Anda di halaman 1dari 282

MANAJEMENPEMERINTAHANPUSAT

(PENGANGGARANDANREALISASIANGGARAN)

PUSATPENDIDIKANDANPELATIHANPENGAWASAN
BADANPENGAWASANKEUANGANDANPEMBANGUNAN

2014

ManajemenPemerintahanPusat

DikeluarkanolehPusatPendidikandanPelatihanPengawasanBPKP
dalamrangkaDiklatFungsionalAuditorDiklatPembentukanAuditorTerampildanAhli


EdisiPertama : 2014

Penyusun
: ImamYunarto,Ak.M.Acc.
Narasumber
: Suhartanto,Ak.,M.M.
Pereviu
: PriyonoDwiNugroho,Ak.,M.Si.,M.M.
Penyunting
: SiscaYulindrasari,Ak.,M.Si.
PenataLetak
: DidikHartadi,S.E.

PusdiklatwasBPKP
Jl.BeringinII,Pandansari,Ciawi,Bogor16720
Telp.(0251)82490018249003
Fax.(0251)82489868248987
Email
:pusdiklat@bpkp.go.id
Website
:http://pusdiklatwas.bpkp.go.id
eLearning :http://lms.bpkp.go.id

Dilarangkerasmengutip,menjiplak,ataumenggandakansebagianatau
seluruhisimodulini,sertamemperjualbelikantanpaizintertulisdari
PusatPendidikandanPelatihanPengawasanBPKP.

KataPengantar

Peran dan fungsi aparat pengawasan intern pemerintah (APIP) dalam rangka membantu
manajemen untuk mencapai tujuan organisasi dilaksanakan melalui pemberian jaminan
(assurance activities) dan layanan konsultansi (consulting activities) sesuai standar, sehingga
memberikan perbaikan efisiensi dan efektivitas atas tata kelola, manajemen risiko, dan
pengendalianinternorganisasi.Selainitu,PeraturanPemerintahNomor60Tahun2008tentang
Sistem Pengendalian Intern Pemerintah mengatur bahwa pelaksanaan audit intern di
lingkungan instansi pemerintah dilaksanakan oleh pejabat yang mempunyai tugas
melaksanakanpengawasanyangtelahmemenuhisyaratkompetensikeahliansebagaiauditor.
Hal tersebut selaras dengan komitmen pemerintah untuk mewujudkan pemerintahan yang
transparan dan akuntabel serta bebas korupsi, kolusi, dan nepotisme pada berbagai aspek
pelaksanaan tugas umum pemerintahan dan pembangunan yang dituangkan dalam Undang
UndangNo.28Tahun1999tentangPenyelenggaraanNegarayangBersihdanBebasdariKKN.
Untuk menjaga tingkat profesionalisme aparat pengawasan, salah satu medianya adalah
pendidikan dan pelatihan (diklat) sertifikasi auditor yang bertujuan untuk meningkatkan
pengetahuan, keterampilan, dan perubahan sikap/perilaku auditor pada tingkat kompetensi
tertentu sesuai dengan perannya sesuai dengan keputusan bersama Kepala Pusat Pembinaan
Jabatan Fungsional Auditor dan Kepala Pusat Pendidikan dan Pelatihan Pengawasan Badan
Pengawasan Keuangan dan Pembangunan Nomor KEP82/JF/1/2014 dan Nomor KEP
168/DL/2/2014tentangKurikulumPendidikandanPelatihanFungsionalAuditor.
Guna mencapai tujuan di atas, sarana diklat berupa modul dan bahan ajar perlu disajikan
dengansebaikmungkin.Evaluasiterhadapmodulperludilakukansecaraterusmenerusuntuk
menilai relevansi substansi modul terhadap perubahan lingkungan yang terjadi. Modul ini
ditujukan untuk memutakhirkan substansi modul agar sesuai dengan perkembangan profesi
auditor, dan dapat menjadi referensi yang lebih berguna bagi para peserta diklat sertifikasi
auditor.
Akhirnya kami mengucapkan terima kasih kepada semua pihak yang telah memberikan
kontribusiatasterwujudnyamodulini.

Ciawi,30April2014
KepalaPusdiklatPengawasanBPKP

Nurdin,Ak.,M.B.A.

Manajemen Pemerintahan Pusat

ii

2014 |Pusdiklatwas BPKP

DaftarIsi

KataPengantar..........................................................................................................................i
DaftarIsi ..............................................................................................................................iii
DaftarGambar.........................................................................................................................v
DaftarTabel............................................................................................................................vii
BabI

PENDAHULUAN......................................................................................................1
A. LatarBelakang......................................................................................................1
B. KompetensiDasar................................................................................................2
C. IndikatorKeberhasilan.........................................................................................2
D. SistematikaModul...............................................................................................2
E. MetodePembelajaran.........................................................................................4

BabII

KONSEPSIGOODGOVERNANCEDANPENGELOLAANKEUANGANNEGARA............7
A. KonsepsiManajemenPemerintahanPusat.........................................................7
B. KonsepsiGoodGovernancedanAkuntabilitas..................................................12
C. KonsepsiKeuanganNegaradanPengelolaannya..............................................21

BabIII

PERENCANAANDANPENGANGGARAN................................................................41
A. Perencanaan.......................................................................................................42
B. Penganggaran.....................................................................................................49

BabIV

PENGORGANISASIAN............................................................................................65
A. PengorganisasianPelaksanaanTugasdanFungsi..............................................65
B. PengorganisasianPengelolaanKeuangan..........................................................77
C. PengorganisasianWaktuKegiatan.....................................................................80

BabV

PELAKSANAANAPBN............................................................................................83
A. Persiapan............................................................................................................84
B. MekanismePelaksanaanPendapatan...............................................................98
C. MekanismePelaksanaanBelanja.....................................................................118
D. MekanismePemotongan/PemungutanPajakPajakNegaraoleh
Bendahara........................................................................................................168
E. ProsesPembiayaan..........................................................................................186
F. PengelolaanAsetdanUtang............................................................................199
G. KetentuanPidana,SanksiAdministrasi,danGantiRugi..................................209

BabVI

PELAPORAN PENGELOLAAN DAN PERTANGGUNGJAWABAN KEUANGAN


NEGARA.............................................................................................................217
A. PelaporanKinerja.............................................................................................217
B. PelaporanKeuangan........................................................................................226
C. PelaporanLainnya............................................................................................247

Manajemen Pemerintahan Pusat

iii


BabVII

AUDITINTERNAL.................................................................................................249
A. KonsepsiAuditInternal...................................................................................249
B. DampakdariAuditInternalTerhadapTataKelolaSektorPublik....................252

BabVIII

PEMERIKSAANPENGELOLAANDANTANGGUNGJAWABKEUANGANNEGARA..255
A. LingkupPemeriksaan.......................................................................................255
B. PelaksanaanPemeriksaan...............................................................................259
C. HasilPemeriksaanDanTindakLanjut..............................................................261

DaftarPustaka.......................................................................................................................263

iv

2014 |Pusdiklatwas BPKP

DaftarGambar

Gambar1.1

KeterkaitanIndikatorKeberhasilandanSistematikaModul..............................4

Gambar2.1

SistemAdministrasiKeuanganNegara..............................................................11

Gambar2.2

PenguasaandanPenyerahanKekuasaanPengelolaanKeuanganNegara........30

Gambar3.1

SiklusAPBN........................................................................................................41

Gambar3.2

KeterkaitanPerencanaandanPenganggaran....................................................51

Gambar3.3

ProsesPenyusunanAPBN..................................................................................55

Gambar3.4

KerangkaWaktuSiklusAPBN.............................................................................59

Gambar4.1

StrukturKelembagaanNegara...........................................................................65

Gambar4.2

Hubungan Lembaga Kepresidenan, DPR, dan BPK dalam Pengelolaan


KeuanganNegara...............................................................................................77

Gambar4.3

LingkupKewenanganKemneterianTeknisdanKementerianKeuangan..........78

Gambar4.4

StrukturOrganisasiPengelolaKeuanganNegara..............................................79

Gambar5.1

SiklusPengelolaanKeuanganNegaraTingkatK/L.............................................83

Gambar5.2

MekanismePembayaran..................................................................................119

Gambar5.3

MekanismePenyelesaianTagihan/PengeluaranNegara................................120

Gambar5.4

JenisjenisPembuatanKomitmen....................................................................121

Gambar5.5

PrinsipPengadaanBarang/Jasa.......................................................................152

Gambar5.6

CaraPengadaanBarang/JasaPemerintah.......................................................158

Gambar5.7

PPhPasal21/26yangWajibDipotongolehBendahara..................................173

Gambar5.8

TarifdanDasarPemotonganPPhPasal23......................................................181

Gambar5.9

PengertianPPNdanPPnBM.............................................................................183

Gambar5.10

BaganAsetPemerintah....................................................................................200

Gambar5.11

LingkupPengelolaanBMN...............................................................................207

Gambar6.1

HubunganKontrakPrinsipalAgen:Solusi.....................................................227

Gambar6.2

PaketLaporanKeuangandanKinerja..............................................................237

Gambar8.1

HierarkiKriteriadanIndikatorKinerja.............................................................258

Manajemen Pemerintahan Pusat

vi

2014 |Pusdiklatwas BPKP

DaftarTabel

Tabel2.1

MekanismeAkuntabilitasPemerintah....................................................................19

Tabel3.1

CakupanSPPN.........................................................................................................43

Tabel3.2

APBNTahun2014..................................................................................................58

Tabel4.1

VariasiPejabatyangBisaDitetapkanSebagaiPejabatPengelolanKeuangan.......80

Tabel4.2

FormatJadwalKegiatan..........................................................................................81

Tabel5.1

KewenanganPenyelesaianPiutangBermasalah/PenghapusanPiutang.............202

Tabel5.2

KewenanganPenghapusan/PemindahtangananBMN.........................................208

Tabel6.1

FormulirPengukuranKinerjaTingkatKementerian/Lembaga............................222

Tabel6.2

FormulirPengukuranKinerjaTingkatUnitOrganisasiEselonI/SatkerK/l.........223

Tabel6.3

OutputLaporanKeuanganSAPP...........................................................................241

Tabel6.4

Formulir Laporan Pelaksanaan Program Prioritas Pembangunan Nasional


K/L/I.......................................................................................................................247

Tabel6.5

FormLapRealisasiRenaksiPencegahandanPemberantasanKorupsiK/L/I....248

Tabel7.1

PerbandinganJasaAssurancedanJasaPemastian..............................................249

Tabel8.1

Ketentuan Pidana Terkait Pemeriksaan Pengelolaan dan Tanggung Jawab


KeuanganNegara..................................................................................................260

Manajemen Pemerintahan Pusat

vii

viii

2014 |Pusdiklatwas BPKP

BabI
PENDAHULUAN

A.

LATARBELAKANG

Dalam sejarah, pembentukan negara senantiasa akan disertai dengan penetapan tujuan
bernegara tidak terkecuali NKRI. Undangundang Dasar 1945 dengan jelas telah
mengamanatkantujuannegaraRepubIikIndonesia,yaitu:melindungisegenapbangsaIndonesia
dan seluruh tumpah darah Indonesia, memajukan kesejahteraan umum, mencerdaskan
kehidupan bangsa, dan ikut melaksanakan ketertiban dunia yang berdasarkan kemerdekaan,
perdamaiandankeadilansosial.Tujuanbernegaratersebutmenjadiacuanbagipenyelenggara
negara/pemerintahdalammenjalanakantugasdanfungsinyadalampembangunan.
Sebagai suatu proses, pelaksanaan tugas dan fungsi pembangunan oleh pemerintah tidak
terlepas dari aspek manajemen yaitu perencanaan (planning), pengorganisasian (organizing),
penggerakan(actuating),danpengawasan(controlling).Aspekmanajementersebutdijabarkan
dalam berbagai peraturan perundangan dalam sistem administrasi untuk mendukung
pencapaiantujuanbernegaradiatas.
Dalammanajemenpemerintahan,pelaksanaansuatutugasdanfungsisenantiasadiikutidengan
pendanaannya atau dikenal dengan prinsip money follows function, di mana pengalokasian
anggaranuntukmendanaisuatukegiatandidasarkanpadatugasdanfungsidarimasingmasing
unitorganisasisesuaidenganamanatundangundang.Dengandemikianpemahamanterhadap
proses manajemen pemerintahan selalu akan beriringan antara aspek kinerja yang menjadi
sasaranpembangunandenganaspekkeuangansebagaipendukungnya.
Sebagai bagian dari organisasi pemerintahan, Aparat Pengawasan Intern Pemerintah (APIP)
berperanmengawalpelaksanaanmanajemenpemerintahanagarmemenuhikarakteristikgood
governance, yaitu transparan, akuntabel, adil, wajar, demokratis, partisipatif, dan responsif.
Untukdapatmelaksanakantugastersebut,APIPdilingkunganpemerintahpusatharusmemiliki
kompetensi yang memadai tentang manajemen pemerintahan. Dengan kompetensi tersebut
diharapkan APIP dapat melaksanakan tugas dengan lebih baik dan hasil pengawasannya bisa
lebih terarah serta dapat memberi manfaat bagi manajemen dalam rangka meningkatkan
kualitaspelaksanaanmanajemenpemerintahan.

Manajemen Pemerintahan Pusat


Modul Manajemen Pemerintahan II ini diberikan pada Diklat Sertifikasi JFA tingkat
PembentukanAuditorAhliselama50jampelatihan.

B.

