Anda di halaman 1dari 45

MAKALAH

DASAR-DASAR PROMOSI KESEHATAN


Dosen Pengampu: Suryati, S.Pd, M.Kes, Kons

Oleh :

Kelompok 1
Nasmia Martha Lenny (1511212007)
Rahmania Adrianus (1511212010)
Kevin Oktra Gilang (1511212012)
Rafida Meilisa (1511212037)
Nindi Elfiza (1511212049)
Haptiah (1511212058)
Rufaida Farhanni Nazira (1511212066)
Hayatul Hasnah (1511212071)
Ameliya Bugesti (1511212074)

PROGRAM STUDI ILMU KESEHATAN MASYARAKAT


FAKULTAS KESEHATAN MASYARAKAT
UNIVERSITAS ANDALAS
2016

BAB II
PEMBAHASAN
1

Deklarasi Alma Ata Tahun 1978


Deklarasi Alma Ata tahun 1978 merupakan bentuk kesepakatan bersama

antara 140 negara (termasuk Indonesia), adalah merupakan hasil Konferensi


Internasional Pelayanan Kesehatan Primer (Primary Health Care) di Kota Alma
Ata, Kazakhstan (sebelumnya merupakan bagian Uni Soviet). Konferensi
Internasional Primary Health Care ini disponsori oleh organisasi kesehatan
dunia (WHO) dan organisasi PBB untuk anak (UNICEF). Isi pokok dari deklarasi
ini bahwa Pelayanan Kesehatan Primer (Dasar) adalah merupakan strategi utama
untuk pencapaian kesehatan untuk semua (Health for All) sebagai bentuk
perwujudan HAM.
Deklarasai Alma Ata ini selan jutnya terkenal dengan kesehatan semua
untuk tahun 2000 atau Health for All by The Year 2000. Bentuk operasional
dalam mencapai kesehatan untuk semua (kesuma) tahun 2000 di Indonesia adalah
PKMD (Pembangunan Kesehatan Masyarakat Desa). Meskipun sebenarnya di
Indonesia cikal bakal atau embrio PKMD sudah berkembanga sejak tahun
1970an di Solo dan Banjarnegara yang di prakarsai oleh Yakkum dalm bentuk
dana sehat, pos obat desa, dan sebagainya.
Deklarasi Alma Ata juga menyebutkan bahwa untuk mencapai kesehatan
untuk semua tahun 2000 adalah melalui pelayanan kesehatan dasar yang
sekurang-kurangnya mencakup 8 pelayanan dasar, yakni :
1

Pendidikan kesehatan (health education)

Peningkatan penyediaan makanan dan gizi (promotion of food supplies


and proper nutrition)

Penyediaan air bersih yang cukup dan sanitasi dasar (adequate supply of
safe water and basic sanitation)

Pelayanan kesehatan ibu dan anak termasuk keluarga berencana (Maternal


and child care, including family planning)

Imunisasi (Immunization against the major infectious diseases)

Pencegahan dan pemberantasan penyakit endemic (preventation and


control of locally endemic diseases)

Pengobatan penyakit umum (Appropriate treatment of common diseases


and injuries)

Penyediaan obat esensial (provision essential drugs)


Dari 8 pelayanan kesehatan dasar tersebut diatas, pendidikan kesehatan

(sekarang promosi kesehatan) di tempatkan pada urutan pertama. Ini berarti


bahwa sejak konferensi Alma Ata tahun 1978, para delegasi 140 negara tersebut
telah mengakui betapa pentingnya peran promosi kesehatan dalam mencapai
kesehatan untuk semua. Oleh sebab itu, dalam Konferensi Internasional Promosi
Kesehatan yang pertama di Ottawa, yang menghasilkan Piagam Ottawa (Ottawa
Charter) ini, deklarasi Alma Ata dijadikan dasar pijakannya. Hal ini dapat dilihat
dalam pembukaan Piagam Ottawa yang menyebutkan :
The first International Conference on Health Promotion, meeting in Ottawa
in 21st of November 1968, hereby present this charter for action to achieve
Health for All by the year 2000 and beyond.
Dalam pernyataan ini tersirat bahwa para delegasi atau peserta dari semua
negara, melalui piagam atau charter tersebut bersepakat untuk melanjutkan
pencapaian sehat untuk semua tahun 2000 dan sesudahnya seperti yang telah
dideklarasikan dalam piagam Alma Ata. Hal tersebut adalah merupakan bentuk
komitmen semua negara untuk melanjutkan terwujudnya kesehatan untuk semua
(Health for All) melalui promosi kesehatan. Lebih jelas lagi dalam pendahuluan
Piagam Ottawa juga disebutkan :
.it built on the progress made through Declaration on Primary Health
Care at Alma Ata, the World Orgnizations target for health for All document, and
the recent debate the World Assembly on intersectoral action for health.
Dari uraian tersebut di atas dapat disimpulkan bahwa sejarah promosi
kesehatan pada akhir abad ke-20 dan awal abad ke-21 yang dimulai dengan
Konferensi Internasional Promosi Kesehatan yang pertama di Ottawa, Kanada ini
tidak terlepas dari Deklarasi Alma Ata.

Konferensi Internasional Promosi Kesehatan Tingkat Dunia

Konferensi Internasional Promosi Kesehatan di Ottawa, Kanada,


Tahun 1986

A. Gerakan menuju kesehatan masyarakat baru


Konferensi Internasional Promosi Kesehatan yang pertama dilaksanakan di
Ottawa, Kanada yang berlangsung tanggal 17-21 November 1986. Konferensi
Promosi Kesehatan yang pertama ini mengambil tema Menuju Kesehatan
Masyarakat Baru (The Move Towards a New Public Health).
Konferensi diikuti oleh perwakilan dari kurang lebih 100 negara, baik
yang berasal dari negara-negara maju dan maupun negara berkembang.
Konferensi Promosi Kesehatan yang pertama ini tidak terlepas dari deklarasi
Alma Ata tahun 1978 tentang Pelayanan Kesehatan Dasar atau Primary Health
Care. Kesepakatan-kesepakatan yang dicapai dalam konferensi merupakan
peletakan dasar pembaharuan promosi kesehatan, dalam konteks seperti tema
konferensi ini, yakni Gerakan Menuju Kesehatan Masyarakat Baru. Kesepakatan
bersama tersebut dituangkan dalam Piagam Ottawa (Ottawa Charter). Isi Piagam
Ottawa beserta pembahasannya yaitu :
1

Batasan promosi kesehatan


Menurut Piagam Ottawa, promosi kesehatan adalah suatu proses yang

memungkinkan orang untuk meningkatkan kendali (control) atas kesehatannya


dan meningkatkan status kesehatan mereka (Health Promotion is the process of
enabling people to increase control over and to improve their health). Untuk
mencapai status kesehatan paripurna baik fisik, mental, dan kesejahteraan sosial,
setiap individu atau kelompok harus mampu mengidentifikasi setiap aspirasi,
untuk memenuhi kebutuhan, dan mengubah atau mengantisipasi keadaan
lingkungan. Karena itu, promosi kesehatan bukan saja tanggung jawab sektor
kesehatan, tapi juga meliputi sektor-sektor lain yang mempengaruhi hidup sehat
dan sejahtera sosial.
2

Determinan kesehatan
Teori klasik yang dikembangkan oleh Bloom (1974) mengatakan ada

empat determinan utama yang mempengaruhi derajat kesehatan individu,

kelompok atau masyarakat. Empat determinan tersebut secara berturut-turut


besarnya pengaruh terhadap kesehatan adalah :
a

Lingkungan, baik lingkungan fisik maupun lingkungan non fisik


(sosial, budaya, ekonomi, politik, dan sebaginya).

Perilaku

Pelayanan kesehatan

Keturunan atau heriditer

Determinan lingkungan ini lebih lanjut dapat dibedakan menjadi dua


kelompok yakni lingkungan fisik (cuaca, iklim, sarana, dan parasarana, dan
sebagainya), dan lingkungan non fisik, seperti lingkungan sosial, budaya,
ekonomi, politik, dan sebagainya.
Derajat kesehatan dibedakan antara derajat kesehatan individu, kelompok
atau masyarakat. Hal ini dapat dipahami karena derajat kesehatan perorangan atau
individu, kelompok dan masyarakat memang berbeda.
Faktor faktor determinan yang menentukan atau mempengaruhi kesehatan
individu, kelompok atau masyarakat, dalam piagam otawa (OTTAWA
CHARTER) disebut prasyarat untuk kesehatan (Prerequisites for health).
Piagam Ottawa, 1986 mengidentifikasikan prasyarat untuk kesehatan
dalam Sembilan faktor, yakni :

Perdamaian dan keamanan (peace)

Perumahan ( shelter)

Pendidikan (education)

Di negara-negara berkembang seperti Indonesia ini terdapat tiga masalah


sosial yaitu:
kebodohan (ignorancy), akibat rendahnya pendidikan.
Berbagai macam penyakit (diseases), akibat rendahnya derajat dan
pelayanan kesehatan.
Kemiskinan (proverty), akibat rendahnya ekonomi.
Ketiga hal ini saling mempengaruhi dan membentuk lingkaran setan :

Kebodohan

Kemiskinan

Kemiskinan
Penyakit

Penyakit
Kebodohan

Penyakit

Kemiskinan

Kebodohan

Oleh sebab itu solusi untuk memutuskan mata rantai tersebut dapat
dilakukan melalui ketiga upaya secara bersama, yang hasilnya juga akan saling
berpengaruh :
1

Pendidikan,

Ekonomi

Kesehatan

Makanan

Ekosistem yang stabil

B Misi Promosi Kesehatan


Secara implisit dirumuskan 3 misi promosi kesehatan, yakni ;
1

Advokasi (advocacy)
Kesehatan yang baik merupakan sumber utama untuk perkembangan
sosial, ekonomi, dan personal, dan merupakan dimensi penting dari
kualitas hidup.

Memampukan atau memperkuat


Aksi atau gerakan promosi kesehatan bertujuan untuk mengurangi
perbedaan di dalam status kesehatan dan menjamin sumber dan
kesempatan yang sama yang memungkinkan semua orang mencapai
potensi kesehatan yang seluas-luasnya.

Menjembatani
Promosi kesehatan membutuhkan aksi yang terkoordinasi dengan sektor
lain oleh pemerintah, sektor kesehatan, sektor sosial, ekonomi, dan dengan
organisasi-organisasi

pemerintah

lainnya

seperti

relawan,

swasta,

pemerintah daerah, sektor industri, serta media. Berbagai pemangku

kepentingan atau stakesholder perlu dilibatkan dalam upaya promosi


kesehatan.

C Strategi Promosi Kesehatan


1

Mengembangkan kebijakan publik berwawasan sehat ( bulid healthy


public policy)

Menciptakan lingkungan yang mendukung (supportive environment)

Memperkuat aksi/gerakan masyarakat ( strengthening community action)

Pengembangan keterampilan perseorangan (develop personal skills)

Reorientasi sistem pelayanan kesehatan ( reorient health service)

D Komitemen Terhadap Promosi Kesehatan


Konferensi Ottawa menghasilkan kesepakatan-kesepakatan yang terkait
dengan komitmen terhadap promosi kesehatan ke depan sebagai berikut :
1

Memusatkan sasaran ke aras kebijakan publik berwawasan kesehatan, dan


melakukan advokasi untuk memperoleh komitmen politik yang jelas
terhadap kesehatan dan kesetaraan/keadilan di seluruh sektor.

