyasehinggatidakmemba
hayakanibudancalonbayinya.
Pemantauanpascapenatalaksanaanterhadapibuhamildengankeadaanhiperemisgravidarumj
ugaharusdilaksanakandenganseksama,

edukasi

yang

baikakankapanibuharuskembalimemeriksakankehamilandankeadaansakitnyaharusdijelask
andenganjelassehinggamencegahhal hal yang tidakdiinginkan.
IV.

Kesimpulan & Saran


Pengetahuan

ibuhamil,

sedangmerencanakankehamilandengan

pasangan
pengetahuan

yang
dan

sudahmenikah
awareness

dari

yang
petugas

kesehatan dapat bersinergi untuk mencegah kematian ibuyang disebabkan oleh


hiperemisgravidarum. Petugas kesehatan juga dapat memberikan edukasi yang baik,
sehinggaibuhamildanpasangan yang sudahmenikah yang sedangmerencanakankehamilan
mengerti

apa

saja

gejaladantandasertabahaya

yang

dapatditimbulkandarikeadaanhiperemesisgravidarumsehinggadapatmendorongkaumibuha
miluntuklebihmemberikanperhatianlebihterhadapkeadaankehamilannyadanmendorongibu
hamiluntukrajinmelakukanpemeriksaanantenatal

care

untukmemantaukeadaankesehatanibudanbayi yang sedangdikandung. Petugas kesehatan


juga

harus

aware

terhdapkapankeadaanhiperemesisgravidarummemerlukanrawatindapdanpenangananinten
sifdanmemberikanpenjelasanlebihlanjutkepadaibukapanselanjutnyaibuharusmemeriksaka
nkeadaankehamilannyakembali.

Gorontalo, 25 Januari 2016


PESERTA

dr. Yislam aljaidi

PENDAMPING

dr. Nurhayati Ayuba


NIP1973122419993031003