KOMPETENSIDASAR

Setelah mempelajari modul ini peserta diklat diharapkan mampu mengidentifikasi titiktitik
kritispadapelaksanaantatakelolasektorpubliksesuaiketentuanyangberlaku.

C.

INDIKATORKEBERHASILAN

Setelahmengikutiprosespembelajaranmodulini,pesertadiklatdiharapkan:
1.

Memilikipengetahuanmengenaiprinsipprinsipakuntabilitassektorpublik(1.16)

2.

Memilikipengetahuanmengenaiprinsipprinsippengukurankinerja(1.17)

3.

Memilikipengetahuanmengenaisistemakuntansikeuanganpemerintahpusat(6.5)

4.

Memiliki pengetahuan mengenai kerangka kerja keuangan pemerintah pusat, seperti


prosespenganggaran,prosespengeluaran,prosesreviukeuangan,manajemenkas,strategi
investasi,dll.(6.3)

5.

Memiliki pengetahuan mengenai prinsipprinsip pembiayaan, pengelolaan keuangan


organisasidanpelaporannya(1.18)

6.

Memilikipengetahuanmengenaidampakauditinternalterhadaptatakelolasektorpublik
(1.6)

7.

D.

Mampumengidentifikasisecarakritiselemenelementatakelolaorganisasi(1.19)

SISTEMATIKAMODUL

Modul ini menguraikan manajemen pemerintahan dalam pelaksanaan tugas dan fungsi
pembangunan untuk mewujudkan tujuan bernegara. Pembahasan dalam modul ini mengikuti
fungsi manajemen yaitu perencanaan (planning), pengorganisasian (organizing), penggerakan
(actuating), dan pengawasan (controlling). Pada setiap fungsi manajemen yang dibahas
dikaitkan mekanisme perencanaan, pelaksanaan, dan pertanggungjawaban pada aspek kinerja
maupun keuangannya. Topik yang dibahas mencakup perencanaan dan penganggaran,
pengorganisasian, pelaksanaan, pengendalian, dan pertanggungjawaban, serta pemeriksaan
pertanggungjawabanpelaksanaananggaran.

2014 |Pusdiklatwas BPKP


Materidalammoduliniterdiridaridelapanbab,yaitu:
Babl

Pendahuluan
Bab ini menguraikan latar belakang manajemen pemerintah pusat, kompetensi
dasar,indikatorkeberhasilan,sistematikamodul,danmetodepembelajaran.

BabII

KonsepsiGoodGovernancedanPengelolaanKeuanganNegara
Bab ini menguraikan konsepsi manajemen pemerintahan pusat, good governance
danakuntabiltas,sertakeuangannegaradanpengelolaannya.

Bablll

PerencanaandanPenganggaran
Babinimenguraikanmekanismeperencanaandanpenganggaran.

BabIV

Pengorganisasian
Bab ini akan menguraikan pengorganisasian pelaksanaan tugas dan fungsi, pengelolaan
keuangan,danwaktukegiatan.

BabV

PelaksanaanAPBN
Bab ini menguraikan pelaksanaan APBN yang meliputi persiapan, mekanisme
pelaksanaan pendapatan, belanja, dan pembiayaan, serta pengelolaan aset dan
utang,sertaketentuanmengenaipidana,sanksiadministrasi,dangantirugi.

BabVI

PelaporanPengelolaandanPertanggungjawabanKeuanganNegara
Babinimenguraikanpelaporankinerja,pelaporankeuangan,danpelaporanlainnya.

BabVII

AuditInternal
Bab ini menguraikan konsepsi audit internal sebagai bentuk pengendalian serta
dampaknyaterhadaptatakelolasektorpublik.

BabVIII

PemeriksaanatasPengelolaandanTanggungJawabKeuanganNegara
Bab ini akan menguraikan pemeriksaan atas pengelolaan dan tanggung jawab
keuangan negara yang mencakup lingkup pemeriksaan, pelaksanaan pemeriksaan,
sertahasilpemeriksaandantindaklanjut.

Manajemen Pemerintahan Pusat


Gambar1.1KeterkaitanIndikatorKeberhasilandanSistematikaModul

E.

METODEPEMBELAJARAN

Metodepemelajaranyangdigunakanuntukmencapaitujuanpembelajaranadalah:
1.

Ceramah
Widyaiswara/instruktur menjelaskan materi manajemen pemerintahan pusat secara
deskriptif. Modul ini tidak membahas mengenai bagaimana cara mengimplementasikan
konsepkonsep dalam manajemen pemerintahan pusat. Alasannya, uraian mengenai
bagaimana cara mempraktikkan konsepkonsep dalam manajemen pemerintahan pusat
dibahas pada tingkatan diklat yang lebih tinggi. Modul ini berisikan halhal mendasar
mengenai manajemen pemerintahan pusat yang diuraikan secara lengkap dan
menyeluruh.

2014 |Pusdiklatwas BPKP


2.

Tanyajawabdandiskusi
Widyaiswara dan peserta bertanya jawab untuk mendalami permasalahan/kondisi yang
terkaitdenganpermasalahandalammanajemenpemerintahanpusat.

3.

Latihan
Peserta berlatih menyelesaikan kasuskasus yang terkait dengan manajemen
pemerintahanpusat.
~

Manajemen Pemerintahan Pusat

2014 |Pusdiklatwas BPKP

BabII
KONSEPSIGOODGOVERNANCEDAN
PENGELOLAANKEUANGANNEGARA

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenai
prinsipprinsipakuntabilitassektorpublik.

A.

KONSEPSIMANAJEMENPEMERINTAHANPUSAT

1.

TujuanBernegaradanPenyelenggaraanNegara
UndangUndang Dasar 1945 dalam pembukaannya menegaskan tujuan bernegara
Indonesiayaitu:
a.

melindungisegenapbangsadanseluruhtumpahdarahIndonesia,

b.

memajukankesejahteraanumum,

c.

mencerdaskankehidupanbangsa,dan

d.

ikut serta mewujudkan ketertiban dunia berdasarkan kemerdekaan, perdamaian


abadi,dankeadilansosial.

Dalam rangka mewujudkan tujuan bernegara dibentuk pemerintahan yang menjalankan


amanahtersebut.Untukmewujudkanamanahtersebut,pemerintahdiberikewenangan
kewenanganberdasarkanperaturanperundangan,diantaranyaPPNomor25Tahun2000
yang menyebutkan kewenangan pemerintah pusat dalam enam bidang yaitu dalam
bidang politik luar negeri, pertahanan dan keamanan, peradilan, moneter dan fiskal,
agamasertakewenanganbidanglain.Kewenanganbidanglainmeliputikebijakantentang
perencanaan nasional dan pengendalian pembangunan nasional secara makro, dana
perimbangan keuangan, sistem administrasi negara dan lembaga perekonomian negara,
pembinaandanpemberdayaansumberdayamanusia,pendayagunaansumberdayaalam
sertateknologitinggiyangstrategis,konservasidanstandardisasinasional.

Manajemen Pemerintahan Pusat


Sejalan dengan kewenangan yang diberikan tersebut, pemerintah juga diberi rambu
rambu melalui berbagai peraturan perundangan agar amanah mewujudkan tujuan
bernegara dapat dijalankan dengan baik. Namun demikian, dalam perjalanannya
pelaksanaanpemerintahantidakselaluberjalanbaik.Puncaknyapadatahun1998,melalui
gerakan reformasi, masyarakat menuntut pergantian rezim pemerintahan saat itu yang
dianggaptelahbanyakmelanggarramburambudalammewujudkantujuanbernegara.
Gerakan reformasi tersebut mendorong Majelis Permusyawaratan Rakyat, sebagai
lembaga tertinggi saat itu (berdasarkan UUD 1945 sebelum diamandemen) menegaskan
perlunya penyelenggaraan negara yang baik melalui ketetapan Nomor XI/MPR/1998
tentang Penyelenggara Negara yang Bersih dan Bebas Korupsi, Kolusi, dan Nepotisme.
Ketetapan tersebut selanjutnya menjadi tonggak penyelenggaraan negara yang mampu
menjalankan fungsi dan tugasnya secara sungguhsungguh dan penuh tanggung jawab.
SebagaiturunanketetapanMPRNomorXI/MPR/1998,disusunUndangUndangNomor28
Tahun2009tentangtentangPenyelenggaraanNegarayangBersihdanBebasdariKorupsi,
Kolusi, dan Nepotisme yang mengetengahkan asasasas umum penyelenggaraan negara
sebagaiberikut.
a.

Asas Kepastian Hukum adalah asas dalam negara hukum yang mengutamakan
landasan peraturan perundangundangan, kepatutan, dan keadilan dalam setiap
kebijakanPenyelenggaraNegara.

b.

Asas Tertib Penyelenggaraan Negara adalah asas yang menjadi landasan


keteraturan, keserasian, dan keseimbangan dalam pengendalian penyelenggaraan
negara.

c.

AsasKepentinganUmumadalahyangmendahulukankesejahteraanumumdengan
carayangaspiratif,akomodatifdanselektif.

d.

Asas Keterbukaan adalah asas yang membuka diri terhadap hak masyarakat untuk
memperoleh informasi yang benar, jujur, dan tidak diskriminatif tentang
penyelenggaraannegaradengantetapmemperhatikanperlindunganatashakasasi
pribadi,golongandanrahasianegara.

e.

Asas Proporsionalitas adalah asas yang mengutamakan keseimbangan antara hak


dankewajibanpenyelenggaranegara.

2014 |Pusdiklatwas BPKP


f.

Asas Profesionalitas adalah asas yang mengutamakan keahlian yang berlandaskan


kodeetikdanketentuanperaturanperundangundanganyangberlaku.

g.

Asas Akuntabilitas adalah asas yang menentukan bahwa setiap kegiatan dan hasil
akhir dari kegiatan penyelenggara negara harus dapat dipertanggungjawabkan
kepada masyarakat atau rakyat sebagai pemegang kedaulatan tertinggi negara
sesuaidenganketentuanperaturanperundangundanganyangberlaku.

Dengan memperhatikan dan melaksanakan asasasas penyelenggaraan negara ini


diharapkan para penyelenggara negara mampu menjalankan fungsi dan tugasnya secara
sungguhsungguhdanpenuhtanggungjawab.
2.

ManajemenPemerintahan
Dalam rangka memahami pengertian manajemen pemerintahan, digunakan pengertian
administrasi negara. Administrasi negara adalah administrasi mengenai negara dalam
keseluruhan arti, unsur, dimensi, dan dinamikanya (LAN, 2003). Administrasi negara
berperan memberikan dukungan dan mengembangkan tugas penyelenggaraan negara,
mengemban misi perjuangan bangsa dalam bernegara, memberikan perhatian dan
pelayanansebaikbaiknyakepadamasyarakat,danmembukapeluangkepadamasyarakat
untukberkaryadalamupayamencapaitujuanbersamadalambernegara,ataupununtuk
melakukanperantertentudalampengelolaankebijakandanpelayananpublikyangsecara
tradisionaldilakukanolehaparaturnegara.
Dalam pengertian administrasi negara terkandung konsepkonsep: tata nilai, organisasi
danmanajemenpemerintahannegara,sistempenyelenggaraankebijakannegara,sumber
dayaaparaturnegara,lingkunganadministrasinegara,posisidanperanwarganegara,dan
dimensi hukum. Organisasi dan manajemen pemerintahannegaramerupakan fenomena
substansial dari disiplin dan sistem organisasi negara. Organisasi pemerintahan negara
berkenaan dengan tatanan organisasi pemerintahan negara meliputi lembaga eksekutif
(pemerintah), dan legislatif (badan perwakilan rakyat), yang eksis pada setiap satuan
wilayah pemerintahan, yudikatif (badan peradilan) dan lembaga negara lainnya yang
diperlukan dalam penyelenggaraan negara, serta tata hubungan fungsional di antara
lembagalembaga tersebut. Sedangkan manajemen pemerintahan negara berkenaan
dengan kegiatan pengelolaan tugas pemerintahan negara, meliputi tugas pemerintahan
umumdanpembangunan.

Manajemen Pemerintahan Pusat


Salah satu lingkup administrasi negara di atas adalah manajemen pemerintahan negara
yang meliputi kegiatan pengelolaan pelaksanaan tugas pemerintahan umum dan
pembangunan dalam berbagai bidang kehidupan dan wilayah pemerintahan, yang
merupakanpelaksanaanfungsifungsimanajemenpemerintahanpadaumumnya,seperti
pengelolaankebijakan,perencanaan,pembiayaan,pelaksanaan,pengendalian,pelayanan,
pengawasan, dan pertanggungjawaban hasilnya dari setiap atau keseluruhan organisasi
pemerintahannegara.
Cakupan manajemen pemerintahan tersebut memperlihatkan empat fungsi pokok
manajemen, yaitu perencanaan (planning), pengorganisasian (organizing), penggerakan
pelaksanaan (actuating), dan pengendalian (controlling) (G.R. Terry, 2000). Perwujudan
konsep manajemen tersebut apabila diterapkan dalam penyelenggaraan negara
mencakup Sistem Perencanaan Pembangunan Nasional (SPPN) dan Sistem Adminsitrasi
KeuanganNegara(SAKN)sebagaiberikut.
a.

SPPN mewakili fungsi perencanaan, yang merupakan satu kesatuan tata cara
perencanaan pembangunan untuk menghasilkan rencanarencana pembangunan
dalamjangkapanjang,jangkamenengah,dantahunanyangdilaksanakanolehunsur
penyelenggara negara dan masyarakat di tingkat pusat dan daerah. Ketentuan
mengenaiSPPNdiaturdalamUndangUndangNomor25Tahun2004.

b.