Melakukan perlawanan atau penolakan terhadap tekanan yang berasal dari


produk-produk berbahaya, pengurasan sumber daya alam secara tidak
bertanggung jawab, kondisi lingkungan hidup yang tidak nyaman untuk
kesehatan, gizi, serta, memusatkan perhatian pada isu-isu globab seperti
polusi, kecelakaan dan keselamatan kerja pengadaan perumahan dan
pembentukan pemukiman yang aman dan sehat.

Merespon kesenjangan dalam pelayanan kesehatan yang ada di dalam


masyrakat dan menjembatanni kesenjangan tersebut dengan kebijakan dan
peraturan-peraturan yang dapat mendorong terciptanya kesetaraan atau
keadilan, baik untuk mendapatkan kesempatan dalam pelayanan kesehatan

maupun fasilitas atau kesempatan lainnya seperti pekerjaan, jaminan


asuransi kesehatan dan sebagainya.
4

Menempatkan manusia sebagai subjek utama kesehatan.

Melakukan reorientasi dalam sistem pelayanan kesehatan dan sumber daya


yang ada demi peningkatan status kesehatan, serta berbagai peran dengan
sektor dan disiplin lain.

Menempatkan kesehatan dan pemeliharaannya sebagai investasi sosial


untuk mengamanatkan isu ekologis kehidupan masyarakat secara
menyeluruh.

Konferensi ini mendorong pihak yang berkepentingan untuk bekerja sama


denga mereka sebagai mitra kesehatan masyarakat yang kuat.

Pilar-Pilar Promosi Kesehatan


1 Gerakan Menuju Kesehatan Masyarakat Baru
Ottawa Charter juga merumuskan strategi promosi keseharan yang baru,
yakni :
a

Membuat kebijakan berwawasan kesehatan (Built healthy public


policy).

Menciptakan lingkungan yang mendukung (Create support ive


environment).

Memperkuat kegiatan masyarakat (Strengthen community action).

Mengembangkan

kemampuan

keterampilan

petugas

(Develop

personal skill).
e

Reorientasi pelayanan kesehatan (Reorient health services).

2 Mengembangkan Kebijakan Berwawasan Kesehatan (Built Healthy Public


Policy)
Hasil konferensi Internasional Promisi Kesehatan yang kedua dituangkan
dalam rekomendasi Adelaide (The Adelaide Recommend ation). Membuat
kebijakan masyarakat sehat atau kebijakan berwawasan kesehatan sebagai Strategi
Promosi Kesehatan yang pertama didasarkan pada asumsi bahwa :

Kesehatan adalah tanggung jawab bersama diantara sektor-sektor


pembangunan di setiap negara. Kesehatan adalah hak asasi manusia
yang sangat fundamental dan merupakan investasi sosial.

Masih terkait dengan kesehatan merupakan hak asasi manusia, maka


perlu adanya pemeratan pelayanan kesehatan.

3 Menciptakan Lingkungan yang Mendukung Kesehatan (Create Supportive


Environment)
Konferensi ketiga diarahkan untuk lebih mengelaborasi atau penjabaran
strategi kedua, yaitu terciptanya lingkungan yang mendukung kesehatan.
4 Pemeran Baru pada Era Baru (New Player for The New Era)
Pada konferensi yang ketiga di Jakarta dibahas tentang bagaimana
melibatkan pihak lain khususnya dunia usaha atau para pemegang otoritas untuk
mengeluarkan kebijakan berwawasan kesehatan dan

menciptakan lingkungan

yang mendukung kesehatan (strategi 2).


5 Menjembatani Kesenjangan Pemerataan (Bridging the Equity Gap)
Keadilan, atau pemerataan dalam konteks kesehatan adalah terjaminnya
semua orang untuk memperoleh kesempatan untuk hidup sehat. Namun pada
kenyataannya dalam masyarakat, terutama di negara-negara berkembang terjadi
kesenjangan (gap) untuk memperoleh kesempatan tersebut.
Untuk itu diperlukan terobosan-terobosan baru guna menutup kesenjangan
tersebut, paling tidak mengurangi atau memperpendek kesenjangan tersebut.
6 Promosi Kesehatan di Dunia yang Mengglobal (Health Promotion in
Globalized World)
Dalam rangka globalisasi promosi kesehatan untuk mewujudkan salah satu
hak asasi manusia, Konferensi Bangkok berhasil mengidentifikasi faktor-faktor
yang kritis dan penting yang mempengaruhi, bahkan sebagai ancaman kesehatan
masyarakat global, yakni :
a

Meningkatnya ketidakadilan di dalam dan antarnegara

Pola baru konsumsi dan komunikasi

Komersialisasi

Perubahan lingkungan global

Urbanisasi

7 Meningkatkan Kesehatan dan Pembangunan, Menutup Kesenjangan


Untuk menutup kesenjangan pembangunan, termasuk pembangunan
kesehatan tersebut, konferensi Promosi Kesehatan di Nairobi telah berhasil
membahas rencana aksi di berbagai perspektif, yang dikelompokkan menjadi :
a

Penguatan lembaga (institusi) promosi kesehatan (capacity building for


health promotion), melalui upaya-upaya antara lain :
1

Memperkuat kepemimpinan Promosi Kesehatan

Memperkuat manajemen kerja

Meningkatkan pembiayaan atau anggaran promosi kesehatan, dan


sebagainya.

Memperkuat sistem kesehatan (strengthening health system), antara


lain melalui :
1

Menyempurnakan kebijakan kebijakan publik yang terkait dengan


isu-isu kesehatan yang strategis yang menjadi ancaman kesehatan
penduduk, seperti meluasnya penyebaran HIV/AIDS, menurunnya
kesehatan perempuan yang dapat berakibat terhadap kualitas hidup
bagi generasi selanjutnya, meningkatkan populasi lansia, dsb.

Meningkatkan

akses

pelayanan

kesehatan

bagi

kelompok

masyarakat dimanapun, tidak hanya karena jarak yang dekat antara


masyarakat dengan fasilitas pelayanan kesehatan, tetapi juga
dengan menurunkan biaya pelayanan kesehatan.
c

Kemitraan dan kerja sama lintas sektor (partnership and inter sector
action)

Pemberdayaan masyarakt (community empowerment)

Melek/sadar kesehatan dan perilaku sehat (health literacy and health


behavior)

Konferensi Internasional Promosi Kesehatan di Adelaide, Australia


tahun 1988
Konferensi Internasional Promosi Kesehatan ke dua dilaksanakan di

Adelaide, Australia pada tanggal 5-9 April 1988. Tema dari konferensi ke dua
adalah membangun kebijakan publik yang berwawasan kesehatan, merupakan

strategi promosi kesehatan yang pertama dari Ottawa Charter. Hasil kesepakatan
konferensi promosi kesehatan di Adelaide ini dituangkan dalam rekomendasi
Adelaide (Adelaide Recommendation).
A.
1

Isi Rekomendasi Adelaide dan Penjelasannya


Lingkungan dan Perilaku Kondusif bagi Kesehatan
Konferensi kedua promosi kesehatan ini menghasilkan seperangkat

strategi guna mendukung terciptanya masyarakat yang hidup dalam lingkungan


yang sehat dan berperilaku sehat. Strategi tersebut meliputi :
a Kebijakan public berwawasan kesehatan.
b Mendorong terwujudnya revitalisasi nilai-nilai asasi kesehatan.
c Pemerataan akses masyarakat terhadap pelayanan kesehatan.
d Akuntabilitas dalam program kesehatan.
e Meningkatkan program melampaui pelayanan.
f Kemitraan.
2 Mengembangkan Kebijakan Publik Berwawasan Kesehatan
Kebijakan public berwawasan kesehatan adalah seperangkat kebijakan,
peraturan maupun regulasi yang menjamin tercapainya tujuan pembangunan
kesehatan. Adanya kebijakan publik ini akan mendorong segera terwujudnya
lingkungan fisik, maupun lingkungan sosial budaya yang mendukung, yang
memungkinkan setiap insan hidup dalam lingkungan dan perilaku sehat.
Kebijakan publik yang berwawasan kesehatan diharapkan mampu mendorong
setiap sector utamanya sector pemerintah untuk senantiasa mengedepankan
petingnya kesehatan dalam setiap formulasi kebijakannya.
Kebijakan public berwawasan kesehatan adalah suatu konsep yang dapat
diinterpresentasikan memiliki dua pengertian, yang pertama sebagai sesuatu yang
sangat menarik untuk dikonsumsi, namun di sisi lain dapat diartiakan sebagai
sesuatu yang mengancam, terutama bagi yang tidak memperoleh manfaat
langsung dari kebijakan tersebut.
Kebijakan dapat dianalisis menggunakan 3 domain :
1 Proses terbentuknya kebijakan.
2 Isi kebijakan yang dihasilkan.
3 Dampak kebijakan yang diambil.

Revitalisasi Nilai Azasi Kesehatan


Pada tahun 1991, Dahlgren dan Whitehead menjelaskan bahwa determinan

kesehatan terdiri dari :


a Aspek sosial budaya dan lingkungan.

b
c
d

Kondisi kehidupan dan pekerjaan.


Jejaring sosial dan komunitas.
Gaya hidup perorangan.

Umur, jenis kelamin dan factor keturunan.


Berkembangnya ilmu kesehatan sekaligus antisipasi dari semakin

kompleknya problematika kesehatan.


Menurut WHO, Problematika kesehatan dapat diatasi melalui :

B.

Penguatan kapasitas masyarakat.

b
c
d

Penguatan keterampilan individu.


Perluasan akses (masyarakat) terhadap fasilitas dan pelayanan.
Mendorong tumbuhnya kebijakan berwawasan kesehatan.

Pemerataan, Uses dan Pengembangan


Herdeman dkk. Mengidentifikasi, setidaknya ada 4 faktor yang menjadi

kendala utama untuk menjangkau pelayanan kesehatan, yaitu :


a

financial

geografis

keterpaparan informasi

persoalan internal rumah tangga


Bridge dan Annear mengidentifikasi ada 5 hal yang menjadi kendala

dalam menjangakau pelayanan, yaitu :


a

hambatan fisik

hambatan financial

c
d

kualitas pelayanan
pengetahuan pengguna tentang ketersedian pelayanan, jaminan
kerahasian.

Hambatan sosial budaya.

Namun harus diakui bahwa dalam menghadapi peradaban dan tantangan


yang semakin kompleks termasuk problematika kesehatan, sebagian masyarakat
masih berada pada kondisi :
a

kebodohan

kekakuan tradisi

penduduk yang tidak terampil

d
e
f
C.

konsumtif
tidak mampu alih teknologi/waralaba
salah penempatan/penggunaan.

Akuntabilitas untuk Kesehatan


Kebijakan public yang bersifat akuntabel berciri :
a

kebijakan tersebut rasional.

menjangkau khalayak yang luas.

efektif untuk mengatasi persoalan.

Oleh masyarakat dapat diterima.

Sehingga kebijakan public yang akuntabel juga menghasilkan aksi masyarakat


yang kondusif.
1

Bergerak melampaui pelayanan kesehatan.


Kebijakan public berwawasan kesehatan yang dibuat merupakan
respons

dari

terjadinya

dinamika

problematika

kesehatan

dan

perkembangan teknologi yang sangat cepat.