Sistem Adminsitrasi Keuangan Negara (SAKN) mencakup pengorganisasian,


penggerakanpelaksanan,danpengendaliansebagaiberikut.
1)

Pengorganisasian, diwujudkan dalam penetapan lingkup dan ketentuan


mengenaikeuangannegarasebagaimanadiaturdalamUndangundangNomor
17Tahun2003;

1)

Penggerakan pelaksanaan, diwujudkan dalam ketentuan mengenai


pengelolaan dan pertanggungjawaban keuangan negara sebagaimana diatur
dalamUndangundangNomor1Tahun2004;

2)

Pengendalian, diwujudkan dalam ketentuan mengenai pemeriksaan


pengelolaandantanggungjawabkeuangannegarasebagaimanadiaturdalam
UndangundangNomor15Tahun2004.

10

2014 |Pusdiklatwas BPKP


Gambar2.1SistemAdministrasiKeuanganNegara

Berdasarkan uraian di atas, dapat ditarik pengertian manajemen pemerintahan sebagai


proses pengelolaan penyelenggaraan pemerintahan yang mencakup perencanaan
pemerintahan, pengorganisasian atau kelembagaan pemerintahan dan penggunaan
sumbersumber daya dan pengawasan penyelenggaraan pemerintahan. Aspekaspek
dalammanajemenpemerintahansecaraumummencakup:
a.

perencanaanpemerintahan,

b.

pengorganisasiankelembagaanpemerintahan,

c.

penggunaan sumbersumber daya pemerintahan untuk pelayanan berikut


pertanggungjawabannya,dan

d.

pengawasanpenyelenggaraanpemerintahan.

Manajemen Pemerintahan Pusat

11


B.

KONSEPSIGOODGOVERNANCEDANAKUNTABILITAS

1.

RevolusiManajemenSektorPublik
Seiring dengan meningkatnya peran swasta dan masyarakat dalam penyelenggaraan
pemerintahan, manajemen sektor publik telah mengalami perubahan yang cukup
signifikan.HaliniantaralaindipicuolehpemikiranOsbornedanGaeblerdalambukunya
ReinventingGovernment(1992)ataupemerintahanwirausaha.Perubahantersebutpada
dasarnya diarahkan pada penciptaan manajemen publik yang handal dan mempertajam
serta meningkatkan kualitas penyelenggaraan administrasi publik. Konsep dan sistem
administrasi publik yang kaku, struktural/hirarkis, dan birokratis telah ditinggalkan dan
sebagaigantinyatelahdikembangkansuatukonsepmanajemenpublikyangfleksibeldan
berorientasi kepada pasar. Dalam paradigma manajemen sektor publik yang baru,
birokrasi pemerintah dibuat seefisien dan seefektif mungkin sehingga mereka dapat
bergerak fleksibel dalam mengikuti tuntutan masyarakat dan perubahan lingkungan.
Paradigmabaruinidianggapsebagaisolusiatasberbagailabelnegatifyangmelekatpada
sektor publik yaitu dengan mengacu pada kaidahkaidah terhadap new public
management(NPM).
Perubahan ini bukan perubahan sederhana dalam management style administrasi
publik. Akan tetapi, perubahan ini merupakan perubahan peranan pemerintah dalam
masyarakatdanhubunganantarapemerintahdenganmasyarakatnya.Paradigmabaruini
merupakantantanganlangsungatasberbagaifungsiprinsipadministrasipublikyangtelah
diyakini sebagai paradigma terpenting selama hampir 20 abad. Dalam paradigma baru,
birokrat dan pemerintah bukanlah satusatunya provider barang dan jasa masyarakat.
Perspektif ini menempatkan organisasi swasta sebagai mitra pemerintah untuk
menyediakan berbagai kebutuhan publik. Pemerintah berperan dalam memfasilitasi
kebutuhan masyarakatnya melalui subsidi, pengaturan perundangundangan dan
pengaturankontrak.Keterbukaanpemerintahjugaditekankandalamparadigmabaruini,
yang ditunjukkan dengan diadopsinya berbagai prinsip dan sistem manajemen sektor
swastakedalamsektorpublikuntukmemperbaikikinerjabirokrasi.
Dalammekanismedanpolahubunganiniakuntabilitasyangadatidakhanyamengalirdari
bawah ke atas, dalam arti pegawai secara hirarkis mempertanggungjawabkan kegiatan
yangdilakukannyakepadapejabatdiatasnya,namunpertanggungjawabanjugadilakukan

12

2014 |Pusdiklatwas BPKP


kepada pihak luar organisasi publik, dalam hal ini masyarakat ataupun kepada sektor
swasta.
2.

PergeseranParadigmaNewPublicManagement(NPM)keGovernance
Orientasi privatisasi yang terdapat pada NPM tidak berarti bahwa peran pemerintah
berkurang, namun tetap terwujud dengan munculnya peranan pengaturan (regulations)
terhadap keterlibatan sektor swasta dan juga dengan mengelola respon yang efektif
terhadap tuntuntan sosial dan ekonomi masyarakat. World Bank (1997) menyebutkan
bahwa meskipun terjadi kecenderungan privatisasi terhadap berbagai kegiatan
pemerintah, hal ini tidak berarti bahwa peran pemerintah menjadi berkurang. Peran
pemerintah masih sangat penting/dominan dalam manajemen pembangunan. Peran
pemerintahmungkinakanberkurangdalammemberikanarahandanpetunjukdaripusat
pemerintahan. Akan tetapi, pemerintah masih tetap bertanggung jawab terhadap
perancangan dan pelaksanaan kebijakan publik, terutama yang berkaitan dengan
transformasi ekonomi, pengurangan kemiskinan, peningkatan kinerja sektor pertanian,
ketenagakerjaan,fasilitassosialdanumum,sertapengelolaanlingkunganhidup.
Hal lain yang mendukung bahwa peran pemerintah masih sangat dibutuhkan dalam
pelayananpublikadalahkenyataanbahwaprinsipekonomidanefisiensitidakselaludapat
diterapkanpadasemuaaktivitaspemerintah(misalnyafasilitassosialdanfasilitasumum).
Pemerintahan yang modern tidak hanya mencakup efisiensi dan peningkatan
keekonomisan, tetapi juga merupakan hubungan akuntabilitas antara negara dengan
warga negara, di mana warga negara tidak diberlakukan hanya sebagai konsumen tapi
jugasebagaiwarganegarayangmemilikihakuntukmendapatkanjaminanataskebutuhan
dasardanmenuntutpemerintahuntukbertanggungjawabatasberbagaikebijakanyang
dilakukan. Hal ini merupakan perubahan pandangan dalam manajemen publik dari
penekanan pada hubungan antara negara dengan pasar ke hubungan antara negara
dengan warga negaranya. Pandangan ini dikenal dengan governance (kepemerintahan)
yangdiartikanolehUNDPsebagai:
the exercise of political, economic and administrative authority in the
managementofacountrysaffairsatalllevelcomprisesthecomplexmechanisms,
processes and institutions through which citizens and groups articulate their
interests,mediatetheirdifferencesandexerciselegalrightsandobligations(UNDP,
1995).

Manajemen Pemerintahan Pusat

13


Dengan kata lain, governance meliputi berbagai kewenangan baik yang menyangkut
kewenangan politik, ekonomi, dan administrasi berinteraksi satu dengan lainnya.
Hubungan ini mencakup hubungan yang komplek antar berbagai kewenangan dalam
semualevelpemerintahandalambentukmekanisme,prosesdanpembentukaninstitusidi
mana masyarakat dan kelompok masyarakat dapat menyampaikan keinginan, mengatur
berbagaiperbedaan,danjugamendapatkanjaminanhukum,termasukpengaturannya.
Konsep ini lebih luas dari fungsi dan kapasitas sektor publik, akan tetapi konsep ini
berkaitandenganmanajemenprosespembangunanyangmelibatkanpemerintah,swasta,
dan masyarakat. Hubungan semua pihak ini bukan merupakan kerangka kegiatan yang
terpisah melainkan dalam kerangka keterpaduan dan kerja sama yang harmonis untuk
pencapaian tujuan dan kepentingan bersama. Tujuan interaksi sosialpolitikekonomi
dalam pengertian ini adalah tercapainya suatu keseimbangan dan sinergi dalam
pemenuhan kebutuhan dan kepentingan masingmasing institusi dalam satu keselarasan
dankeseimbangan.
3.

KarakteristikGoodGovernance(GG)
Dalam rangka mengembangkan strategi yang lebih implementatif, terdapat banyak
karakteristik dan prinsip tentang GG. Salah satu yang menjadi tonggak penting adalah
karakteristikGGyangdirumuskanpadadeklarasiManila,yaitutransparan,akuntabel,adil,
wajar,demokratis,partisipatif,danresponsif.
Masingmasingkarakteristikdijelaskanlebihlanjutsebagaiberikut.
a.

Transparan, mengindikasikan adanya adanya kebebasan dan kemudahan didalam


memperoleh informasi yang akurat dan memadai bagi mereka yang memerlukan.
Informatif, mutakhir, dapat diandalkan, mudah diperoleh dan dimengerti adalah
beberapaparameteryangdigunakanuntukmengecekkeberhasilantranparansi.

b.

Akuntabel, di mana semua pihak (baik pemerintah, swasta dan masyarakat) harus
mampu memberikan pertanggungjawaban atas mandat yang diberikan kepadanya
untuk para stakeholders. Secara umum organisasi atau institusi harus akuntabel
kepada mereka yang terpengaruh dengan keputusan atau aktivitas yang mereka
lakukan.

14

2014 |Pusdiklatwas BPKP


c.

Adil, yaitu terdapat jaminan bagi masyarakat untuk mendapatkan pelayanan dan
kesempatan yang sama dalam menjalankan kehidupannya. Sifat adil ini diperoleh
dari aspek ekonomi, sosial dan politik. Adil ini juga berarti terdapat jaminan akan
kesejahteraan masyarakat dimana semua masyarakat merasa bahwa mereka
memilikihakdantidakmerasadiasingkandarikehidupanmasyarakat.

d.

Wajar, yaitu jaminan pemerintah terhadap pemenuhan kebutuhan dasar


masyarakat (standar). Hal ini mensyaratkan bahwa semua kelompok, terutama
kelompokyanglemah,memilikikesempatanuntukmeningkatkankesejahteraannya.
Untuk alasan ini, dalam memberikan pelayanan kepada masyarakat pemerintah
harus menyediakan standar pelayanan untuk menjamin kesamaan (fair) dan
konsistensipelayanan.

e.

Demokratis, yaitu terdapat jaminan kebebasan bagi setiap individu untuk


berpendapat/mengeluarkan pendapat serta ikut dalam kegiatan pemilihan umum
yangbebas,langsung,danjujur.

f.

Partisipatif, yaitu terdapat jaminan kesamaan hak bagi setiap individu dalam
pengambilankeputusan(baiksecaralangsungmaupunmelaluilembagaperwakilan).
Dalam kaitannya dengan partisipasi ini, terdapat tuntutan agar pemerintah
meningkatkan fungsi kontrol terhadap manajemen pemerintah dan pembangunan
dengan melibatkan organisasi nonpemerintah. Peran organisasi nonpemerintah
sangatpentingdalamkonteksinikarenadiyakiniorganisasiinimemilikikontakyang
lebihbaikdenganmasyarakatmiskin,memilikihubunganyangbaikdengandaerah
pedalamandanpedesaan,mampumenyediakanmetodealternatifpelayananpublik
dengan harga yang murah dan sebagai mediator dalam menyampaikan berbagai
pandangandankebutuhanmasyarakat.

g.

Tanggap/peka/responsif,yangberartibahwadalammelaksanakankepemerintahan
semua institusi dan proses yang dilaksanakan pemerintah harus melayani semua
stakeholders secara tepat, baik dan dalam waktu yang tepat (tanggap terhadap
kemauanmasyarakat).

Berdasarkan konsep di atas, dapat dilihat bahwa good governance mempunyai tujuan
yanglebihbesardarisekedarmanajemenyangefisiendanpenggunaansumberdayayang
ekonomis.Goodgovernanceadalahstrategiuntukmenciptakaninstitusimasyarakatyang

Manajemen Pemerintahan Pusat

15


kuat, dan juga untuk membuat pemerintah/publik sektor semakin terbuka, responsif,
akuntable dan demokratis. Di samping itu, konsep good governance jika dikembangkan
akan menciptakan modern governance (nasional maupun lokal) yang handal yang tidak
hanya menekankan aktivitasnya dalam kerangka efisiensi tetapi juga akuntabilitasnya di
mata publik. Penerapan good governance juga sangat berperan dalam pencegahan dan
pemberantasan praktikpraktik KKN yang dapat menghindarkan penyalahgunaan fasilitas
publikuntukkepentinganpribadisemaksimalmungkin.
4.