Mitra dalam proses kebijakan.
Kemitraan memiliki beberapa cirri :
1 kerjasama pada berbagai jenjang (individu, kelompok, institusi)
2 adanya kesepakatan tentang peran dari tiap pihak.
3 Bersama-sama mencapai tujuan tertentu.
4 Saling menanggung risiko dan manfaat
Persoalan dan kendala dalam kemitraan dilihat dari 3 sisi pelaku
kemitraan :
a kendala bermitra di pihak pemerintah
1 asimetris, pemerintah merasakan dirinya sebagai patron, sebab
2

menyandang dana, mengatur, mempunyai SDM yang baik


orientasi pemerintah tidak berdasarkan benar-benar

suatu

kebutuhan (felt needs), tetapi hanya berdasarkan intusisi saja, dan


seringkali implementasi proyek tidak sesuai dengan kondisi
lapangan. Dengan kapasitas SDM yang kuat, pemerintah

mempunyai kemampuan prediksi.


3 egosentrisme sektoral.
4 Birokratis (menghambat proses sosial exchange).
kendala bermitra di pihak swasta
1 asimetris (merasa sebagai klien pemerintah, dipaksa untuk
melayani masyarakat).

tidak merasakan need sendiri (tidak merasa bahwa dirinya punya


masalah, belum melihat manfaat langsungnya belum dapat dilihat

segera).
motivasi tidak sesuai dengan tujuan program (ikut program untuk
menggalang

koneksi

dengan

pemerintah,

takut

didemo

masyarakat).
Egoism individu, kelompok (merasa lebih hebat, lebih tinggi
dibandingkan masyarakat).

D. Area Utama Kebijakan Publik Berwawasan Kesehatan


1. Dukungan Terhadap (Program) Kesehatan Perempuan
Perempuuan adalah promoter kesehatan utama di dunia, utamanya dalam
mewujudkan derajat kesehatan keluarga yang setinggi-tingginya, namun banyak
diantara mereka mengalami berbagai diskriminasi, termasuk diantaranya upah
yang rendah pada perempuan yang bekerja.
Konferensi juga mengusulkan agar semua Negara mengembangkan
kebijakan dan program yang berwawasan kesehatan dimana perempuan menjadi
focusnya. Untuk itu perlu ada :
a

keadilan memperoleh kesempatan ekonomi, atau mendapatkan pekerjaan.

b
c
d

Hak melahirkan kebutuhan dan preferensinya.


Kesempatan menjalankan fungsi mengasuh anak-anaknya.
Kebebasan menentukan pelayanan kesehatan.

2. Pangan dan Gizi


Pangan dan gizi adalah tujuan fundamental kebijakan public berwawasan
kesehatan. Kebijakan ini harus menjamin bahwa pertanian, ekonomi dan
lingkungan yang mempunyai dampak pada kesehatan harus menjadi prioritas
pemerintah. Kebiajakan pangan dan gizi yang diperlukan adalah yang menjamin
terintegrasinya factor produksi dan distribusi makanan oleh swasta dan public,
sehingga dicapai harga yang adil dan terjangkau.
3.Tembakau dan Alkohol

Penggunaan tembakau (rokok) dan penyalahgunaan alcohol adalah dua


bahaya kesehatan yang patut mendapat tindakan segera melalui pengembangan
kebijakan public yang sehat. Konsumsi tembakau tidak hanya merugikan si
perokok, namun juga merugikan lingkungan di sekitarnya (perokok pasif).
Alcohol berkontribusi sangat besar pada kriminalitas, trauma fisik dan mental,
termasuk juga memberikan sumbangan terhadap terjadinya perselisihan sosial. Di
sisi lain, penggunaan tembakau sebagai komoditas ekonomi kelompok miskin
berimplikasi pada krisis dunia dalam produksi dan distribusi pangan.
4. Menciptakan Lingkungan yang Mendukung
Lingkungan adala determinan utama

status

kesehatan.

Dalam

melaksanakan pengelolaan lingkungan hidup terdapat setidaknya terdapat dua


prinsip dasar, yaitu harus dapat melindungi kesehatan manusia dari langsung dan
tidak langsung efek samping dari factor-faktor biologi, kimia dan fisik, serta harus
mengakui bahwa perempuan dan laki-laki adalah bagian dari ekosistem yang
kompleks. Dalam mengelola lingkungan, komitmen semua tingkat dan lini
pemerintahan diperlukan.
a. Aliansi baru untuk kesehatan.
Konferensi yang diselerenggarakan di bagian selatan Benua Australia juga
menyarankan tentang perlunya lembaga-lembaga pemerintah, swasta maupun
lembaga

swadaya

masyarakat

local,

nasional

maupun

internasional

menyelerenggarakan :
1. Upaya-upaya meyebarluaskan pengalaman dalam melaksanakan
praktik-praktik

promosi

kesehatan

sebagai

upaya

meningkatkan

kemampuan semua pihak dalam melaksanakan program, melalui


pendirian clearing house.
2. Jejaring sumber daya promosi kesehatan dalam riset, pelatihan, dan
program yang menjadi implementasi kebijakan berwawasan kesehatan.
b. Komitmen untuk kesehatan masyarakat global.
Agar kesehatan dan kesejahteraan tercapai diperlukan beberapa syarat, yaitu
perdamaian, makanan bergizi, air bersih, pendidikan, perumahan, peran sosial
yang jelas, pendapatan, serta dukungan ekosistem.

E. Tantangan Masa Depan

Keadilan dan pemerataan dalam penguasaan dan kepemilikan sumber

daya ekonomi.
Terjaminnya Keselamatan, kesejahteraan dan kesehatan masyarakat

dalam melaksanakan aktivitas pekerjaannya.


Pengembangan jejaring internasional dalam mewujudkan perdamaian,
keadilan sosial, hak asasi manusia, konservasi lingkungan serta

pembangunan berkelanjutan.
Terwujudnya komitmen semua pihak dari beragam latar belakang
aspirasi sosial politiknya dalam menumbuhkan kebijakan berwawasan

kesehatan.
Memastikan bahwa memajuan teknologi dalam kesehatan harus
membantu meningkatkan tercapainya masyarakat yang sehat, bukan
menghambatnya.

Konferensi Internasional Promosi Kesehatan di Sundsvall, Swedia

tahun 1991
A. Menciptakan lingkungan yang mendukung kesehatan
Konferensi internasional promosi kesehatan yang ketiga, dilaksanakan di
Sundsvall, Swedia, tanggal 9-15 Juni 1991. Tema konferensi yang ketiga ini
adalah Menciptakan lingkungan yang mendukung kesehatan atau Supportive
Environment for Health. Tema ini merupakan strategi yang kedua promosi
kesehatan dan telah dirumuskan dalam piagam ottawa (ottawa charter).
Konferensi di Sundsvall merupakan penjabaran yang lebih rinci tentang
pengembangan lingkungan yang mendukung kesehatan. Konferensi dihadiri oleh
318 orang peserta atau perwakilan dari 81 negara, baik dari negara maju maupun
negaran berkembang. Hasil konferensi promosi kesehatan yang ketiga ini
dirumuskan dalam pernyataan sundsvall (sundsvall statement).
Konferensi diselenggarakan berjarak tiga tahun setelah konferensi di
adelaide, Australia, dan 5 tahun setelah konferensi pertama di ottawa. Sesuai
dengan tujuan yang disusun sejak awal perencanaan konferensi, konferensi
memang dimaksudkan untuk memfokuskan diri pada hal yang bersifat kegiatan
action. Untuk itu, peserta yang datang ke konferensi ini membawa dan
menyajikan pengalaman mereka tentang upaya-upaya yang sudah berhasil
dijalankan berkenaan dengan lingkungan yang mendukung kesehatan. Ada
tujuh isu pokok tentang lingkungan yang mendukung ini, dan didiskusikan

melalui lokakarya yaitu pendidikan, makanan dan gizi, rumah dan lingkungan
rumah tangga, pekerjaan dan tempat kerja, transportasi, dan dukungan sosial.
1 Model praktik promosi kesehatan
a Health promotion strategy analysis model (HELPSAME)
Model ini berguna untuk manganalisis pengalaman dalam menciptakan
lingkungan yang mendukung. Dengan menyediakan struktur analisis,
HELPSAME dapat dipakai sebagai alat analisis dalam menciptakan
lingkungan yang mendukung dan mengklarifikasi strategi dan unsurunsur yang penting untuk dipakai dalam menjalankan promosi
b

kesehatan.
Sundsvall pyramid of supportive environment
Yang didasarkan pad 6 topik yang didiskusikan yaitu makanan, rumah
dan lingkungan tetangga, makanan dan transportasi sebagai alas

piramid, dan pendidikan dan dukungan sosial sebagai dinding piramid.


Supportive environment action model (SESAME)
Model ini berperan dalam memfasilitasi kegiatan, dan dapat dilihat
sebagai sebuah spiral. HELPSAME dan SESAME bersifat saling
melengkapi, tidak masing-masing eksklusif dan tidak pula dapat saling

mengganti.
Lingkungan yang mendukung kesehatan
Konferensi sundsvall yakin bahwa proposal untuk penerapan strategi
kesehatan untuk semua harus mencerminkan dua prinsip dasar:
a Pemerataan harus menjadi prioritas dasar dalam percepatan lingkungan
yang mendukung bagi kesehatan, dengan mengeluarkan energi dan
kekuatan kreatif dan mengajak semua orang dalam upaya yang unik
b

ini.
Kegiatan publik untuk lingkungan yang mendukung bagi kesehatan
harus mengakui saling ketergantungan diantara semua makhluk hidup
dan harus menatalaksana semua sumber daya alam, dengan
memperhatikan kebutuhan generasi masa depan

B Dimensi-dimensi Aksi untuk Menciptakan Lingkungan yang Mendukung


Dalam konteks kesehatan, lingkungan yang mendukung aspek fisik, sosial,
dan budaya di mana masyarakat tinggal, beraktivitas, serta dengan siapa saja
mereka berinteraksi. Oleh karena itu konsep lingkungan tidak dapat dipisahkan
dari besarnya akses terhadap sumber data dan daya dukung yang memadai untuk
kehidupannya, dan seberapa besar peluang bagi masyarakat untuk diberdayakan.
Dengan demikian, dalam menciptakan lingkungan yang mendukung, setidaknya

terrdapat beberapa dimensi, yaitu melakukan perubahan fisik, perubahan sosial,


meningkatkan aspek spiritual, serta mendorong peningkatan kualitas ekonomi dan
politik. Semua dimensi saling terkait membentuk interaksi yang dinamis.
Oleh sebab itu, pemerintah dan masyarakat di berbagai negara perlu
mencermati terjadinya perubahan, sekaligus melakukan berbagai tindakan proaktif
dan antisipatif yang cerdas, serta empatik. Berbagai aksi perlu dirancang dengan
cermat, dan koordinasi pada tingkat lokal, regional, nasional, dan tingkat global
harus dilakukan agar solusi yang diperoleh tepat dan sejalan dengan prinsipprinsip pembangunan yang berkelanjutan (sustainable development).
Konferensi ini mengupas empat dimensi dalam lingkungan yang mendukung
kesehatan, yaitu:
1 Dimensi sosial budaya
Dimensi sosial meliputi nilai dan norma, adat kebiasaan serat prosesproses sosial di masyarakat yang mempengaruhi kesehatan. Dalam
masyarakat tradisional berbagai praktik sosial budaya dapat mengancam
kesehatan. Di sisi lain, terdapat juga budaya masyarakat yang berdampak
positif terhadap kesehatan, mislanya kebiasaan bergotong-royong
masyarakat.
2 Dimensi politik
Sejalan dengan tumbuh kembangnya demokrasi, terjadi pergeseran
perspektif hubungan antara pemerintah dan rakyatnya, dari suatu keadaan
kewenangan mutlak pemerintah atas rakyatnya (the state society) menjadi
partisipasi rakyat dalam mengelola negara (civil society). Untuk itu
pemerintah harus menjamin peran serta masyarakat dalam mengambil
keputusan,
menumbuhkan
tanggung
jawabnya
sekaligus
mendesentralisasikan sumber daya yang diperlukan dalam pembangunan.
3 Dimensi ekonomi
Ekonomi adalah determinan utama kesehatan, untuk menjamin
tercapainya kesehatan untuk semua dan pembangunan berkelanjutan
diperlukan peningkatan dan redistribusi ekonomi, termasuk di dalamnya
4

penggunaan teknologi yang aman dan terpercaya.