KonsepAkuntabilitas
Goodgovernancetidakhanyaterkaitdenganefisiensidanekonomis,tapijugaberkaitan
dengan

akuntabilitas

berbagai

penyelenggaraan

kepentingan

publik

kepada

stakeholdernya. Ide dasar dari akuntabilitas adalah kemampuan seseorang atau


organisasi atau penerima amanat untuk memberikan jawaban kepada pihak yang
memberikan amanat atau mandat tersebut. Semua unit organisasi, apakah dipilih atau
ditunjuk,

dikatakan

akuntabel

ketika

mereka

mampu

menjelaskan

dan

mempertanggungjawabkan semua tindakan/kegiatan yang mereka lakukan, dan


menerima

sanksi

untuk

tindakan

yang

tidak

layak

atau

tidak

dapat

dipertanggungjawabkan.
Konsepdanaplikasiakuntabilitassebenarnyasudahadanamunseiringdenganperubahan
lingkungan tuntutan akuntabilitas menjadi semakin besar. Secara garis besar terdapat
empat model akuntabilitas yang perkembangannya lebih banyak dipengaruhi karena
perubahantuntutandankebutuhanmasyarakat.
a.

ModelTradisionalWestminster
Modelinimenyebutkanbahwagarispertanggungjawabanakuntabilitasadalahdari
bawahkeatas(hierakhis),dangariskewenangan(otoritas)dariataskebawahatau
akuntabilitasministerial.
Model akuntabilitas ini sesuai dengan konsep birokrasi yang diterapkan oleh Max
Weber sehingga disebut juga sebagai administrative accountability. Dalam konsep
ini,setiapindividumemberikanpertanggungjawabanterhadapsuatutugasspesifik
yang diterima kepada atasannya secara hirarkis. Hal ini dilakukan sebagai bentuk
kontrolatasanterhadapkinerjabawahan.

16

2014 |Pusdiklatwas BPKP


ModeltradisionalWestminstermemilikibeberapakelemahan,yaitu:
1)

idepertanggungjawabanyangmenekankanpadapenjelasandanpembenaran
atas suatu tindakan dianggap tidak cukup digunakan untuk melihat kinerja
suatutindakan;

b.

2)

hubungandalampertanggungjawabanyangbersifatinterpersonal;

3)

kontrolyangbersifattopdown.

ModelTradisionalyangDikembangkan(upward,inwarddanoutward)
Modelinimerupakanjawabanterhadapadanyabeberapakelemahandalammodel
tradisionalWestminster.Denganberbagaikelemahantersebutdantuntutanglobal
terhadap transparansi dan kejujuran organisasi pemerintah, maka dikembangkan
konsep pertanggungjawaban akuntabilitas yang tidak hanya dari bawah ke atas,
tetapi juga bersifat ke dalam (perorangan) dan ke luar (masyarakat). Untuk
mendukung akuntabilitas internal dan eksternal ini, pendukung konsep ini
menyarankan diciptakannya berbagai mekanisme dan sistem akuntabilitas seperti
pengembangan jaminan kebebasan mendapatkan informasi dan pembentukan
berbagai lembaga independen yang bertujuan untuk mengontrol kinerja sektor
publiksepertiombudsmandanlembagaperadilanyangkuat.

c.

ModelStone
Dalam model ini pertanggungjawaban/akuntabilitas dibagi dalam lima kategori,
yaitu:

d.

1)

kontroldariparlemen(DPR),

2)

managerialism,

3)

pengadilan/lembagasemiperadilan,

4)

perwakilanmasyarakat,

5)

pasar(konsumenpengusaha).

ModelJaringanKerja(JaringanyangKompleks)
Parapihakyangterkaitsatudenganyanglainmembentuksuatujaringankerjayang
kompleks dan saling memberikan kontribusi dan informasi. Model ini menekankan

Manajemen Pemerintahan Pusat

17


padapolahubunganyangterjalindalamsuatukerjasama.Dalamsuatusistemkerja
sama,semuapihakyangterkaitsalingmelakukankomunikasi,pemberianinformasi
dan hubungan kerja yang saling melengkapi untuk mencapai tujuan dari jaringan
kerjayangdibuat.
Selain model akuntabilitas yang menekankan pada cara dan institusi pendukung
dalam pelaksanaan akuntabilitas, terdapat faktor lain yang penting, yaitu
mekanismeakuntabilitas.Pengembanganmekanismeakuntabilitasdiarahkanuntuk
meningkatkan:
a.

kejelasantugasdanperan,

b.

hasilakhiryangspesifik,

c.

prosesyangtransparan,

d.

ukurankeberhasilankinerja,dan

e.

konsultasidaninspeksipublik.

Mekanismeakuntabilitasjugameliputibeberapaaspek,yaitusiapayangharusmelakukan
akuntabilitas,kepadasiapaakuntabilitasinidilakukan,untukapaakuntabilitasdilakukan,
dan bagaimana proses akuntabilitas dilaksanakan. Mekanisme akuntabilitas ini sangat
bervariasi dan sangat ditentukan oleh keputusan atau aktivitas yang dilakukan suatu
organisasimengikatorganisasisecarainternalataumengikatsecaraeksternal.
Kepada siapa kita harus bertanggung jawab, tergantung pada siapa yang memberi kita
mandat dan seberapa besar berbagai tindakan yang kita lakukan mempengaruhi orang
lain. Pertanggungjawaban dapat diberikan kepada masyarakat (pelanggan), pemerintah
pusat dan daerah (termasuk dalam hal ini presiden, menteri, bupati/walikota, gubernur,
pejabat struktural dalam birokrasi pemerintah), organisasi kemasyarakatan/NGOs,
organisasipemerintahlainnyamisalnyaBUMN,danlembagapenilaiorganisasipublikyang
diaturdalamundangundang.
Mulgan, Richard (2003) dalam bukunya Holding Power to Account, membuat matriks
mekanisme akuntabilitas pemerintah. Contoh dari matriks yang dikembangkan adalah
sebagaimanaTabel2.1berikut.

18

2014 |Pusdiklatwas BPKP


Tabel2.1MekanismeAkuntabilitasPemerintah

Mekanisme

Siapa

KepadaSiapa

UntukApa

Bagaimana

Prosesnya
Bagaimana

Pemilu

Parpol
Individu
(yang dipilih)

Pemilih

Kinerja
secara total

Kampanye
Parpol

Diskusi
Amandemen

Media

Pemerintah
Birokrasi

Wartawan
Publik

Kinerja
secara
umum
Keputusan
khusus

Laporan pers
Wawancara
Laporan dari
informan

Informasi
Diskusi

Aksespublik
secara
langsung

Birokrasi

Publik

Kebijakan
umum
Keputusan
khusus

Prosedur
pengaduan
Prosedur
FOI
Anggaran
dasar

Informasi
Diskusi
(bukan FOI)
Amandemen
(bukan FOI)

Catatan:FOI=freedomofinformation

5.

KebijakanAkuntabilitasdiIndonesia
Pengembangan kebijakan akuntabilitas di Indonesia dipicu oleh dua hal penting, yaitu:
pertama,adanyatuntutaninternal(masyarakatIndonesia)antaralainagarsektorpublik
semakintransparandanmampumempertanggungjawabkanatasberbagaikebijakandan
tindakan yang dilakukan yang ditujukan untuk menyelesaikan dan memenuhi tuntutan
publik.Kedua,adalahtuntutanperubahandalamlingkunganglobaldalamhalmanajemen
sektorpublikmisalnyatuntutanGoodGovernancedanPerformanceManagement.
Kebijakan akuntabilitas di Indonesia dimulai sejak dikeluarkannya TAP MPR RI Nomor
XI/MPR/1998danUUNomor28Tahun1999tentangPenyelenggaraanNegarayangBersih
dan Bebas dari KKN. Dalam UU Nomor 28 Tahun 1999 disebutkan salah satu asas
penyelenggaraankepemerintahanyangbaikyaituasasakuntabilitas.Asasakuntabilitasdi
sini diartikan bahwa setiap kegiatan dan hasil akhir dari kegiatan penyelenggara negara
harus dapat dipertanggungjawabkan kepada masyarakat sebagai pemegang kedaulatan
tertingginegarasesuaidenganketentuanperundangundanganyangberlaku.
Dalam tataran praktis, terdapat Instruksi Presiden Nomor 7 Tahun 1999 tentang
AkuntabilitasKinerjaInstansiPemerintahsebagaiwujudnyatapenerapanakuntabilitasdi

Manajemen Pemerintahan Pusat

19


Indonesia. Inpres ini mendefinisikan Akuntabilitas Kinerja Instansi Pemerintah (AKIP)
sebagai pertanggungjawaban keberhasilan atau kegagalan misi dan visi instansi
pemerintah dalam mencapai tujuan dan sasaran yang telah ditetapkan melalui
seperangkat indikator kinerja. Dalam konteks AKIP ini, instansi pemerintah diharapkan
dapat menyediakan informasi kinerja yang dapat dipahami dan digunakan sebagai alat
ukur keberhasilan ataupun kegagalan pencapaian tujuan dan sasaran tersebut. Inpres
Nomor 7 Tahun 1999 dijabarkan lebih lanjut dalam Keputusan Kepala Lembaga
Administrasi Negara Nomor 589/IX/6/Y/99 tentang Pedoman Pelaporan Akuntabilitas
Instansi pemerintah, yang telah diperbaiki dengan Keputusan Kepala LAN Nomor
239/IX/6/8/2003 tentang Perbaikan Pedoman Pelaporan Akuntabilitas Kinerja Instansi
Pemerintah.
Sistem Akuntabilitas Kinerja Instansi pemerintah (SAKIP) merupakan instrumen yang
digunakan

instansi

pemerintah

dalam

memenuhi

kewajiban

untuk

mempertanggungjawabkankeberhasilandankegagalanpelaksanaanmisiorganisasi(LAN,
2004, hal. 63). Sebagai suatu sistem, SAKIP terdiri dari komponenkomponen yang
merupakan satu kesatuan, yakni perencanaan kinerja, pengukuran dan evaluasi kinerja,
sertapelaporankinerja.KomponendalamSAKIPinimenceminkansemuaprosesyangada
dalammanajemenkinerja.
PP Nomor 8 Tahun 2006 Pasal 2 3 telah menegaskan kewajiban penyusunan dan
penyajian laporan keuangan maupun laporan kinerja dalam rangka pertanggungjawaban
pelaksanaan APBN/ APBD bagi pemerintah pusat, pemerintah daerah, kementerian
negara/lembaga,danBendaharaUmumNegara.
Selanjutnya berdasarkan Inpres Nomor 4 Tahun 2011 tentang Percepatan Peningkatan
Kualitas Akuntabilitas Keuangan Negara ditetapkan peran BPKP untuk melaksanakan (1)
asistensi kepada kementerian/lembaga/pemerintah daerah untuk meningkatkan
pemahamanbagipejabatpemerintahpusat/daerahdalampengelolaankeuangannegara/
daerah, meningkatkan kepatuhan terhadap peraturan perundangundangan, dan
meningkatkan kualitas laporan keuangan dan tata kelola, (2) evaluasi terhadap
penyerapan anggaran kementerian/ lembaga/pemerintah daerah, dan memberikan
rekomendasi langkahlangkah strategis percepatan penyerapan anggaran, dan (3) audit
tujuan tertentu terhadap programprogram strategisnasional yang mendapat perhatian

20

2014 |Pusdiklatwas BPKP


publikdanmenjadiisuterkini,dan(4)rencanaaksiyangjelas,tepat,danterjadwaldalam
mendorongpenyelenggaraanSPIPpadasetiapkementerian/lembaga/pemerintahdaerah.

C.

KONSEPSIKEUANGANNEGARADANPENGELOLAANNYA

1.

KeuanganNegara
a.

Pengertian
Undangundang Nomor 17 Tahun 2003 Pasal 1 ayat (1) mendefenisikan keuangan
negarasebagaisemuahakdankewajibannegarayangdapatdinilaidenganuang,
sertasegalasesuatubaikberupauangmaupunberupabarangyangdapatdijadikan
miliknegaraberhubungdenganpelaksanaanhakdankewajibantersebut.
Pengertian tersebut mengandung tiga pokok penting unsur keuangan negara
sebagaiberikut.
1)

Hakikat keuangan negara, yaitu hak dan kewajiban negara yang dapat dinilai
dengan uang. Pembentukan pemerintahan negara menimbulkan hak dan
kewajiban negara (yang dapat dinilai dengan uang) antara negara dengan
rakyatdalamkehidupanberbangsadanbernegarayangmeliputi:
a)

hak negara, yang meliputi hak memungut pajak, mengeluarkan dan


mengedarkanuang,danmelakukanpinjaman;

b)

kewajiban negara, yang meliputi kewajiban untuk menyelenggarakan


tugaslayananumumpemerintahannegaradanmembayartagihanpihak
ketiga.

2)

Keuangan negara dapat berupa uang maupun barang yang dapat dijadikan
milik negara. Keuangan negara dapat berupa penerimaan dan pengeluaran
uangnegara/daerahmaupunsegalabentukkekayaanyangberbentukbarang
(aset)yangdapatdijadikanmiliknegara.

3)

Keuangan negara berkaitan dengan pelaksanaan hak dan kewajiban dalam


rangkapencapaiantujuanberbangsadanbernegara,sebagaimanatercantum
dalamPembukaanUUD1945.

Manajemen Pemerintahan Pusat

21


b.

PendekatanPerumusanKeuanganNegara
Pendekatan yang digunakan dalam merumuskan keuangan negara adalah dari sisi
objek,subjek,proses,dantujuan.
1)

Darisisiobjek
Keuangannegarameliputisemuahakdankewajibannegarayangdapatdinilai
denganuang,termasukkebijakandankegiatandalambidangfiskal,moneter,
dan pengelolaan kekayaan negara yang dipisahkan, serta segala sesuatu baik
berupauangmaupunbarangyangdapatdijadikanmiliknegara.