Dimensi gender
Sejalan dengan terjadinya perkembangan peradaban, berbagai pihak perlu
melihat secara lebih berimbang tentang persoalan gender. Berbagai peran
dalam pembangunan seharusnya terbebaskan dari diskriminasi gender.
Perempuan mempunyai kemampuan yang tidak kalah dari laki-laki.
Untuk mewujudkan lingkungan yang mendukung kesehatan,
konferensi sundsvall merumuskan pelaksanaan promosi kesehatan yang
berdasarkan dua prinsip utama, yakni ekuitas (pemerataan) dan
keseimbangan ekologis dan sustainabilitas.

C Mempromosikan lingkungan yang mendukung

Konferensi sundsvall mengidentifikasi empat strategi utama ditingkat


masyarakat dalam mempromosikan terciptanya lingkungan yang mendukung
kesehatan, yaitu:
1 Advokasi
Advokasi adalah upaya yang dilakukan untuk memperoleh dukungan
politis dalam kebijakan dan implementasi program. Nerdasarkan
kepentingannya, sasaran advokasi dapat dikelompokkan menjadi:
1 Pengambil kebijakan utama
2 Legislatif
3 Stakeholder
4 Public figur
5 Asosiasi/organisasi profesi
Tujuan dari advokasi adalah:
a

Meningkatkan jumlah kebijakan publik yang selaras dengan yang

b
c

diharapkan
Meningkatkan opini masyarakat dalam mendukung program
Teratasinya masalah yang menimpa banyak orang

Untuk dalam rangka memenuhi syarat dasar melakukan advokasi, pada


waktu memilih sasaran advokasi hal-hal berikut perlu diperhatikan:
1

Bentuk instrumen kebijakan publik yang diinginkan (apakah

berbentuk peraturan, anggaran, atau hal lain)


Kompetensi dan jangkauan kewenangan unsur atau istansi yang

3
a

hendak diadvokasi
Ciri dan kondisi spesifiknya sebagai sasaran komunikasi
Substansi advoaksi
Beberapa syarat tertentu agar suatu substansi/program tertentu dapat
diadvokasikan:
1 Credible, Program yang diajukan dapat dipercaya
2 Feasible, secara teknis program layak untuk dilaksanakan
3 Relevant, program memenuhi kebutuhan masyarakat dan benarbenar memecahkan masalah
4 Urgent, program harus segera dilaksanakn
5 High priority, program mempunyai prioritas tinggi
Kompone advokasi
1 Analisis terhadap para pemangku kepentingan (stakholders).
2 Analisis terhadap jejaring (network) dalam pengambilan
keputusan/ pemberian dukungan.
3 Merumuskan strategi advokasi.

4 Pendekatan kunci dalam advokasi.


Pendidikan dan pemberdayaan masyarakat
Sebagai suatu proses, jackson (1989) dan rissel (1994) mengatakan
pemberdayaan masyarakat melibatkan beberapa komponen berikut, yaitu
pemberdayaan
personal,
pengembangan
kelompok
kecil,
pengorganisasian masyarakat, kemitraan dan aksi sosial dan politik.
Pemberdayaan masyarakat dapat dilaksanakan dengan mengikuti langkahlangkah:
a Menetapkan tujuan
b Merancang program
c Memilih strategi pemberdayaan
d Implementasi strategi dan manajemen
Kemitraan
Kemitraan adalah tema yang mulai sering dibicarakan sejalan dengan
adanya kesadaran tentang dunia yang mengglobal, serta diperlukannya
kerja sama di berbagai jenjang dari lokal hingga internasional dalam
mengatasi berbagai persoalan, kemiskinan, hak asasi manusia, hingga
kesehatan. Kesehatan adalah masalah yang cukup kompleks. Dalam
kesehatan, tema kemitraan semakin menguat setelah dilaksanakannya
konferensi internasional promosi kesehatan ke 4 di jakarta, idonesia,
dengan tema The new players for the new era (pemeran-pemeran baru
untuk era baru)
Mediasi
Promosi kesehatan adalah kegiatan yang besar, luas, sekaligus berat.
Promosi kesehatan dilaksanakan dengan berpedoman pada 6 faktor:
a Masalah
b Nilai-nilai
c Teori
d Fakta
e Strategi
f Aksi

D Perspektif global
Perspektif global adalah cara pandang yang melihat semua makhluk dari
berbagai belahan dunia adalah bagian yang integral dari ekosistem bumi.
Demikian pula halnya dengan kesehatan, adalah bagian yang tak terpisahkan dari
lingkungan hidupnya. Pengaruh lingkungan terhadap kehidupan mahkluk hidup
sangat besar. Oleh karena itu untuk mempertahankan kualitas hidupnya, manusia
harus berprilaku yang selaras dengan upaya melestarikan dan mengelola
lingkungan yang sejalan dengan prinsip pembangunan berkelanjutan.
Hal tersebut merupakan tantangan besar bagi umat manusia, di tengah
berbagai ketidakadilan. Ketidakadilan yang dipicu oleh ketimpangan yang besar

dalam pendapatan masyarakat antarbangsa telah menyebabkan terjadinya


ketidaksetaraan dalam akses masyarakat dalam kesehatan, lingkungan hidup,
pemukiman, air bersih dan sanitasi. Pengambilan keputusan politik dan
pengembangan industri lebih sering didasarkan pada perencanaan jangka pendek
dan keuntungan ekonomi yang tidak memperhitungkan risiko kesehatan dan
kerusakan lingkungan. Berbagai penyelesaian hutang telah menguras sumber daya
negara-negara miskin. Belanja militer meningkat dan peperangan telah
menyebabkan kematian, kecacatan, dan kini menyebabkan terjadinya vandalisme
ekologis.
Eksploitasi tenaga kerja, eksportasi dan dumping bahan-bahan berbahaya,
khususnya pada bangsa-bangsa yang lemah dan miskin dan konsumsi sumber
daya dunia secara mubazir, mendemonstrasikan bahwa pendekatan pembangunan
yang ada merupakan sebuah krisis. Diperlukan pengembangan etika baru dan
perjanjian global yang didasarkan pada hidup bersama secara damai guna
memungkinkan distribusu dan penggunaan yang merata dari sumber daya bumi
yang terbatas ini.
E Mencapai akuntabilitas global
Konferensi sundsvall menyerukan kepada masyarakat internasional agar
memantapkan mekanisme baru dalam program kesehatan dan akuntabilitas
ekologi yang dibangun di atas prinsip-prinsip pembangunan kesehatan yang
berkelanjutan. Untuk itu, diperlukan berbagai inisiatif, etika dan kebijakan peda
tingkat global dalam rangka pembangunan yang berkelanjutan. Salah satu
diantaranya adalah dalam mengendalikan perdagangan dan pemasaran produk zat
berbahaya bagi kesehatan dan lingkungan. Berbagai lembaga donor internasional
dan multilateral, misalnya bank dunia dan dan moneter internasional didesak
untuk menggunakan panduan tentang pembangunan berkelanjutan dalam
menyusun perencanaan , pelaksanaan dan menilai proyek-proyek pembangunan.
Negara-negara miskin dan berkembang perlu dibantu sehingga lebih mandiri
dalam mengambil keputusan yang mereka perlukan.
Konferensi sundsvall telah menunjukkan kembali bahwa isu-isu kesehatan,
lingkungan

dan

pembangunan

manusia

tidak

dapat

dipisah-pisahkan.

Pembangunan harus dimaknai sebagai upaya meningkatkan kualitas hidup dan

kesehatan, sambil menjaga kelestarian lingkungan. Kemitraan global diperlukan


untuk menjamin masa depan kehidupan umat manusia dimuka bumi ini.
4. Konferensi Internasional Promosi Kesehatan di Jakarta, Indonesia
tahun 1997
A Pemeran Baru di Era Baru
Jakarta

adalah

merupakan

tempat

penyelenggaraan

Konferensi

Innternasional Promosi Kesehatan yang ke empat, dan merupakan pertama kali


konferensi

ini

diselenggarakan

di

negara

berkembang.

Konferensi

ini

diselenggarakan pada tanggal 21 25 Juli 1997, dengan mengambil tema :


Pemeran Baru pada Era Baru atau New Player for a New Era. Konferensi
sebelumnya diselenggarakan di negara maju, yakni Kanada, Australia, dan
Swedia. Konferensi ini dihadiri oleh 250 orang peserta yang berasal dari negara
negara berkembang maupun negara negara maju. Hasil konferensi dituangkan
dalam Deklarasi Jakarta (Jakarta Declaration).

B Sejarah Baru
Penyelenggaraan

Konferensi

Internasional

Promosi

Kesehatan

ini

merupakan bagian sejarah tersendiri, karena Konferensi ini dilaksanakan hampir


20 tahun setelah negara negara angggota WHO mendeklarasikan Kesehatan
untuk Semua tahun 2000 atau Health for All by the year 2000 di Alma Ata.
Konferensi Internasional Promosi Kesehtana di Jakarta diselenggaraka 10 tahun
setelah Konferensi Internasional Promosi Kesehatan yang pertama menghasilkan
Piagam Ottawa atau Ottawaa Charter
Konferensi Internasional Promosi Kesehatan di Jakarata, mempunyai
keunikan yakni dengan melibatkan pihak swasta (non government organization).
Pada konferensi sebelumnya hanya melibatkan pihak pihak praktisi kesehatan
pemerintah dan swasta dann pihak pihak akademisi dari perguruan tinggi, tetapi
konferensi internasional Promosi Kesehatan di Jakarta ini , disamping keterlibatan
unsur unsur diatas tersebut,

juga melibatkan pihak swasta. Pentingnya

melibatkan pihak swasta dalam program program kesehatan adalah dalam


rangka perwujudan dari corporate sosial responsbility bagi

pihak sswasta,

khususnya dalam membantu program program kesehatan. Oleh sebab itu dalam
rangka menangani masalah masalah kesehatan, termasuk Promosi Kesehatan,
pihak swasta harus dilibatkan.

Itulah sebabnya maka pada Konferensi

Internasioanal Promosi Kesehatan di Jakarta ini melibatkan sektor swasta bukan


hanya sebagai peserta konferensi, tetapi juga dalam perencanaan dan pembiayaan
konferensi. Dari Konferensi Internasional Promosi Kesehatan yang keempat di
Jakarta ini, disepakatinya Deklarasi Jakarta tentang Promosi Kesehatan Abad 21
atau The Declaration on Heaklth Promotion into the 21 Century.
1

Promosi Kesehatan : Investasi Swasta yang Berharga


Memasuki abad ke 21 ini kesehatan menghadapi tantangan luar biasa

besarnya. Dengan kemajuan ilmu pengetahuan dan teknologi, memang manusia


memperoleh kemudahan kemudahan yang luar biasa dalam hidupnya, mulai
dari makanan, tempat tinggal, hiburan, komunikasi, transportasi, dan sebagainya.
Namun disisi lain dampak dari kemudahan itu juga mengancam kesehatan
manusia itu sendiri.
Kemudahan kemudahan yang dicapai oleh manusia juga berakibat
terhadap gaya hidup yang berisiko kesehatan. Dampak yang diakibatkan oleh
perkembangan ilmu dan teknologi ke depan, khusunya abad ke 21 ini juga
berkembangnya perilaku perilaku yang berisiko tinggi terhadap kesehatan.
Dipihak lain, masyarakat tidak atau kurang siap mengantisipasi dampak dari
perkembangan tersebut, maka orang menjadi rentan

terhadap faktor risiko

kesehatan.
Cara untuk mengeliminir faktor perilaku yang berisiko terhadap kesehatan
ini yang paling utam adalah dengan promosi kesehatan. Karena dengan promosi
kesehatan, bukan hanya perilaku masyarakat yang dipersiapkan untuk menghadapi
risiko kesehatan, tetapi juga pihak pihak yang menimbulkan terjadinya faktor
risiko kesehatan.
Promosi kesehatan, dengan berbagi kegiatan dan strategi, dengan berbagai
metode dan teknik berupaya untuk memerangi perilaku perilaku masyarakat
yang berisiko dan mengembangkan perilaku hidup sehat. Hal ini berarti bukan
hanya meningkatnya perilaku sebagai salah satu determinan kesehatan yang lain
sehingga berpengaruh positif terhadap kesehatan, teapi juga meningkatnya
determinan kesehatan yang lain sehingga berpengaruh positif terhadap kesehatan.

Dengan kata lain promosi kesehatan merupakan investasi yang sangat berharga
dalam rangka meningkatnya derajat kesehatan dimana pun juga.
Menyadari akan pentingnya Promosi Kesehatan ini, maka para peserta
Konferensi Internasional Promosi Kesehatan yang keempat di Jakarta ini berupaya
melibatkan semua pihak yang berkepentingan terhadap kesehatan.
2 Determinan Kesehatan : Tantangan Baru
Dalam Deklarasi Jakarta tentang promosi kesehatan, masalah masalah
kesehatan dan determinan determinan kesehatan telah diidentifikasikan, dan bila
disederhanakan dapat dikelompokkan menjadi :
a Prasyarat untuk kesehatan
Prasyarat untuk terwujudnya derajat kesehatan yang juga merupakan
determinan secara akumulatif terhadap kesehatan masyarakat ini
mencakup :
1 Perdamaian.
2 Perumahan.
3 Pendidikan.
4 Perlindungan sosial.
5 Hubungan kemasyarakatan.
6 Pangan.
7 Pendapatan.
8 Pemerdatyaan perempuan.
9 Ekosisitem yang mantap.
10 Pemanfaatan sumber daya yang berkelanjutan, keadilan sosial,
penghormatan terhadap hak hak asasi manusia.
11 Persamaan.
b Kecenderungan demografi
Struktur atau pola demograsi pada abad 21 sudah barang tentu akan
mengalami perubahan disebabkan antara lain karena :
1 Kenaikan jumlah penduduk usia lanjut sebagai kelompok yang rentan
2

terhadap masalah kesehatan, akibat meningkatnya harapan hidup.


Urbanisasi yang tinggi akibat ketimpangan pembangunan antar desa
dan kota akan memperberat masalah kesehatan perkotaan (urban

health).
Perbandingan antara jumlah penduduk wanita dan laki laki yang
tidak seimbang, jumlah penduduk wanita cenderung lebih tinggi

dibandingkan jumlah penduduk laki laki.


Sementara itu juga terjadi perubahan perilaku, sosial, dan biologis
seperti : kebiasaan kurang gerak (sedentary), kebal antibiotik dan obat
obatan, penyalahgunaan obta, kekerasan baik di dalam keluarga

maupun di masyarakat, dan sebagainya merupakan ancaman


kesehatan dan kesejahteraan manusia.
c

Faktor antarbangsa
Dampaknya terhadap kesehatan, antara lain : ekonomi global, pasar
uang dan perdagangan, akss ke media teknologi komunikasi dan juga
degradasi lingkungan akibat penggunaan sumber daya secara tidak

bertanggung jawab.
Masalah kesehatan utama : Penyakit
Penyakit infeksi (menular) :
Penyakit penyakit baru yang dulu tidak ada, tetapi belakangan ini
muncul (new emerging disease), seperti HIV/AIDS, Flu Burung, dan Flu
Babi. Sementara itu penyakit penyakit lama yang sudah menurun bahkan
sudah tidak ada, tetapi meningkat atau muncul lagi (emerging diseases),
seperti TB Paru dan Cacar.
Penyakit Tidak Menular :
Di negara negara berkembang menghadapi beban ganda masalah
kesehatan. Di satu sisi masih tingginya penyakit penyakit infeksi
(menular), tetapi dipihak lain penyakit penyakit tidak menular seperti
hipertensi, diabetes mellitus, penyakit jantung dan pembuluh darah
cenderung meningkat. Perubahan perubahan dan masalah masalah
tersebut membawa perubahan terhadap norma, gaya hidup dan lingkungan
tempat tinggal bagi semua orang diseluruh dunia.

Pendekatan Baru Promosi Kesehatan


Selama konferensi dirumuskan dalam Deklarasi Jaklarta, antara lain
menyebutkan bahwa :
a Dari penelitian penelitian yang dihasilkan oleh peneliti peneliti
dari berbagai negara memberikan bukti bahwa Promosi kesehatan
mempunyai pengaruh daklam menunjang keberhasilan program
kesehatan yang lain, antara lain meningkatkan cakupan imunisasi,
meningkatkan cakupan ibu hamil yang melakukan ante natal
care, meningkatkan masyarakat dalam penggunaan jamban dan air
b

bersih, dan sebagainya.


Strategi promosi kesehatan yang telah dirumuskan dalam Ottawa
Charter, yakni :

1
2
3
4

Mengembangkan kebijakan yang berwawasan kesehatan,


Menciptakan lingkungan yang mendukung,
Memeperkuat kegiatan masyarakat dalam kesehatan,
Meningkatkan keterampilan perorangan dan memelihara

kesehatan,
Reorientasi pelayaan kesehatan.

Pendekatan baru promosi kesehatan yang dimaksud dalam Deklarasi


Jakarta ini adalah sebagai berikut :
a

Pendekatan komprehensif
Pendekatan komprehensif yang dimaksud disini adalah
melaksanakan kelima strategi Ottawa Charter secara bersamaan
dalam Promosi Kesehatan untuk strategi mengembangkan
kebijakan yang berwawasan kesehatan, menciptakan lingkungan
yang mendukung, reorientasi pelayanan kesehatan ditujukan
kepada para pembuat keputusan (sasaran tertier) dan tokoh
masyaraakt (sekunder). Sedangkan untuk strategi memperkuat
kegiatan masyarakat, meningkatkan keterampilan perorangan
sasaran utamanya adalah masyarakat dalam berbagai jenis
kelompok dan tatanan (sasaran primer), dan juga tokoh

masyarakat (sasaran sekunder).


Pendekatan melalui tatanan
Tatanan implementasi Promosi Kesehatn dapat dibedakan
menjadi berbagai jenis, antara lain :
1 Tatanan
administrasi
pemerintahan,

misalnya

Kabupaten/kota, Kecamatan, Desa atau Kelurahan, Pulau,


2
3

dan sebagainya.
Institusi pendidikan : Sekolah, Madrasah, Perguruan Ringgi.
Institusi pelayaan kesehatan : Rumah Sakit, Poliklinik, dan

sebagainya.
Tempat tempat kerja : pabrik, perusahaan, kantor, dan

sebagainya.
Tempat tempat umum : Pasar, terminal, mall, stasiun kereta

api, dan sebagainya.


Keluarga, sebagai unit masyarakat terkecil : Keluarga atau
rumah tangga adalah merupakan tempat promosi kesehatan
yang pertama dan utama.

Peran serta masyarakat


Dengan peran serta masyarakat dalam program kesehatan,
mereka akan menyadari bahwa kesehatan atau pelayan kesehatan

sebenarnya adalah berasal dari dan oleh mereka sendiri.


Pembelajaran kesehatan
Promosi Kesehatan adalah merupakan pembelajaran
kesehatan oleh masyarakat. Pembelajaran harus datang dalam diri
yang belajar atau masyarakat. Haisl dari pembelajaran kesehatan
bagi masyarakat, adalah bahwa kesehatan adalah sumber
kehidupan mereka, yang perlu disambung dan ditingkatkan.
Guna menghadapi tatangan tanntangan pada tahun
mendatang, memerlukan pendobrakan terhadap sekat sekat atau
dinding dinding yang selama ini menghambat terwujudnya kerja

sama tersebut.
C Prioritas Promosi Kesehatan Abad 21
Adapun dalam konferensi Internasional Promosi Kesehatan yang ke
empat di Jakarta ini menetapkan prioritas sebagi berikut :
1

Meningkatkan Tanggung Jawab Sosial dalam Kesehatan


Secara spesifik tanggung jawab sosial dalam kesehatan yang
perlu direalisasikan oleh setiap pemangku kepentingan atau
stakeholder kesehatan, termasuk sektor industri dan perdagangan
adalah sebagai berikut :
a Menghindari hal hal yang dapat merugikan kesehatan orang
b

lain (masyarakat).
Melindungi lingkungan dan menjamin terus dimanfaatkannya

sumber daya.
Membatasi produksi dan perdagangan barang barang yang
berbahaya seperti tembakau dan senjata, termasuk juga

membatasi praktik pemasarannya yang tidak sehat.


Menjaga keselamatan masyarakat, baik ditempat umum

maupun ditempat kerja.


Memasukkan dampak kesehatan sebagai bagian integral dari
kebijakan pembangunan.