2)

Darisisisubjek
Keuangan negara meliputi seluruh objek sebagaimana tersebut di atas yang
dimilikinegara,dan/ataudikuasaiolehPemerintahPusat/Daerah,Perusahaan
Negara/Daerah,danbadanlainyangadakaitannyadengankeuangannegara.

3)

Darisisiproses
Keuangan negara mencakup seluruh rangkaian kegiatan yang terkait dengan
pengelolaan objek sebagaimana tersebut di atas, mulai dari perumusan
kebijakandanpengambilankeputusansampaidenganpertanggunggjawaban.

4)

Darisisitujuan
Keuangannegarameliputiseluruhkebijakan,kegiatan,danhubunganhukum
yang terkait dengan pemilikan dan/atau penguasaan objek sebagaimana
tersebutdiatasdalamrangkapenyelenggaraanpemerintahannegara.

c.

RuangLingkupKeuanganNegara
SesuaiPasal2UndangundangNomor17Tahun2003,keuangannegarameliputi:
1)

hak negara untuk memungut pajak, mengeluarkan dan mengedarkan uang,


danmelakukanpinjaman;

2)

kewajiban negara untuk menyelenggarakan tugas layanan umum


pemerintahannegaradanmembayartagihanpihakketiga;

22

2014 |Pusdiklatwas BPKP


3)

penerimaan/pengeluarannegara/daerah;

4)

kekayaan negara/kekayaan daerah yang dikelola sendiri atau oleh pihak lain
berupa uang, surat berharga, piutang, barang, serta hakhak lain yang dapat
dinilai dengan uang. Termasuk kekayaan yang dipisahkan pada perusahaan
negara/perusahaandaerah;

5)

kekayaan pihak lain yang dikuasai oleh pemerintah dalam rangka


penyelenggaraantugaspemerintahandan/ataukepentinganumum;dan

6)

kekayaan pihak lain yang diperoleh dengan menggunakan fasilitas yang


diberikanpemerintah.

2.

PengelolaanKeuanganNegara
a.

RuangLingkup
Pengaturan mengenai pengelolaan keuangan negara mencakup seluruh kegiatan
perencanaan, penguasaan, penggunaan, pengawasan, dan pertanggungjawaban
keuangannegara,yangmeliputi:
1)

pengertiandanruanglingkupkeuangannegara,

2)

asasasasumumpengelolaankeuangannegara,

3)

kedudukan presiden sebagai pemegang kekuasaan pengelolaan keuangan


negara,

4)

pendelegasian kekuasaan presiden kepada Menteri Keuangan dan


menteri/pimpinanlembaga,

5)

susunanAPBNdanAPBD,

6)

ketentuanmengenaipenyusunandanpenetapanAPBNdanAPBD,

7)

pengaturan hubungan keuangan antara pemerintah pusat dan bank sentral,


sertapemerintahdaerahdanpemerintah/lembagaasing,

Manajemen Pemerintahan Pusat

23


8)

pengaturan hubungan keuangan antara pemerintah dengan perusahaan


negara, perusahaan daerah dan perusahaan swasta, dan badan pengelola
danamasyarakat,dan

9)

penetapan

bentuk

dan

batas

waktu

penyampaian

laporan

pertanggungjawabanpelaksanaanAPBNdanAPBD.
b.

BidangPengelolaanKeuanganNegara
Bidang pengelolaan keuangan negara dapat dikelompokkan dalam tiga sub bidang
pengelolaan, yaitu subbidang pengelolaan fiskal, subbidang pengelolaan moneter,
dansubbidangpengelolaankekayaannegarayangdipisahkan.
1)

Subbidang pengelolaan fiskal, meliputi fungsifungsi pengelolaan kebijakan


fiskal dan kerangka ekonomi makro, penganggaran, administrasi perpajakan,
administrasikepabeanan,perbendaharaan,sertapengawasankeuangan.

2)

Subbidang pengelolaan moneter, berkaitan dengan kebijakan serta


pelaksanaan kegiatan sektor perbankan dan lalu lintas moneter, baik dalam
maupun luar negeri. Serangkaian kebijakan di bidang moneter tersebut
dilakukan oleh pemerintah agar ada keseimbangan yang dinamis antara
jumlah uang yang beredar dengan barang dan jasa yang tersedia di
masyarakat.

3)

Subbidang pengelolaan kekayaan negara yang dipisahkan, berkaitan dengan


kebijakan dan pelaksanaan kegiatan di sektor Badan Usaha Milik
Negara/Daerah(BUMN/BUMD)yangberorientasimencarikeuntungan(profit
motive).

c.

HubunganKeuanganantaraPemerintahdanLembagaLembagaInfra/Supranasional
Karena kegiatan pengelolaan keuangan negara bersifat kompleks, UU Nomor 17
tahun2003mengaturketentuanmengenaihubungankeuanganantarapemerintah
pusatdanlembagalembagainfra/supranasional,yangsebagaiberikut.

24

2014 |Pusdiklatwas BPKP


1)

BankSentral(Pasal21).
Pemerintah pusat dan bank sentral berkoordinasi dalam penetapan dan
pelaksanaankebijakanfiskaldanmoneter.

2)

PemerintahDaerah(Pasal22)

Pemerintah pusat berkewajiban mengalokasikan dana perimbangan


kepada pemerintah daerah berdasarkan undangundang perimbangan
keuanganpusatdandaerah.

Pemerintah pusat dapat memberikan pinjaman dan/atau hibah kepada


pemerintah daerah atau sebaliknya setelah mendapatkan persetujuan
denganDPR.

3)

PemerintahAsingdanBadan/LembagaAsing(Pasal23)

Pemerintah pusat dapat memberikan hibah/pinjaman kepada atau


menerima hibah/pinjaman dari pemerintah/lembaga asing dengan
persetujuanDPR.

Pinjaman dan/atau hibah yang diterima pemerintah pusat tersebut


dapatditeruspinjamkankepadaPemerintahDaerah/PerusahaanNegara/
PerusahaanDaerah.

4)

Perusahaan Negara, Perusahaan Daerah, Perusahaan Swasta, dan Badan


PengelolaDanaMasyarakat(Pasal24)

Pemerintah dapat memberikan pinjaman/hibah/penyertaan modal


kepada dan menerima pinjaman/hibah dari perusahaan negara/daerah
setelahmendapatpersetujuanDPR/DPRD.

Menteri Keuangan melakukan pembinaan dan pengawasan kepada


perusahaannegara.

Pemerintah pusat dapat melakukan penjualan dan/atau privatisasi


perusahaannegarasetelahmendapatkanpersetujuanDPR.

Manajemen Pemerintahan Pusat

25

Gubernur/bupati/walikota melakukan pembinaan dan pengawasan


kepadaperusahaandaerah.

Pemerintah daerah dapat melakukan penjualan dan/atau privatisasi


perusahaandaerahsetelahmendapatpersetujuanDPRD.

Dalam keadaan tertentu, untuk penyelamatan perekonomian nasional,


pemerintah pusat dapat memberikan pinjaman dan/atau melakukan
penyertaan modal kepada perusahaan swasta setelah mendapat
persetujuanDPR.

d.

AsasPengelolaanKeuanganNegara
Kewajiban pengelolaan keuangan negara dinyatakan dalam UU Nomor 17 Tahun
2003 pasal 3 ayat (1), bahwa setiap penyelenggara negara wajib mengelola
keuangan negara secara tertib, taat pada peraturan perundangundangan, efisien,
ekonomis,efektif,transparan,danbertanggungjawabdenganmemperhatikanrasa
keadilandankepatutan.
Asaspokoktersebutdijabarkankedalamasasasasumum,baikasasasasyangtelah
lama dikenal (seperti, asas tahunan, asas universalitas, asas kesatuan, dan asas
spesialitas) maupun asasasas baru sebagai pencerminan penerapan kaidahkaidah
yang baik (best practices) dalam pengelolaan keuangan negara. Asasasas tersebut
adalahsebagaiberikut:
1)

asas tahunan, mensyaratkan bahwa anggaran negara dibuat secara tahunan


danharusmendapatpersetujuandaribadanlegislatif(DPR);

2)

asas universalitas (kelengkapan), memberikan batasan bahwa tidak


diperkenankan terjadinya percampuran antara penerimaan dengan
pengeluarannegara;

3)

asas kesatuan, mempertahankan hak budget dari dewan secara lengkap,


dalam arti semua pengeluaran harus tercantum dalam anggaran. Dengan
demikian,yangdibukukandalamanggaranadalahjumlahbrutonya;

26

2014 |Pusdiklatwas BPKP


4)

asas spesialitas, mensyaratkan bahwa jenis pengeluaran dimuat dalam mata


anggaran tertentu/tersendiri dan diselenggarakan secara konsisten, baik
secara kualitatif maupun kuantitatif. Secara kuantitatif artinya jumlah yang
telahditetapkandalammataanggarantertentumerupakanbatastertinggidan
tidak boleh dilampaui. Secara kualitatif berarti penggunaan anggaran hanya
dibenarkanuntukmataanggaranyangtelahditentukan;

5)

asas akuntabilitas, berorientasi pada hasil, bahwa setiap pengguna anggaran


wajib menjawab dan menerangkan kinerja organisasi atas keberhasilan atau
kegagalansuatuprogramyangmenjaditanggungjawabnya;

6)

asas profesionalitas, mengharuskan pengelolaan keuangan negara ditangani


olehtenagayangprofessional;

7)

asas proporsionalitas, pengalokasian anggaran dilaksanakan secara


proporsional pada fungsifungsi kementerian/lembaga sesuai dengan tingkat
prioritasdantujuanyangingindicapai;

8)

asas keterbukaan, dalam pengelolaan keuangan negara diwajibkan adanya


keterbukaandalampembahasan,penetapan,danperhitungananggaranserta
atashasilpengawasanolehlembagaaudityangindependen;

9)

asaspemeriksaankeuangan,dilakukanolehbadanpemeriksayangbebasdan
mandiri, dengan memberi kewenangan yang lebih besar pada Badan
Pemeriksa Keuangan untuk melaksanakan pemeriksaan atas pengelolaan
keuangannegarasecaraaktifdanindependen.

Asasasas umum tersebut juga diperlukan guna menjamin terselenggaranya


prinsipprinsip pemerintahan. Dengan dianutnya asasasas umum tersebut,
pelaksanaan undangundang keuangan negara, selain menjadi acuan dalam
reformasi manajemen keuangan negara, dimaksudkan untuk memperkokoh
landasan pelaksanaan desentralisasi dan otonomi daerah di Negara Kesatuan
RepublikIndonesia.

Manajemen Pemerintahan Pusat

27


3.

KekuasaandanKewenanganPengelolaanKeuanganNegara
a.

KekuasaanPengelolaanKeuanganNegara
Berdasarkan UU Nomor 17 Tahun 2003 Pasal 6 ayat 1 Presiden selaku kepala
pemerintahanmemegangkekuasaanumumpengelolaankeuangannegara,sebagai
bagian dari kekuasaan pemerintahan. Penyelenggaraan kekuasaan tersebut
dilaksanakansebagaiberikut.
1)

Sebagiankekuasaandikuasakankepadamenterikeuangan,selakupengelola
fiskal dan wakil pemerintah dalam kepemilikan kekayaan negara yang
dipisahkan. Menteri Keuangan sebagai pembantu presiden dalam bidang
keuanganpadahakekatnyaadalahChiefFinancialOfficer(CFO),yaitusebagai
seorangmanajerkeuangannegarapemerintahRepublikIndonesia.

2)

Sebagian kekuasaan dikuasakan kepada menteri/pimpinan lembaga negara


dan

lembaga

pemerintah

non

kementerian,

selaku

pengguna

anggaran/pengguna barang kementerian negara/lembaga yang dipimpinnya;


dan setiap menteri/pimpinan lembaga pada hakekatnya adalah Chief
OperationalOfficer(COO)untuksuatubidangtertentupemerintahan.
3)

Dalam rangka penyelenggaraan asas desentralisasi, sebagian kekuasaan


pengelolaan keuangan diserahkan kepada gubernur/bupati/walikota selaku
kepalapemerintahandaerahuntukmengelolakeuangandaerahdanmewakili
pemerintahdaerahdalamkepemilikankekayaandaerahyangdipisahkan.

Kekuasaanpresidentersebuttidaktermasukkewenangandibidangmoneter,antara
lain mengeluarkan dan mengedarkan uang yang pelaksanaannya diatur dengan
undangundang. Untuk mencapai kestabilan nilai rupiah, tugas menetapkan dan
melaksanakan kebijakan moneter serta mengatur dan menjaga kelancaran sistem
pembayarandilakukanolehbanksentral.
Prinsip penyelenggaraan kekuasaan dan pelimpahan kewenangan di atas perlu
dilaksanakan secara konsisten agar terdapat kejelasan dan kepastian dalam
pembagian wewenang dan tanggung jawab, terlaksananya mekanisme check and

28

2014 |Pusdiklatwas BPKP


balance, serta untuk mendorong upaya peningkatan profesionalisme dalam
penyelenggaraantugaspemerintahan.
b.

KewenanganPengelolaanKeuanganNegara
Kekuasaan pengelolaan keuangan negara yang dimiliki presiden meliputi
kewenanganyangbersifatumumdankewenanganyangbersifatkhusus.
1)

Kewenanganyangbersifatumum,meliputikewenanganuntuk:
a)

menetapkanArahdanKebijakanUmum(AKU);

b)

menetapkanstrategidanprioritasdalampengelolaanAPBN,antaralain:

pedomanpelaksanaandanpertanggungjawabanAPBN,

pedoman penyusunan rencana kerja kementerian negara/


lembaga,

2)

gajidantunjangan,

pedomanpengelolaanpenerimaannegara.