Meningkatkan Investasi untuk Pembangunan Kesehatan


Program kesehatan adalah merupakan investasi

untuk

pengembangan sumber daya manusia. Oleh sebab itu kualitas

sumber daya manusia sangat ditentukan oleh kesehatan, di samping


pendidikan dan ekonomi. Selama ini investasi pemerintah untuk
pembangunan kesehatan yang nota bene invesatasi untuk
pembangunan sumber daya ini sangat rendah. Dari tahun ke tahun
semenjak orde breformasi ini, anggaran untuk kesehatan hanya antar
2,5% sampai dengan 4.0% saja dari APBN. Tinggi rendahnya
anggaran untuk kesehatan baik nasional maupun daerah, sangat
tergantung dari kebijakan pemerintah dan parlemen (DPR/DPRD).
Selain dari pada itu investasi pembangunan kesehatan juga
dapat diartikan memprioritaskan program program kesehatan untuk
kelompok kelompok strategis. Kelompok kelompok yang
memperoleh prioritas dan yang sebagai upaya meningkatkan
investasi untuk pembangunan kesehatan adalah wanita dan anak
anak.
3

Meningkatkan Kemitraan untuk Kesehatan


Penyelenggaraan pelayanan kesehatan,

pemberantasan

penyakit ,menular, peningkatan gizi masyarakat, pengadaan air


bersih dan sebagainya memerlukan kemitraan dengan sektor di luar
kesehatan baik pemerintah maupun

swasta. Kemitraan dengan

semua sektor perlu dibangun, dikembangakan, dan ditingkatkan


dalam rangka meningkatkan derajat kesehatan masyarakat.
4

Meningkatkan kemampuan perorangan dalam Memberdayakan


Masyarakat
Pemberdayaan masyarakat dibidang kesehatan, dimaksudkan
agar masyarakat mampu memelihara dan meningkatkan kesehatan
mereka sendiri. Sedangkan masyarakat unit terkecil adalah keluarga,
dan selajutnya keluarga ini terdiri dari individu -

individu atau

perorangan. Dimensi mampu berprilaku atau berupaya tetap sehat,


mencegah dari serangan penyakit, mencari pertolongan atau
pengobatan saran atau fasilitas kesehatan yang tepat, serta berupaya
kesehatannya lebih baik lagi. Untuk itu diperlukan pemberian
informasi tentang kesehatan melalui penyuluhan atau media, tetapi

juga kemampuan berusaha guna memperoleh sarana prasarana untuk


mewujudkan perilaku sehat.
Untuk mewujudkan kemampuan seperti tersebut di atas maka
Promosi Kesehatan harus dilaksanakan oleh dan dengan masyarakat,
bukannya untuk dan kepada masyarakat. Di samping itu, untuk
meningkatkan kemampuan masyarakat diperlukan juga pendidikan
praktis, latihan keterampilan, dan akses ke sumber daya. Sedangkan
untuk memberdayakan perorangan memerlukan akses yang lebih
konsisten dan terpercaya dalam proses pembuatan keputusan.
5

Mengembangkan Infrastruktur untuk Promosi Kesehatan


Untuk mengembangkan infrastruktur promosi kesehatan harus
dicari mekanisme pembiayaan baru baik lokal, nasional, regional
maupun internasional. Insentif da rangsangan serta upaya upaya
advokasi yang lain harus diciptakan untuk memperoleh dukungan
pemerintah,

swasta,

lembaga

swaday

masyarakat,

institusi

pendidikan dan sektor lain dalam program program promosi


kesehatan.
Berbagai tatanan kesehatan merupakan dasar kelembagaan
untuk mengembangkan infrastruktur yang diperlukan dalam promosi
kesehatan. Pelatihan dan praktik kepemimpinan lokal pada setiap
tatanan harus didorong untuk menunjang kegiatan promosi
kesehatan.

Dalam

menjalin

kerja

sama,

khususnya

untuk

mengembangkan infrastruktur Promosi Kesehatan ini, semua negara


peserta Konferensi Internasional Promosi Kesehatan di Jakarta ini
kedepan harus menyesuaikan diri dengan lingkungan politik, hukum,
pendidikan, sosial dan ekonomi masing masing negara yang
bersangkutan.
D Tindakan yang Perlu Diambil
Untuk mempercepat kemajuan promosi kesehatan seluruh dunia, para
peserta menyetujui pembentukan aliansi promosi kesehatan dunia, yang
bertujuan untuk menindaklanjuti berbagai prioritas kegiatan promosi
kesehatan yang dituangkan dalam deklarasi ini.
Prioritas aliansi ini diarahkan untuk :

Membangkitkan kesadaran tentang adanya perubahan determinan

kesehatan.
Mendukung pengembangan kerja sama dan jaringan untuk

3
4
5
6
7

pembangunan kesehatan.
Mobilisasi sumber daya bagi promosi kesehatan.
Mengakumulasi pelajaran dari pengalaman.
Meningkatkan pertukaran pengalaman.
Meningkatkan solidaritas dalam berbagai kegiatan.
Mendorong keterbukaan dan tanggung jawab sosial dalam promosi
kesehatan.

5.
Konferensi Internasional Promosi Kesehatan di Mexico City, Meksiko,
Tahun2000
MenjembataniKesenjanganPemerataan
Konferensi Internasional Promosi Kesehatan yang ke lima diselenggarakan di
KotaMeksiko (MexicoCity), Meksiko,padatanggal59Juni2000.Konferensiini
mengambiktema:Menjembatanikesenjanganpemerataanatau Bridgingtheequity
gap, dengandihadiri olehpeserta dari sekitar 100 negara, baikdari negara maju
maupunnegaraberkembang.Konferensiglobalkelimainiagakberbedadenganke
empat konferensi sebelumnya, karena konferensi melibatkan programprogram
kementerian,yangmemungkinkanparamenteridandelegasinyaberbagipengalaman
sertatantanganyangdihadapidalammempromosikankesehatandinegaramasing
masing. Para menteri dan delegasinya diundang untuk mengesahkan Pernyataan
KementrianMeksikotentangPromosikesehatan.Pernyataantersebutditandatangani
olehsekitar100negaradengantingkatkomitmenpolitikyangtinggi.Dibawahini
adalah butirbutir kesepakatan dan rencana gerakan (aksi) yang dihasilkan oleh
KonferensiMeksiko.
1

DariIdekeAksi(Tindakan)
KesepakatantingkatmenterisebagaihasilKonferensiPromosiKesehatandi
Kota Meksiko, dan merupakan upaya untuk mewujudkan ideide menjadi
tindakantindakan.Kesepakatanupayauntukmewujudkanideidetersebutsecara
lengkapadalahsebagaiberikut:

Menghargai bahwa pencapaian standar kesehatan setinggi mungkin


merupakan aset positif bagi kenyamanan hidup dan penting bagi
pertumbuhanpembangunansosialekonomidanpemerataan.

Menyadari bahwa promosi kesehatan dan pembangunan sosial


merupakankewajibandantanggungjawabpemerintahdanseluruhsektor
yangadadidalammasyarakat.

Mengakuibahwabeberapatahunterakhirini,melaluiupayayangserius
daripemerintahdanmasyarakattelahterjadiperbaikandankemajuandi
bidangpelayanankesehatan.

Menyadaribahwawalaupuntelahterjadipeningkatan,berbagaimasalah
kesehatan belum teratasi sehubungan dengan pembangunan sosial
ekonomi. Oleh karena itu hal ini bersifat urgent dan perlu cermati
dalammencapaikesetaraandidalampelayanankesehatan.

Perlu pula disimak bahwa pada saat yang sama, pertumbuhan dan
terjadinya penyakit infeksi baru telah mengurangi keberhasilan yang
dicapaidibidangkesehatan.

Menyadaripentingnyadeterminansosialekonomidanlingkunganbagi
kesehatan dan hal ini membutuhkan mekanisme kolaborasi yang kuat
untukmempromosikankesehatandiberbagaisektordandisetiaptatanan
masyarakat.

Sepakat bahwa promosi kesehatan harus menjadi komponen dasar


kebijakan dan kegiatan publik di setiap negara untuk mencapai
kesetaraandankesehatanyanglebihbaikuntuksemua.

Menunjukkanada bukti kuat bahwa strategi promosi kesehatan dalam


mempromosikankesehatancukupelektif.

Berdasarkanpernyataandiatas,makadiperlukanaksiataugerakansebagai
berikut:
1

Menempatkanpromosikesehatansebagaiprioritasutamabaikditingkat
lokal,regional,nasionalmaupunditingkatinternasional.

Mengambilperanutamadalampengembanganpartisipasiaktifdisetiap
sektorterkaitdandikalanganmasyarakatmadani,didalamimplementasi
gerakangerakan promosi kesehatan dengan memperkuat dan
memperluaskemitraandibidangkesehatan.

Memperkuat persiapan rencana kegiatan di kabupaten/kota di seluruh


dunia,biladibutuhkan.Rencanainiakanberbedasesuaidengankonteks
negara yang bersangkutan, namun akan mengikuti pedoman yang
disepakati,yakni:
a

Identifikasiskalaprioritasuntukmemperkuatkebijakanpublik
yang berwawasan kesehatan dan programprogram lain yang
dibutuhkan.

Dukungan riset dengan teknologi terbaru terhadap prioritas


pilihan.

Mobilisasi finansial dan sumber daya operasional untuk


membangunkapasitassumberdayamanusiadaninstitusiuntuk
pengembangan,implementasi,monitoring,danevaluasirencana
kegiatandikota/kabupaten.

Membangun dan memperkuat jaringan promosi kesehatan di tingkat


nasionaldaninternasional.

Melakukan advokasi terhadap lembagalembaga di dalam PBB yang


peduliakandampakkesehatanagarmenjadiagendamereka.

Memberikan informasi kepada Direktorat Jendral organisasi kesehatan


dunia(WHO)agardicantumkandalamlaporanBadanEksekutiftentang
perkembanganprogramprogramdiatas.

KesepakataniniditandatanganidiKotaMeksikopadatanggal5Juni2000
dalamBahasaArab,Cina,Inggris,Perancis,Rusia,Portugis,danSpanyol.
2

KerangkaKerja(RencanaAksi)TingkatNasional
KonferensikelimadiMeksikojugamengahasilkankerangkakerjarencana
aksi(planofaction)programpromosikesehatantingkatnasional:Menjembatani
kesenjangan dalam kesetaraan merupakan tantangan terbesar bagi promosi
kesehatan.Promosikesehatanmerupakansalahsatustrategiyangefektifuntuk
mengurangikesenjanganini.Untukmencapaikesehatanbagisemua,harusfokus
pada upaya peningkatan kondisi yang kondusif pada kelompokkelompok
marjinalditiaplapisanmasyarakat,baikdinegaranegaraberkembangmaupundi
negaramaju.
Secara umum, penjelasan tentang konferensi ini bertujuan untuk
pengembangansuatukerangkakerja(framework)perencanaankegiatanditingkat

kota/kabupaten untuk menindak lanjuti kesepakatan yang dihasilkan oleh


konferensiPromosiKesehatandiMeksiko.
Secarakhusus,kerangkainibertujuan:
1

Menempatkan kesehatan sebagai dasar hak asasi manusia serta sebagai


sumberuntukpembangunansosialekonomi.

Memobilisasi dana dan sumber daya teknik untuk membangun


kelangsungan hidup masyarakat, kapasitas manusia, dan institusi untuk
menentukandeterminankesehatanpokok.

Mengarahkan perhatian pada kesetaraan sosial dan kesetaraan gender di


setiap tingkat pemerintahan maupun berbagai sektor yang ada dalam
masyarakat.

Menunjang pengembangan pengetahuan dan pemahaman untuk


membangun potensi sumber daya manusia dan kapasitas
institusi/organisasi.

Meningkatkanpartisipasidanmemeliharalingkunganyangkondusifuntuk
memperkuatkohesiataukesatuanmasyarakat.

Mengintegrasikan program promosi kesehatan ke dalam agenda sistem


reformasipelayanankesehatan.

Prinsippencapaiankeberhasilan
Rencana aksi tersebut akan berhasil secara efektif bila memenuhi prinsip
prinsipantaralainsebagaiberikut:
1

Mempunyaisasarandantujuanyangjelas.

Perandantanggungjawabstakeholdersudahdiklarifikasidanditerima.

Mekanismeyangtransparandanakuntabilitas.

Strategiyangdikembangkantelahdipahami(komprehensif).