Kewenanganyangbersifatkhusus,meliputikewenanganmembuatkeputusan/
kebijakanteknisterkaitpengelolaanAPBN,antaralainmenetapkan:
a)

keputusansidangkabinetdibidangpengelolaanAPBN,

b)

keputusanrincianAPBN,

c)

keputusandanaperimbangan,dan

d)

penghapusanasetdanpiutangnegara.

Manajemen Pemerintahan Pusat

29


Gambar2.2PenguasaandanPenyerahanKekuasaanPengelolaanKeuanganNegara

c.

PelimpahanKewenanganPengelolaanKeuanganNegara
Kewenangan presiden terhadap pengelolaan keuangan negara yang dilimpahkan
kepadapejabatnegara,yaitusebagiankewenanganyangbersifatumumdikuasakan
kepada menteri/pimpinan lembaga negara dan lembaga pemerintahan non
kementerian negara, selaku pengguna anggaran atau Chief Operational Officer
(COO); sementara sebagian kewenangan yang bersifat khusus dikuasakan kepada
Menteri Keuangan selaku Bendahara Umum Negara (BUN) atau Chief Financial
Officer(CFO).
1)

TugasMenteri/PimpinanLembaga
Dalam melaksanakan kewenangan umum tersebut, menteri/pimpinan
lembagaselakupenggunaanggaranmempunyaitugasuntuk:
a)

menyusun rancangan anggaran kementerian negara/lembaga yang


dipimpinnya;

30

2014 |Pusdiklatwas BPKP


b)

menyusundokumenpelaksanaananggaran;

c)

melaksanakan

anggaran

kementerian

negara/lembaga

yang

dipimpinnya;
d)

melaksanakan pemungutan penerimaan negara bukan pajak dan


menyetorkannyakekasnegara;

e)

mengelola piutang dan utang negara yang menjadi tanggung jawab


kementeriannegara/lembagayangdipimpinnya;

f)

mengelolabarangmilik/kekayaannegarayangmenjaditanggungjawab
kementeriannegara/lembagayangdipimpinnya;

g)

menyusun dan menyampaikan laporan keuangan kementerian negara/


lembagayangdipimpinnya;dan

h)

melaksanakan tugastugas lain yang menjadi tanggung jawabnya


berdasarkanketentuanundangundang.

2)

TugasMenteriKeuangan
Dalam rangka pelaksanaan kekuasaan atas pengelolaan fiskal, Menteri
Keuanganmempunyaitugassebagaiberikut:
a)

menyusunkebijakanfiskaldankerangkaekonomimakro;

b)

menyusunrancanganAPBNdanrancanganPerubahanAPBN;

c)

mengesahkandokumenpelaksanaananggaran;

d)

melakukanperjanjianinternasionaldibidangkeuangan;

e)

melaksanakan pemungutan pendapatan negara yang telah ditetapkan


denganundangundang;

f)

melaksanakanfungsibendaharaumumnegara;

g)

menyusun laporan keuangan yang merupakan pertanggungjawaban


pelaksanaanAPBN;

h)

melaksanakantugastugaslaindibidangpengelolaanfiskalberdasarkan
ketentuanundangundang.

Manajemen Pemerintahan Pusat

31


d.

PenyerahanKekuasaanPengelolaanKeuangan
Dalam rangka penyelenggaraan asas desentralisasi penyelenggaraan pemerintahan
di daerah (otonomi daerah), sebagian kekuasaan presiden diserahkan kepada
gubernur/walikota/bupatiselakuKepaladaerah.Berdasarkanpasal2UUNomor17
Tahun2003,keuangannegarayangdiserahkantersebutmeliputi:
1)

kewajiban negara untuk menyelenggarakan tugas layanan umum


pemerintahannegaradanmembayartagihanpihakketiga;

2)

penerimaandaerah;

3)

pengeluarandaerah;

4)

kekayaandaerahyangdikelolasendiriatauolehpihaklainberupauang,surat
berharga,piutang,barang,sertahakhaklainyangdapatdinilaidenganuang,
termasukkekayaanyangdipisahkanpadaperusahaandaerah.

Penyerahankekuasaantersebutdilaksanakandenganpengalokasiansebagiandana
APBN kepada daerah dalam bentuk dana perimbangan, sesuai dengan ketentuan
yangdiaturdalamundangundangperimbangankeuanganantarapemerintahpusat
dengan daerah untuk membiayai kebutuhan daerah dalam rangka pelaksanaan
desentralisasi.Danaperimbangantersebutterdiriatas:
1)

DanaAlokasiUmum(DAU)
Dana Alokasi Umum (selanjutnya disebut DAU) adalah dana yang bersumber
dari pendapatan APBN yang dialokasikan dengan tujuan pemerataan
kemampuan keuangan antardaerah untuk mendanai kebutuhan daerah
dalamrangkapelaksanaandesentralisasi.
Jumlah keseluruhan DAU ditetapkan sekurangkurangnya 26% dari
pendapatandalamnegerinetoyangditetapkandalamAPBN.
JumlahalokasiDAUuntuksuatudaerahdidasarkanatasdasarcelahfiskaldan
alokasidasardarimasingmasingdaerah.

32

2014 |Pusdiklatwas BPKP

Celah fiskal adalah kebutuhan fiskal dikurangi dengan kapasitas fiskal


daerah.

AlokasidasarberdasarkanjumlahgajiPegawaiNegeriSipilDaerah.

Kebutuhan fiskal daerah merupakan kebutuhan pendanaan daerah


untuk melaksanakan fungsi layanan dasar umum, yang diukur
berdasarkan secara berturutturut dengan jumlah penduduk, luas
wilayah,IndeksKemahalanKonstruksi,ProdukDomestikRegionalBruto
perkapita,danIndeksPembangunanManusia.

Kapasitas fiskal daerah merupakan sumber pendanaan daerah yang


berasaldariPADdanDanaBagiHasil.

RumusDAU:

DAU=CelahFiskal+AlokasiDasar
DAU=(KebutuhanFiskalKapasitasFiskal)+JumlahgajiPNSDaerah
DAU=(KebutuhanFiskal(PAD+DanaBagiHasil)+JumlahGajiPNSDaerah

2)

DanaAlokasiKhusus(DAK)
Dana Alokasi Khusus (selanjutnya disebut DAK) adalah dana yang bersumber
dari pendapatan APBN yang dialokasikan kepada daerah tertentu dengan
tujuan untuk membantu mendanai kegiatan khusus yang merupakan urusan
daerahdansesuaidenganprioritasnasional,sesuaidenganfungsiyangtelah
ditetapkandalamAPBN.
Pemerintah menetapkan kriteria DAK yang meliputi kriteria umum, kriteria
khusus,

dan

kriteria

teknis.

Kriteria

umum

ditetapkan

dengan

mempertimbangkan kemampuan keuangan daerah dalam APBD, kriteria


khusus ditetapkan dengan memperhatikan peraturan perundangundangan
dan karakteristik daerah, dan kriteria teknis ditetapkan oleh kementerian
negara/departementeknis.

Manajemen Pemerintahan Pusat

33


Daerah

penerima

DAK

wajib

menyediakan

dana

pendamping

sekurangkurangnya 10% dari alokasi DAK dan dianggarkan dalam APBD


(daerah dengan kemampuan fiskal tertentu tidak diwajibkan menyediakan
danapendamping).
3)

DanaBagiHasil(DBH)
Dana Bagi Hasil adalah dana yang bersumber dari pendapatan APBN yang
dialokasikan kepada daerah berdasarkan angka persentase tertentu yang
bersumberdari:

Pajak, terdiri atas Pajak Bumi dan Bangunan (PBB) dan Bea Perolehan
atasHakTanahdanBangunan(BPHTB),PajakPenghasilan(PPh)Pasal25
dan Pasal 29 Wajib Pajak Orang Pribadi Dalam Negeri, serta cukai hasil
tembakau.

Sumber daya alam, terdiri atas minyak dan gas bumi, kehutanan,
pertambangan umum, perikanan, pertambangan panas bumi, dan hasil
cukai.

4)

DanaOtonomiKhusus

Dana Otonomi Khusus Papua dan Papua Barat dan Dana Tambahan
Infrastruktur dalam rangka Otonomi Khusus Provinsi Papua dan Papua
Barat. Dana transfer ini dialokasikan berdasarkan UU Nomor 35 Tahun
2008tentangPenetapanPerpuNomor1Tahun2008tentangPerubahan
atas UU Nomor 21 Tahun 2001 tentang Otonomi Khusus bagi Provinsi
Papuamenjadiundangundang.

DanaOtonomiKhususAceh.Danatransferinidialokasikanberdasarkan
UUNomor11Tahun2006tentangPemerintahanAceh.

Dana Keistimewaan Daerah Istimewa Yogyakarta, yaitu dana yang


berasal dari Bagian Anggaran BUN yang dialokasikan untuk mendanai
Kewenangan Istimewa dan merupakan Belanja Transfer pada bagian
TransferLainnya.DanatransferinidialokasikanberdasarkanUUNomor
13Tahun2012.

34

2014 |Pusdiklatwas BPKP


5)

DanaPenyesuaian
Dana penyesuaian ditujukan untuk mendukung program/kebijakan tertentu
pemerintah yang berdasarkan peraturan perundangundangan, kegiatannya
sudahmenjadiurusandaerahyangmeliputi:

e.

TunjanganProfesiGuruPNSDaerah

DanaTambahanPenghasilanGuruPNSDaerah

DanaInsentifDaerah

DanaProyekPemerintahDaerahdanDesentralisasi

BantuanOperasionalSekolah

PengurusanUmum/PengurusanAdministrasi
Sebagaimana telah disebutkan sebelumnya, bahwa pengurusan umum atau
pengurusan administrasi mengandung unsur penguasaan, yang erat hubungannya
dengan penyelenggaraan tugas pemerintahan di segala bidang dan tindakannya
dapat membawa akibat pengeluaran dan atau menimbulkan penerimaan negara.
Dalam pengurusan umum terdapat dua pejabat atau subjek pengurusan, yang
disebutotorisatordanordonator.
1)

Otorisator
Otorisator adalah pejabat yang memperoleh pelimpahan wewenang untuk
mengambil tindakantindakan yang mengakibatkan adanya penerimaan
dan/ataupengeluarannegara.
Tindakantindakan otorisator yang bisa berakibat penerimaan dan/atau
pengeluarantersebutdisebutotorisasi.
Otorisasidapatdibedakanmenjadidua,yaitu:

Manajemen Pemerintahan Pusat

35


a)

Otorisasibersifatluas/umum
Otorisasi bersifat luas/umum adalah otorisasi yang tidak membawa
akibatlangsungpadapengeluarandanataupenerimaannegara.Contoh
otorisasi umum adalah undangundang, peraturan pemerintah,
peraturan pemerintah pengganti undangundang, keputusan presiden,
instruksi presiden, peraturan gaji pegawai negeri, peraturan pemberian
tunjangan, dan sebagainya. Otorisasi umum baru akan berakibat
pengeluaran dan/atau penerimaan, apabila sudah ada/dilengkapi
otorisasiyangbersifatkhusus.

b)

Otorisasibersifatsempit/khusus.
Otorisasibersifatsempit/khususadalahotorisasiyangmempunyaiakibat
langsung terhadap penerimaan dan/atau pengeluaran negara. Contoh
otorisasi khusus adalah surat keputusan pengangkatan pegawai, surat
keputusan penunjukan bendahara, surat keputusan pensiun, dan
sebagainya.

2)

Ordonator
Ordonator adalah pejabat yang berwenang untuk melakukan pengujian dan
pembebanan tagihan yang diajukan kepada kementerian negara/lembaga
sehubungan dengan tindakan otorisator, serta memerintahkan pembayaran
dan atau menagih penerimaan yang timbul sebagai akibat pelaksanaan
anggaran.Secaragarisbesar,ordonatorbertugasuntukmenguji,meneliti,dan
mengawasi penerimaanpenerimaan, serta pengeluaranpengeluaran negara,
termasuktagihantagihanyangdiajukanolehpihakketigakepadapemerintah,
apakah benarbenar telah sesuai dengan otorisasi yang dikeluarkan oleh
otorisator dan belum kedaluwarsa. Apabila tagihantagihan tersebut telah
memenuhi persyaratan, maka ordonator menerbitkan Surat Perintah
Membayar(SPM)dan/atauSuratPenagihan.

36

2014 |Pusdiklatwas BPKP


f.