Perencanaanmeliputimekanismeuntukmonitoringdanevaluasi.
Pertimbanganpertimbangankuncidalammewujudkanrencanaaksitersebut

diatasjugadirumuskan,danrumusantersebutmencakup:
1

Partisipasi:
Publik,perorangan,dansektorsektoryangadadisetiaplapisanmasyarakat
akandirangsanguntukterlibataktifdalamtahappersiapanrencanaaksiyang
difasilitasiolehMenteriKesehatan.

Adaptabilitas:
Rencanaaksiharustanggapterhadapkebutuhanlokal.Setiapnegaraakan
mempersiapkan perencanaan berdasarkan kondisi lingkungan, tatanan,
program,daninvestasiyangtersediadinegaramasingmasing.

Feasibilitas:
Aktivitasyangdiajukanharusmemperhitungkanwaktuyangsesuaisehingga
memungkinkansumberdayayangada,dukunganekonomi,kebijakanlegal
dansosial,sertakapasitasyangtersediauntukmemperkuatkemitraandan
aliansi.

Terukur:
Evaluasiprosesdandampakharusdilakukan.

Inovasi:
Proses pengembangan rencana harus melibatkan pendekatan baru dalam
komunikasidandapatmerangsangtumbuhnyakegiatankreatifsertadialog.

Dukungandanfasilitas
Dukungan diperoleh terutama dengan menggunakan sumbersumber yang
tersediapadasetiapnegara,termasuksektornonkesehatan.Mitramitralainyang
dianggap relevan juga perlu dilibatkan, seperti WHO, UNESCO, organisasi
organisasi bilateral dan multilateral, akademisi, Pusat Promosi Kesehatan,
Yayasan Promosi Kesehatan Nasional, IUHPE, dan Lembaga Swadaya
Masyarakat lainnya, sektor swasta, kelompok asuransi sosial, koperasi dan
sebagainya.

Keluaran(outcomes)yangdiharapkan
Berdasarkan pernyataan hasil konferensi Promosi Kesehatan di Meksiko,
makalangkahlangkahdibawahiniperludiambil:
1

Memperkuat jaringan nasional, regional, dan internasional dalam rangka


promosikesehatan.

Melakukanadvokasitentangdampakkesehatandariagendamasingmasing.

Melaporkan secara periodik kepada panitia regional dan pertemuan


organisasikesehatanduniatentangkemajuanyangdihasilkanolehrencana
aksitersebut.

StrategiOperasional
1

Prosesperencanaan
a

Penilaiankebutuhan(needsassesment)meliputi:

Identifikasiskalaprioritasisuisukesehatanyangpenting.

Identifikasi asetaset yang ada, seperti kebijakan, legislasi,


sumberdayamanusia,dansumberdayaalamyangtersedia.

Identifikasi kapasitas sumber daya manusia dan infrastruktur


yangtersedia.

Proses identifikasi kebutuhan dan penentuan skala prioritas harus


melibatkananggotamasyarakatdansektorsektorpublikdanswastayang
relevan,yangmeliputi:
a

Tujuanyang jelasdanhasilyangdiharapkansesuaidenganwaktu
yangtersedia.

Dampak yang diharapkan dan indikator pencapaian harus


diidentifikasisecarajelas.

Kontribusinya terhadap pengembangan perencanaan nasional,


terutamadibidangkesehatanharusnyata.

Keterlibatan stakeholder dan kontributor kunci harus diarahkan


padatingkatyangtepat,mencakupanggotamasyarakat,LSM,sektor
swasta, akademisi, lembagalembaga agama, WHO, UNESCO,
UNICEF,sertapenyandanglainnya.

Menentukanskalaprioritas,tujuan,danhasilyangdiharapkan
Ketika skala prioritas telah tersusun, maka tujuan, dan hasil yang
diharapkan dapat ditentukan. Telaah sumbersumber dan aset yang
tersediamerupakansuatuyangpenting.Konsultasidankomunikasijuga
perluditingkatkan.

Pemilihanstrategidanintervensiyangpalingefektif
Upaya ini meliputi pemilihan dan pertimbangan arah gerakanyang
sesuaidengansituasiobjektif,subjekutama(targetsasaran),tujuanyang

diharapkan, bentuk dan mekanisme intervensi, teknik intervensi


(mekanismepenjenjangan),sertasettingtempatnya.Selanjutnyarencana
aksi yangtelahdibuat perludilakukanuji coba (pretest) metode dan
bahanbahanyangdigunakan.
2

Implementasi
Rencana aksi upaya promosi kesehatan yang efektif harus melibatkan
berbagaimacamkegiatansepertiberikutini:
a

Peningkatankesadaranpublikdanparapelakupolitikdiberbagailapisan,
seperti tingkat pemerintah pusat, provinsi, kabupaten dan kecamatan,
bahkanditingkatdesa.

Bagaimana pesanpesan promosi kesehatan dapat dikomunikasikan


secaraefektif.

Menawarkan atau mengusulkan kebijakan publik yang berwawasan


kesehatan.

Memperkuatgerakanmasyarakatdalamupayakesehatan.

Menciptakanlingkunganyangkondusifbagikesehatansertamerangsang
terciptanyagayahidupsehatdisetiaplapisanmasyarakat.

MonitoringdanEvaluasi
Jika dilakukan secara berkala dapat memberikan informasi atau
peringatansecaradiniterhadapmasalahataukendalayangdihadapi.Ukuran
hasil dari upaya promosi kesehatan dapat mencakup beberapa indikator,
antaralainsepertidibawahini:
a

Ukuran tentang pemahaman kesehatan, yang meliputi tingkat


pengetahuan,sikap,motivasi,tendensiperilaku,keterampilanpersonal,
dankepercayaandiri.

Ukuran pengaruh dan gerakan masyarakat, yang meliputi unsur


partisipasi masyarakat, pemberdayaan masyarakat, norma sosial, dan
opinipublik.

Ukuranyangmencakupunsurkebijakanpublikberwawasankesehatan,
yangmeliputipernyataanpolitik,legislasi,regulasi,alokasisumberdaya,
unsurbudaya,danperilaku.

Ukurankondisikesehatandangayahidupsehat(healthylifestyle),yang
meliputi unsurunsur penggunaan tembakau, pilihan dan kesempatan
untuk memperoleh makanan makanan sehat, aktivitas fisik, alkohol,
narkoba, rasio tentang faktorfaktor yang protektif dan berisiko pada
lingkunganfisikdanlingkungansosialbudaya.

Ukuran efektivitas pelayanan kesehatan, yang meliputi penyediaan


pelayanan pencegahan, akses ke tempattempat pelayanan kesehatan,
sertafaktorfaktor sosial budaya yang berhubungandengan pelayanan
kesehatan.

Ukuran lingkungan sehat, yang meliputi membatasi akses dalam


penggunaan tembakau, alkohol, obatobat terlarang, penyediaan
lingkunganpositifbagianakanakdanoranglanjutusia,kebebasandari
kekerasandariberbagaibentukpenyalahgunaan.

Ukuran dampak sosial, yang meliputi kualitas hidup, kemadirian,


jaringan dukungan sosial, diskriminasi positif, dan pemerataan dan
keadilan.

Ukurandampakkesehatan,yangmeliputipenurunantingkatkesakitan,
kematian dan ketidak mampuan, kompetensi psikososial, serta
keterampilandiri.

Ukuran pengembangan kapasitas (capacity building), yang meliputi


ukurankelangsunganpartisipasimasyarakatdanpemberdayaan.

MekanismeAksi(MenchanismforAction)
Lima Mekanisme aksi pelengkap yang di usulkan dalam konferensi ini adalah
sebagaiberikut:
1 PengembanganKebijakanPublikyangBerwawasanKesehatan
Meliputi identifikasi faktorfaktor perlindungan lingkungan fisik dan psikososial
yang berkontribusi terhadap perbaikan determinan kesehatan. Determinan ini
mencakup:
1

Kesempatankerja,

Keamananfinansial,

Perumahanyangmemadai,

Aksesterhadappendidikanyangberkualitas,

Makananyangamandansehat,

Aksesterhadapinformasi,

Tersedianyatransportasiyangaman,

Ketersediaanfasilitasrekreasidanaktivitasfisik,

Kesempatanuntukmengembangkanketerampilandiri.

2 MenciptakanLingkunganyangMendukung
Promosi kesehatan memberikan beberapa inisiatif untuk memberdayakan
masyarakatdanmenciptakankemitraandiantaraotoritaslokalterpilih,perwakilan
darisektoryangberbeda,pemimpinmasyarakatdanswastauntukmengembangkan
rencanaaksisertamenciptakanlingkunganyangsehatdankondusif.
3

ReorientasiPelayananKesehatan
Komponenyangpalingumumadalah:

Pengukuranupayapreventif,

Strategipertumbuhan(pembangunan)kesehatan,

Keterlibatanlintassektor,

Partisipasimasyarakat,

Peningkatankesetaraan,dan

Memperluasdesentralisasi.

MemperkuatGerakanMasyarakat
Pemberdayaan memberikan suatu gagasan untuk melakukan kendali secara
personaldankemampuanuntukmelakukanperubahankondisisosialdankesehatan
melalui mobilisasi kolektif dan menghilangkan rasa ketidakberdayaan dan
ketidakmampuan.

PengembanganKeterampilanIndividu
Perbedaanantarapemberdayaanperorangandengankelompoklebihpadatatanan
teoriketimbangrealitas.Pemahammasalahmengenaikemampuanindividudalam
menghadapi masalah yang menimpanya merupakan dasar dari gerakan kolektif
untukterjadinyasuatuperubahansosial.Didalamjaringanpendukungsosial,setiap
individu harus menjaga identitas sosialnya ketika menerima materi pendukung,
pelayanan,informasi,dankontaksosialyangbaru.

Limamekanismeaksipromosikesehataninimerupakanpelengkap.Pencapaian
tujuantujuanpromosikesehatantergantungpadaimplementasistrategiyangtepat
didalamlimaareaini.

Konferensi Internasional Promosi Kesehatan di Bangkok, Thailand


tahun 2005
A. Promosi Kesehatan dalam Globalisasi
Konferensi Internasional Promosi Kesehatan yang ke enam
dilaksanakan di Bangkok, Thaialnd, tanggal 7 11 Agustus 2005.
Konferensi ini diikuti oleh perwakilan peserta dari sekitar 90 negara,
dengan tema : Promosi Kesehatan dlam Dunia yang Mengglobal atau
Health Promotion in A Globalized World.
Kemitraan dalam Konteks Global
Tujuan dihasilkannya Piagam Bangkok adalah untuk menegaskan
bahwa kemitraan adaalah strategi yang sangat penting untuk
meningkatkan kesehatan, keseteraan, dan keadilan. , di tengah arus
pembangunan nasional dan global. Promosi kesehatan terbukti dpat
menurunkan

infeksi

baru

HIV/AIDS

di

Brazil,

Thailand,

meningkatkan peran masyarakat Singapura dalam berolahraga dan


menurunkan

kejadian

diare

pada

kelompok

miskin

melalui

peningkatan praktik cuci tangan.


B. Penegasan Kembali Peran Promosi Kesehatan
Dalam konferensi dinyatakan :
- PBB mengakui bahwa kesehatan adalah hak dasar setiap manusia
-

yang harus diperoleh tanpa diskriminasi.


Promkes dilakukan berdasarkan pemenuhan Hak asasi manusia
(HAM) serta mencakup berbagai upaya peningkatan kualitas hidup,
serta mencakup pula upaya meningkatkan kesehatan mental dan

spiritualnya.
Promkes adalah proses membantu masyarakat untuk meningkatkan
kontrol atas determinan kesehatannya.

C. Kebijakan Koherensi
Berbagai problematika yang menimpa bangsa bangsa menuntut
adanya kebijakan penanggulanagan di tingkat global, yang harun
melibatkan pertalian (koherensi) di tingkat pemerintahan setiap negara,
badan badan organisasib dunia, serta organisasi oraganisasi masyarakat
termasuk kalangan swasta.

Tindakan yang perlu dilakukan untuk meningkatkan kemajuan dalam


kesehatan, yaitu :
1. Advokasi untuk kesehatan dilakukan berdasarkan pada hak asasi
manusia dan solidaritas.
2. Investasi dalam kebijakan,

tindakan

dan

infrastruktur

yang

berkelanjutan untuk mengonterol determinan kesehatan.


3. Membangun kapasitas untuk pengembangan kebijkan, kepemimpinan,
praktik promosi kesehatan, alih pengetahuan, riset dan paham
kesehatan.
4. Mengatur dan membuat perundangan untuk menjamin perlindungan
tingkat tinggi atas bahaya dan memungkinkan kesempata yang sama
bagi semua orang dalam kesehatan dan kesejahteraan.
5. Bermitra dan membangun aliansi dengan berbagai kalangan publik,
swasta, organisasi nonpemerintah dan internasional serta masyarakat
sipil untuk menciptakan tindakan yang berkelanjutan.
D. Komitmen untuk Kesehatan bagi Semua
Beberapa komitmen untuk kesehatan bagi semua, yaitu :
1. Menjadikan Promosi Kesehatan sebagai Pusat Agenda Pembangunan
Global
2. Membuat

Promosi

Kesehatan

Tanggung

Jawab

Semua

Lini

Pemerintah.
3. Menjadikan Promosi Kesehatan untuk Pemberdayaan Masyarakat.
E. Promosi Kesehatan dan Praktik Korporasi
Sektor korporasi berdampak langsung pada kesehatan masyarakat dan
pada faktor faktor penentu kesehatan melalui pengaruhnya pada :
1. Pengaturan tingkat lokal,
2. Budaya berskala nasional,
3. Lingkungan,
4. Distribusi kekayaan,
7. Konferensi Internasional Promosi Kesehatan di Nairobi, Kenya tahun
2009
A Meningkatkan Kesehatan dan Pembangunan
Konferensi Internasional Promosi Kesehatan yang ke 7 di Nairobi,Kenya
tanggal 26-30 Oktober mengambil tema Mempromosikan kesehatan dan
pembangunan: Menutup kesenjangan Implementasi (promoting health and
development :closing the implementation gap). Tema ini berangkat dari kenyataan
bahwa pembangunan kesehatan dimanapun saat ini menghadapi tantangan. Krisis

moneter yang terjadi beberapa tahun yang lalu masih menghantui pembangunan
ekonomi nasional pada umumnya, dan lebih khusus lagi bagi pembangunan
kesehatan. Konferensi yang dihadiri oleh perwakilan-perwakilan dari hampir 100
negara ini akhirnya menghasilkan kesepakatan yang dituangkan dalam
kesepakatan Nairobi (Nairobi Statement).
B Konferensi Global
Konferensi Nairobi menunjukkan konferensi yang lebih esensial dan suatu
pendekatan yang efektif. Pelayanan kesehatan Primer ( Primary Health Care)
sebagaiman dinyatakan oleh badan eksekutif WHO, sebagai berikut:
1

Mencapai

persetujuan

untuk

pencapaian

pembngunan

kesehatan

Internasional.
2

Mengajukan pembahasan tentang kegawatdaruratan penyakit-penyakit


menular,trauma,gangguan mental,kondisi-kondisi yang menyebabkan
terjadinya epidemi di negara-negara miskin.

Menangani isu ketidaksetaraan atau ketidakadilan kesehatan,gender,kelas


sosial, tingkat pendapatan,etnis,pendidikan,pekerjaan, dan lain-lain masih
di masyarakat terutama di negara berkembang.

C Strategi dan Aksi


Dalam

konferensi

Nairobi,

dihasilkan

strategi

dan

aksi

yang

dikelompokkan menjadi 5 subtema, yaitu:


1

Membngun kapasitas promosi kesehatan (building capacity for


health promotion)

Penguatan sistem kesehatan (strengtenig health system)

Kemitraan dan kerja sama lintas sektor (Phatership and


intersektoral action)

Pemberdayaan masyarakat (community empowertment)

Sehat dan perilaku sehat (health literacy and health behavior).

D. Aksi Bersama

Pada saat ini negara berkembang dan negara maju dihadapkan pada
penyebaran penyakit yang seharusnya dapat dicegah,dimana penyakit tersebut
menjadi ancaman dan memperlemah pembangunan perekonomian di masa
mendatang.
Lima tanggung jawab penting bagi pemerintah stake holder,yaitu:
1

Memperkuat kepemimpinan dan suber daya manusia promosi


kesehatan.

Mengutamakan promosi kesehatan dalam pembangunan.

Memberdayakan masyarakat dan individu.

Meningkatkan proses partisipasi masyarakat.

Mengembangkan dan memanfaatkan teknologi dan pengetahuan.

8. Konferensi Internasional Promosi Kesehatan di Helsinki, Finlandia


tahun 2013
Dengan tema : Membangun warisan kita, mencari untuk masa depan kita
Konferensi Internasional Promosi Kesehatan ke-8 diselenggarakan di
Helsinki, Finlandia pada tanggal 10-14 Juni 2013. Pertemuan tersebut dibangun
berdasarkan warisan yang kaya ide, tindakan dan bukti awalnya yang terinspirasi
oleh Deklarasi Alma Ata pada Pelayanan Kesehatan Primer (1978) dan Piagam
Ottawa untuk Promosi Kesehatan (1986). Ini merupakan aksi lintas sektoral dan
kebijakan publik yang sehat sebagai elemen sentral untuk promosi kesehatan,
pencapaian kesetaraan kesehatan, dan realisasi kesehatan sebagai hak asasi
manusia. Selanjutnya WHO sebagai badan konferensi promosi kesehatan global
menetapkan prinsip dasar untuk tindakan promosi kesehatan. Prinsip-prinsip ini
telah diperkuat di Rio Deklarasi 2011 Politik Sosial Penentu Kesehatan, Deklarasi
2011 Politik Rapat tingkat tinggi PBB Majelis Umum tentang Pencegahan dan
Pengendalian Penyakit menular, dan Rio + 20 dokumen hasil 2012 ( Masa Depan
Kami Ingin). Hal juga tercermin dari berbagai program WHO, strategi dan
resolusi, dan berkontribusi pada perumusan tujuan pembangunan pasca-2015.
9. Konferensi Internasional Promosi Kesehatan di Shanghai, China
tahun 2014

Baru-baru ini Konferensi Promosi Kesehatan Global ke 9 diadakan di


Shanghai International Convention Center pada tanggal 21-25, 2016.
Tahun 2016 akan menandai ulang tahun ke-30 dari Konferensi Promosi
Kesehatan Global sejak diadakan

pertama kalinya, dan konferensi di China

memegang peranan penting. Hal ini tidak hanya menunjukkan kepada penduduk
China, pengalaman berharga dan kemajuan luar biasa di bidang pembangunan
kesehatan dan promosi kesehatan, yang akan memperkuat posisi dan peran
kesehatan dalam membantu mencapai tujuan pembangunan berkelanjutan setelah
2015, tetapi juga mempromosikan pengembangan teori dan praktek pada promosi
kesehatan, memberikan kontribusi untuk hidup sehat dari semua bangsa di dunia.
Konferensi Promosi Kesehatan Global adalah konferensi antar
pemerintah tingkat tinggi yang diprakarsai oleh Organisasi Kesehatan Dunia
(WHO) untuk promosi kesehatan, memberikan pedoman yang penting dalam
kegiatan promosi kesehatan di seluruh dunia. Konferensi Promosi Kesehatan
Dunia

ke-9 yang akan diadakan di Shanghai pada musim gugur 2016 akan

diselenggarakan bersama China National Health & Komisi Keluarga Berencana,


WHO dan diselenggarakan oleh pemerintah kota Shanghai. Diharapkan bahwa
sekitar 750 orang akan menghadiri konferensi, termasuk menteri dan pejabat
tinggi dari negara-negara anggota WHO, perwakilan organisasi internasional,
pakar internasional pejabat pemerintah.

BAB III
PENUTUP
3.1 Kesimpulan
Deklarasi Alma Ata tahun 1978 merupakan bentuk kesepakatan bersama
antara 140 negara (termasuk Indonesia), adalah merupakan hasil Konferensi
Internasional Pelayanan Kesehatan Primer (Primary Health Care) di Kota Alma
Ata, Kazakhstan (sebelumnya merupakan bagian Uni Soviet). Konferensi
Internasional Promosi Kesehatan yang pertama dilaksanakan di Ottawa, Kanada
yang berlangsung tanggal 17-21 November 1986. Konferensi Promosi Kesehatan
yang pertama ini mengambil tema Menuju Kesehatan Masyarakat Baru (The
Move Towards a New Public Health).
Konferensi Internasional Promosi Kesehatan ke dua dilaksanakan di
Adelaide, Australia pada tanggal 5-9 April 1988. Tema dari konferensi ke dua
adalah membangun kebijakan publik yang berwawasan kesehatan, merupakan

strategi promosi kesehatan yang pertama dari Ottawa Charter. Konferensi


internasional promosi kesehatan yang ketiga, dilaksanakan di Sundsvall, Swedia,
tanggal 9-15 Juni 1991. Tema konferensi yang ketiga ini adalah Menciptakan
lingkungan yang mendukung kesehatan atau Supportive Environment for
Health.
Konferensi Jakarta diselenggarakan pada tanggal 21 25 Juli 1997,
dengan mengambil tema : Pemeran Baru pada Era Baru atau New Player for a
New Era. Konferensi Internasional Promosi Kesehatan yang ke enam
dilaksanakan di Bangkok, Thaialnd, tanggal 7 11 Agustus 2005. Konferensi
Internasional Promosi Kesehatan yang ke 7 di Nairobi,Kenya tanggal 26-30
Oktober mengambil tema Mempromosikan kesehatan dan pembangunan:
Menutup kesenjangan Implementasi (promoting health and development :closing
the implementation gap).
Konferensi Internasional Promosi Kesehatan ke-8 diselenggarakan di
Helsinki, Finlandia pada tanggal 10-14 Juni 2013. Baru-baru ini Konferensi
Promosi Kesehatan Global ke 9 diadakan di Shanghai International Convention
Center pada tanggal 21-25, 2016.

DAFTAR PUSTAKA
Hartono,

Bambang.2010.Promosi

Kesehatan

di

Puskesmas

&

Rumah

Sakit.Jakarta: Rineka Cipta.


Notoatmodjo, Soekidjo.,dkk.2013.Promosi Kesehatan Global.Jakarta: Rineka
Cipta.
Notoatmodjo, Soekidjo.2010.Promosi Kesehatan Teori dan Aplikasinya.Jakarta:
Rineka Cipta.
Supiyati dan Eny Retna Ambarwati.2012.Promosi Kesehatan Dalam Perspektif
Ilmu Kebidanan.Yogyakarta: Pustaka Rihama.
Departemen

Kesehatan

Republik

Indonesia.2008.Promosi

Sekolah.Jakarta: Fakultas Kesehatan Masyarakat UI.

Kesehatan

di