PengurusanKhusus/Kebendaharaan/Comptable
Sebagaimana disebutkan dalam UU Nomor 1 Tahun 2004 Pasal 7 ayat (1),
kewenangan pengurusan khusus atau pengurusan kebendaharaan (comptable)
dipegang oleh menteri keuangan, sebagaimana disebutkan: Menteri Keuangan
adalahBendaharaUmumNegara(BUN).
TugaskebendaharaanyangdilaksanakanBUNmeliputi:
1)

menetapkankebijakandanpedomanpelaksanaananggarannegara;

2)

mengesahkandokumenpelaksanaananggaran;

3)

melakukanpengendalianpelaksanaananggarannegara;

4)

menetapkansistempenerimaandanpengeluarankasnegara;

5)

menunjukbankdan/ataulembagakeuanganlainnyadalamrangka

6)

pelaksanaanpenerimaandanpengeluarananggarannegara;

7)

mengusahakan dan mengatur dana yang diperlukan dalam pelaksanaan


anggarannegara;

8)

menyimpanuangnegara;

9)

menempatkanuangnegaradanmengelola/menatausahakaninvestasi;

10)

melakukanpembayaranberdasarkanpermintaanpejabatPenggunaAnggaran
atasbebanrekeningkasumumnegara;

11)

melakukanpinjamandanmemberikanjaminanatasnamapemerintah;

12)

memberikanpinjamanatasnamapemerintah;

13)

melakukanpengelolaanutangdanpiutangnegara;

14)

mengajukan rancangan peraturan pemerintah tentang standar akuntansi


pemerintahan;

Manajemen Pemerintahan Pusat

37


15)

melakukanpenagihanpiutangnegara;

16)

menetapkansistemakuntansidanpelaporankeuangannegara;

17)

menyajikaninformasikeuangannegara;

18)

menetapkan kebijakan dan pedoman pengelolaan serta penghapusan barang


miliknegara;

19)

menentukan nilai tukar mata uang asing terhadap rupiah dalam rangka
pembayaranpajak;

20)

menunjukpejabatKuasaBendaharaUmumNegara.

Selaku BUN, menteri keuangan mengangkat kuasa BUN untuk melaksanakan tugas
kebendaharaan dalam rangka pelaksanaan anggaran dalam wilayah kerja yang
ditetapkan. Tugas kebendaharaan yang dimaksud meliputi kegiatan menerima,
menyimpan,

membayar

atau

menyerahkan,

menatausahakan,

dan

mempertanggungjawabkan uang dan surat berharga yang berada dalam


pengelolaannya,termasukmelakukanpengendalianpelaksanaananggarannegara.
KuasaBUNberkewajiban:
1)

memerintahkan penagihan piutang negara kepada pihak ketiga sebagai


penerimaananggaran;dan

2)

melakukanpembayarantagihanpihakketigasebagaipengeluarananggaran.

Untuk melaksanakan tugastugas kebendaharaan dalam rangka pelaksanaan


anggaranpendapatan/belanjapadakantor/satuankerjadilingkungankementerian
negara/lembaga,menteri/pimpinanlembagamengangkatbendaharapenerimaan/
pengeluaran. Tugas kebendaharaan tersebut meliputi kegiatan menerima,
menyimpan,

menyetor/membayar/menyerahkan,

menatausahakan,

dan

mempertanggungjawabkanpenerimaan/pengeluaranuangdansuratberhargayang
beradadalampengelolaannya.
Bendahara pada satker dibedakan dalam bendahara khusus penerimaan dan
bendahara pengeluaran. Bendahara khusus penerimaan bertugas melakukan

38

2014 |Pusdiklatwas BPKP


penerimaan atas pendapatan negara dan selanjutnya menyetorkan ke kas negara.
Bendaharainiseringdisebutjugapenyetortetapataupenyetorberkalakarena
dariuangyangditerimanyapadawaktuyangtetapharusdisetorkankekasnegara.
ContohbendaharajenisiniadalahBendaharaPenerimaBeaDanCukai,bendahara
penerimapadakementerian/lembaganegarayangmengelolaPNBPantaralaindari
hasil pertanian, kehutanan, penjualan jasa, sita, denda, dan sebagainya. Secara
periodik, bendahara ini membuat surat pertanggungjawaban tentang uang yang
diterimadandisetorkannyameskipuntidakadauangyangharusdisetor(tidakada
penerimaan).
Bendahara khusus pengeluaran bertugas melakukan pembayaran atas tagihan
kepadanegarabaiksecaralangsungmaupunmelaluiuangpersediaandengandana
yangdiperolehnyamelaluiDIPAataudokumenlainyangdipersamakan.
Beberapaketentuanyangberkaitandenganbendahara,yaitu:
1)

bendahara penerimaan dan bendahara pengeluaran diangkat oleh menteri/


pimpinanlembagamelaluisuratkeputusan;

2)

bendaharapenerimaandanbendaharapengeluaranadalahpejabatfungsional
dantidakbolehdirangkapolehKuasaPenggunaAnggaranatauKuasaBUN;

3)

bendaharapenerimaan/pengeluarandilarangmelakukan,baiksecaralangsung
maupun tidak langsung, kegiatan perdagangan, pekerjaan pemborongan dan
penjualan jasa, atau bertindak sebagai penjamin atas kegiatan/
pekerjaan/penjualantersebut;

4)

persyaratan pengangkatan dan pembinaan karir bendahara diatur oleh BUN


selakuPembinaNasionalJabatanFungsionalBendahara.
~

Manajemen Pemerintahan Pusat

39

40

2014 |Pusdiklatwas BPKP

BabIII
PERENCANAANDANPENGANGGARAN

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenai
prosesperencanaandanpenganggaran(6.3).

Dalam manajemen pemerintahan, kegiatan perencanaan dan penganggaran merupakan salah


satu tahapan dari siklus Anggaran Pendapatan dan Belanja Negara (APBN) sebagaimana pada
Gambar3.2berikut.
Gambar3.1SiklusAPBN

Dari lima tahapan dalam siklus tersebut, pemerintah menjalankan tiga tahapan yaitu
perencanaan, pelaksanaan, dan pertanggungjawaban. Dalam tahapan perencanaan terdapat
fungsi perencanaan itu sendiri, pengorganisasian, dan pengendalian dengan tujuan
mendapatkan hasil perencanaan yang optimal berdasarkan sumber daya yang dimiliki. Pada
tahapan pelaksanaan terdapat fungsi pengorganisasian, penggerakan pelaksanaan, dan
pengendalian dengan tujuan terlaksananya rencana yang telah ditetapkan secara optimal
Manajemen Pemerintahan Pusat

41


dengan hasil yang dapat dipertanggungjawabkan. Sedangkan tahapan pertanggungjawaban
dapatdipenuhidenganbaikapabilatahapanperencanaandanpelaksanaanbisadilaluidengan
baik.

A.

PERENCANAAN

Perencanaanadalahsuatuprosesuntukmenentukantindakanmasadepanyangtepat,melalui
urutan pilihan, dengan memperhitungkan sumber daya yang tersedia. Berdasarkan Undang
UndangNomor25Tahun2004ditetapkanSistemPerencanaanPembangunanNasional(SPPN)
yang merupakan satu kesatuan tata cara perencanaan pembangunan untuk menghasilkan
rencanarencana pembangunan dalam jangka panjang, jangka menengah, dan tahunan yang
dilaksanakan oleh unsur penyelenggara negara dan masyarakat di tingkat Pusat dan Daerah
dalamrangkamenjamintercapainyatujuandalambernegara.
SPPNdiselenggarakandalamrangkamencapaitujuansebagaiberikut.
1.

Menjamin adanya koordinasi di antara pelaku pembangunan, baik di tingkat pusat,


hubunganantarapusatdengandaerahmaupunhubunganantardaerah.

2.

Menjamin terciptanya integrasi, sinkronisasi, dan sinergi baik antardaerah, antarruang,


antarwaktu,antarfungsipemerintahmaupunantarapusatdandaerah.

3.

Menjamin keterkaitan dan konsistensi antara perencanaan, penganggaran, pelaksanaan,


danpengawasan.

4.

Mengoptimalkanpartisipasimasyarakat.

5.

Menjamintercapainyapenggunaansumberdayasecaraefisien,efektif,berkeadilan,dan
berkelanjutan.

AdapuncakupanSPPNsebagaimanaTabel3.1berikut.

42

2014 |Pusdiklatwas BPKP


Tabel3.1CakupanSPPN

No

Dokumen

JangkaWaktu

PenanggungJawab
Penyusunan

Pengesahan

1. RPJPNasional

Panjang(periode20
tahun)

Presidendibantu
MenteriPPN/Kepala
BAPPENAS

UndangUndang
(olehDPR)

2. RPJMNasional

Menengah(periode5
tahun)

Presiden

PeraturanPresiden

Menteri/Pimpinan
Lembaga

PeraturanMenteri

Presiden

PeraturanPresiden

Menteri/Pimpinan
Lembaga

PeraturanMenteri

3. RenstraK/L
4. RKP
5. RenjaK/L

Pendek(periode1
tahun)

1.

RencanaPembangunanJangkaPanjang(RPJP)
RPJPadalahdokumenperencanaanuntukperiodeduapuluhtahun.SaatiniPemerintah
sedangmenjalankanRPJPNasionaluntukperiodetahun2005sampaidengan2025.RPJP
NasionalmerupakanpenjabarandaritujuandibentuknyapemerintahannegaraIndonesia
yang tercantum dalam Pembukaan UUD Negara Republik Indonesia Tahun 1945, yaitu
untuk melindungi segenap bangsa dan seluruh tumpah darah Indonesia, memajukan
kesejahteraan umum, mencerdaskan kehidupan bangsa, dan ikut melaksanakan
ketertiban dunia yang berdasarkankemerdekaan, perdamaian abadi, dan keadilansosial
dalambentukrumusanvisi,misidanarahpembangunannasional.
Proses penyusunan RPJP dilakukan secara partisipatif dengan melibatkan seluruh unsur
pelakupembangunan.PenyusunanRPJPdilakukandalam4tahap,yaitu:
a.

penyiapan rancangan RPJP. Kegiatan ini dibutuhkan guna mendapatkan gambaran


awaldarivisi,misi,danarahpembangunannasional;

b.

musyawarah Perencanaan Pembangunan (Musrenbang) jangka panjang yang


dilaksanakan untuk mendapatkan masukan dan komitmen dari seluruh pemangku
kepentingan/stakeholdersterhadaprancanganRPJP;

c.

penyusunan rancangan akhir RPJP, di mana seluruh masukan dan komitmen hasil
Musrenbangmenjadimasukanutamapenyempurnaanrancangan;dan

Manajemen Pemerintahan Pusat

43


d.

penetapan undangundang tentang RPJP di bawah koordinasi kementerian yang


bertanggungjawabterhadappelaksanaantugasdanfungsihukum.Rancanganakhir
RPJP beserta lampirannya disampaikan kepada DPR sebagai inisiatif Pemerintah,
untukdiproseslebihlanjutmenjadiUndangUndangtentangRPJPNasional.

RPJP Nasional Tahun 2005 2025 ditetapkan berdasarkan UndangUndang Nomor 17


Tahun2007,yangdisusundalamtataurutsebagaiberikut.

BabIPendahuluan

BabIIKondisiUmum

BabIIIVisidanMisiPembangunanNasionalTahun20052025

BabIVArah,Tahapan,danPrioritasPembangunanJangkaPanjangTahun20052025

BabVPenutup

Visipembangunannasionaltahun20052025adalahIndonesiayangMandiri,Maju,Adil
danMakmur.Dalammewujudkanvisipembangunannasionaltersebutditempuhdelapan
misipembangunannasionalsebagaiberikut:

mewujudkan masyarakat berakhlak mulia, bermoral, beretika, berbudaya, dan


beradabberdasarkanfalsafahPancasila;

mewujudkanbangsayangberdayasaing;

mewujudkanmasyarakatdemokratisberlandaskanhukum;

mewujudkanIndonesiaaman,damai,danbersatu;

mewujudkanpemerataanpembangunandanberkeadilan;

mewujudkanIndonesiaasridanlestari;

mewujudkan Indonesia menjadi negara kepulauan yang mandiri, maju, kuat, dan
berbasiskankepentingannasional;

44

mewujudkanIndonesiaberperanpentingdalampergaulanduniainternasional.

2014 |Pusdiklatwas BPKP


2.

RencanaPembangunanJangkaMenengah(RPJM)Nasional
RPJM adalah dokumen perencanaan untuk periode 5 (lima) tahun. RPJM Nasional
merupakan penjabaran dari visi, misi, dan program kepala negara terpilih yang wajib
disusun dalam waktu tiga bulan setelah dilantik. Dalam penyusunannya, RPJM Nasional
harus berpedoman pada RPJP nasional, yang memuat strategi pembangunan nasional,
kebijakanumum,programbaikdidalammaupunlintaskementerian/lembaga,dalamsatu
maupunlintaskewilayahan,sertakerangkaekonomimakro.Termasukdidalamnyaadalah
arah kebijakan fiskal dalam rencana kerja yang berupa kerangka regulasi dan kerangka
pendanaanyangbersifatindikatif.
TahapanpenyusunanRPJMadalahsebagaiberikut.
a.

PenyiapanrancanganawalRPJMNasionalolehKementerianPerencanaan/Bappenas
sebagai lembaga yang bertanggung jawab mengkoordinasikan perencanaan
pembangunansecaranasional.

b.

Penyiapan rancangan rencana strategis kementerian/lembaga (rancangan Renstra


K/L),yangdilakukanolehseluruhkementeriandanlembaga.Penyusunanrancangan
renstra ini bertujuan untuk merumuskan visi, misi, tujuan, strategi, kebijakan,
program dan kegiatan pembangunan yang sesuai dengan tugas dan fungsi
kementerian/lembagaagarselarasdenganprogramprioritaskepalanegaraterpilih.

c.

Penyusunan rancangan RPJM Nasional oleh kementerian perencanaan/Bappenas.


Tahap ini merupakan upaya mengintegrasikan rancangan awal RPJM Nasional
denganrancanganrenstraK/L,yangmenghasilkanrancanganRPJMNasional.

d.

Penyelenggaraan Musyawarah Perencanaan Pembangunan (Musrenbang) Jangka


Menengah Nasional. Kegiatan yang dilaksanakan paling lambat dua bulan setelah
presiden dilantik ini dilaksanakan guna memperoleh berbagai masukan dan
komitmendariseluruhpemangkukepentingan(stakeholders)atasrancanganRPJM
Nasional.

e.

Penyusunan Rancangan Akhir RPJM Nasional, dimana seluruh masukan dan


komitmen hasil Musrenbang Jangka Menengah Nasional menjadi masukan utama
penyempurnaanRancanganRPJMNasional.

Manajemen Pemerintahan Pusat

45


f.

Penetapan Peraturan Presiden tentang RPJM Nasional, di bawah koordinasi


kementerian yang bertanggung jawab terhadap pelaksanaan tugas dan fungsi di
bidanghukumdanperundangundangan.

RPJMmerupakanprodukperencanaanyangdibuatpresidenselakukepalapemerintahan
dalamperiodejabatanselamalimatahun.RPJMNasionaltahun2010sampaidengan2014
ditetapkan berdasarkan Peraturan Presiden Nomor 5 Tahun 2010. RPJMN 20102014
merupakan tahap kedua dari pelaksanaan RPJPN 20052025. RPJMN 20102014 ini
selanjutnya menjadi pedoman bagi kementerian/lembaga dalam menyusun Rencana
Strategis Kementerian/Lembaga (RenstraK/L) dan menjadi bahan pertimbangan
pemerintah daerah dalam menyusun/menyesuaikan rencana pembangunan daerahnya
masingmasingdalamrangkapencapaiansasaranpembangunannasional.
RPJMN 20102014 disusun dalam tiga buku yang merupakan satu kesatuan yang utuh
denganmasingmasingmemuathalhalsebagaiberikut:

Buku I memuat strategi, kebijakan umum, dan kerangka ekonomi makro yang
merupakan penjabaran dari Visi, Misi, dan Program Aksi serta sebelas prioritas
pembangunan nasional dari PresidenWakil Presiden, Susilo Bambang Yudhoyono
Boediono dengan visi: Terwujudnya Indonesia yang Sejahtera, Demokratis, dan
Berkeadilan.

Buku II memuat rencana pembangunan yang mencakup bidangbidang kehidupan


masyarakat sebagaimana yang tertuang dalam RPJPN 20052025 dengan tema:
Memperkuat Sinergi Antarbidang Pembangunan dalam rangka mewujudkan visi
pembangunannasionalyangtercantumdalamBukuI.

Buku III memuat rencana pembangunan kewilayahan yang disusun dengan tema:
Memperkuat Sinergi Antara Pusat dan Daerah dan Antardaerah dalam rangka
mewujudkanvisipembangunannasionalyangtercantumdalamBukuI.

3.

RencanaPembangunanTahunan/RencanaKerjaPemerintah(RKP)
Rencana Pembangunan Tahunan Nasional, yang selanjutnya disebut Rencana Kerja
Pemerintah(RKP),adalahdokumenperencanaannasionaluntukperiodesatutahun.RKP
merupakanpenjabarandariRPJMNasionalyangberisiprioritaspembangunan,rancangan

46

2014 |Pusdiklatwas BPKP


kerangka ekonomi makro yang mencakup gambaran perekonomian yang menyeluruh
termasuk kebijakan fiskal, program K/L, lintas K/L, dan kewilayahan dalam bentuk
kerangkaregulasidankerangkapendanaanyangmasihbersifatindikatifdalamkerangka
waktutahunan.
TahapanpenyusunanRKPadalahsebagaiberikut.
a.

PenyiapanrancanganawalRKPsebagaipenjabaranRPJMNasional.

b.

Penyiapan rancangan RenjaKL sesuai dengan tugas pokok dan fungsinya dengan
mengacukepadarancanganawalRKP.

c.

Bappenas mengkoordinasikan penyusunan rancangan RKP dengan menggunakan


rancanganRenjaKL.

d.

MusyawarahPerencanaanPembangunan(Musrenbang).
1)

PenyusunanrancanganakhirrencanakerjaberdasarkanhasilMusrenbang.

2)

PenetapanRKPdalambentukperaturanpresiden.

RKP Tahun 2014 telah ditetapkan pada tanggal 17 Mei 2013 dengan Peraturan Presiden
Nomor39Tahun2013,yangmerupakanpenjabarandariRPJMNasionalTahun20102014.
RKP Tahun 2014 memuat Rancangan Kerangka Ekonomi Makro tahun 2014, serta
prioritaspembangunan, rencana kerja danpendanaannya, dengan Visi Indonesia tahun
2014 yaituIndonesia yang Sejahtera, Demokratis, dan Berkeadilan. Adapun tema
pembangunannasionalyaituTahun2014adalahMemantapkanPerekonomianNasional
BagiPeningkatanKesejahteraanRakyatyangBerkeadilan.
RKP2014terdiriatas3(tiga)bukuyaitu:
a.

BukuItentangPrioritasPembangunandanKerangkaEkonomiMakro,

b.

BukuIItentangPrioritasPembangunanBidang,dan

c.

BukuIIItentangRencanaPembangunanBerdimensiKewilayahan.

Sasaran Utama Pembangunan Nasional 20102014 yang harus dicapai pada tahun 2014
adalahsebagaiberikut.

Manajemen Pemerintahan Pusat

47


a.

Dalam rangka meningkatkan kesejahteraan rakyat, dengan pertumbuhan ekonomi


pada kisaran 6,9 persen, pengangguran terbuka ditargetkan menurunmenjadi 5,6
5,9persen,dantingkatkemiskinanmenjadi9,010,0persen.

b.

Dalam rangka pembangunan demokrasi, Indeks Demokrasi Indonesia mencapai


kisaran6870.

c.

Dalam rangka pembangunan hukum, Indeks Persepsi Korupsi Indonesia mencapai


4,0.

4.

RencanaStrategisKementerian/Lembaga(RenstraK/L)
Sebagai penjabaran RPJM Nasional, Kementerian/Lembaga sebagai lembaga pembantu
Kepala

Negara/Presiden

selanjutnya

menyusun

rencana

strategis

(Renstra)

kementerian/lembaga(K/L)yangmemuatvisi,misi,tujuan,strategi,kebijakan,program,
dan kegiatan pembangunan yang disusun sesuai dengan tugas dan fungsi K/L serta
berpedomankepadaRPJMdanbersifatindikatif.
TahapanpenyusunanrenstraK/Ladalahsebagaiberikut.
a.

Mempelajarivisi,misi,danprogramkepalanegaraterpilihterhadaptugasdanfungsi
kementerian/lembaga yang dipimpinnya. Dalam hal ini menteri/kepala lembaga
mengkaji implikasi visi, misi, dan program presiden terpilih terhadap tugas pokok
danfungsiK/Lyangdipimpinnyadalambentuk:
1)

memberikan penilaian keterkaitan visi, misi, dan program dalam Renstra K/L
padaperiodelalu;

2)

mengidentifikasikan program presiden terpilih terhadap capaian kinerja


programK/Lperiodesebelumnya;dan

3)
b.

membuatkesimpulan.

MenyusunRancanganRenstraK/LdenganberpedomanpadaRancanganAwalRPJM
Nasional.

48

2014 |Pusdiklatwas BPKP


5.

RencanaKerjaKementerian/Lembaga(RenjaK/L)
RenjaK/L merupakan implementasi rencana pembangunan tahunan kementerian/
lembagadalambentukdokumenperencanaankementerian/lembagauntukperiodesatu
tahun. RenjaK/L disusun berpedoman pada RenstraK/L yang telah ada lebih dulu dan
mengacupadaprioritaspembangunannasional.Karenasalingterkait,penyusunanRenja
K/LdilakukansecarabersamaandenganpenyusunanRKP.

B.

PENGANGGARAN

1.

Pengertian
JohnF.DuedalamGovernmentFinanceandEconomicAnalysismendefinisikananggaran
negara(statebudget)sebagaiberikut.
Abudget,inthegeneralsenseoftheterm,isafinancialplanforaspesificperiodof
time.Agovernmentbudgettherefore,isastatementofproposedexpendituresand
expectedrevenuesforthecomingperiod,togetherwithdataofactualexpenditures
andrevenuesforcurrentandpastperiod.
Pada intinya, anggaran merupakan rencana keuangan untuk kurun waktu tertentu.
Anggaran negara merupakan rencana pendapatan dan belanja untuk periode tahun
berikutnya dan dilengkapi dengan realisasi untuk periode saat ini dan periode
sebelumnya.
Menurut Wildavsky (1975), anggaran adalah catatan masa lalu, rencana masa depan,
mekanisme pengalokasian sumber daya, metode untuk pertumbuhan, alat penyaluran
pendapatan,mekanismeuntuknegosiasi,harapanaspirasistrategiorganisasi,satubentuk
kekuatankontrol,danalatataujaringankomunikasi.
Sedangkan pengertian penganggaran (sektor publik) terkait dengan proses penentuan
jumlah alokasi dana untuk tiaptiap program dan aktivitas dalam satuan moneter
(Mardiasmo,2009).
Berdasarkan pengertianpengertian tersebut di atas, penganggaran negara merupakan
proses penentuan rencana keuangan mendatang yang berisi pendapatan dan belanja,
gambaran strategi pemerintah dalam pengalokasian sumber daya untuk pembangunan,
alat pengendalian, instrumen politik, dan disusun dalam periode tertentu. Anggaran

Manajemen Pemerintahan Pusat

49


negaradiIndonesiadiwujudkandalamAnggaranPendapatandanBelanjaNegara(APBN)
yang menurut UndangUndang Nomor 17 Tahun 2003 merupakan rencana keuangan
tahunanpemerintahannegarayangdisetujuiolehDewanPerwakilanRakyat.
2.

PrinsipprinsipPenganggaran
Secaraumum,prinsipprinsippenganggaranadalahsebagaiberikut.
a.

TransparansidanAkuntabilitasAnggaran
APBNharusdapatmenyajikaninformasiyangjelasmengenaitujuan,sasaran,hasil
dan manfaat yang diperoleh masyarakat dari suatu progam dan kegiatan yang
dianggarkan.

b.

DisiplinAnggaran
Penyusunananggaranhendaknyadilakukanberlandaskanasasefisiensi,tepatguna,
tepat waktu, dan dapat dipertanggungjawabkan. Pendapatan yang direncanakan
merupakanperkiraanyangterukursecararasionalyangdapatdicapaiuntuksetiap
sumber pendapatan, sedangkan belanja yang dianggarkan pada setiap pos/pasal
merupakan batas tertinggi pengeluaran belanja. Penganggaran pengeluaran harus
didukungdenganadanyakepastiantersediapenerimaandalamjumlahyangcukup
dantidakdibenarkanmelaksanakanprogamdankegiatanyangbelum/tidaktersedia
anggarannya.

c.

KeadilanAnggaran
Pemerintah wajib mengalokasikan penggunaan anggaran secara adil agar dapat
dinikmati oleh seluruh kelompok masyarakat tanpa diskriminasi dalam pemberian
pelayanan.

d.

EfisiensidanEfektivitasAnggaran
Danayangtersediaharusdimanfaatkansebaikmungkinuntukdapatmenghasilkan
peningkatandankesejahteraanyangmaksimaluntukkepentinganmasyarakat.

50

2014 |Pusdiklatwas BPKP


e.

Disusundenganpendekatankinerja
APBN disusun dengan pendekatan kinerja,yaitu mengutamakan upaya pencapaian
hasil kerja (keluaran dan hasil) dari perencanaan atas alokasi biaya atau
masukan/input yang telah ditetapkan. Hasil kerja harus sepadan atau lebih besar
dari biaya atau masukan dan mampu menumbuhkan profesionalisme kerja pada
setiapunitkerjayangterkait.

3.

Hubungandokumenperencanaandenganpenganggaran
Hubungan dokumen perencanaan dengan penganggaran dapat dilihat pada Gambar 3.1
berikut.
Gambar3.2KeterkaitanPerencanaandanPenganggaran

APBN memiliki kerangka waktu tahunan yang sepadan dengan dokumen perencanaan
RKP. Penganggaran terkait dengan dengan proses penentuan jumlah alokasi dana untuk
tiaptiapprogramdankegiatanyangtelahditetapkandalamdokumenperencanaanRKP.
DengandemikianRKPmerupakanarahpenyusunanAPBN.
4.

AnggaranPendapatandanBelanjaNegara
Anggaran Pendapatan dan Belanja Negara (APBN) adalah adalah rencana keuangan
tahunanpemerintahannegarayangdisetujuiolehDewanPerwakilanRakyat.APBNterdiri

Manajemen Pemerintahan Pusat

51


dari pendapatan, belanja, dan pembiayaan. Anggaran pendapatan merupakan estimasi
pendapatanyangmungkindicapaidalamperiodeyangbersangkutan.
a.

FungsiAPBN
SebagaimanadisebutkandalamPasal3ayat(4)UUNomor17Tahun2003tentang
KeuanganNegara,APBNmemilikifungsifungsisebagaiberikut.
1)

Fungsi otorisasi, yaitu APBN merupakan dasar untuk melaksanakan


pendapatandanbelanjapadatahunyangbersangkutan.

2)

Fungsiperencanaan,yaituAPBNmerupakanpedomanbagimanajemendalam
merencanakankegiatanpadatahunyangbersangkutan.

3)

Fungsi pengawasan, yaitu APBN menjadi pedoman untuk menilai apakah


kegiatan penyelenggaraan pemerintah sesuai dengan ketentuan yang telah
ditetapkan.

4)

Fungsi alokasi, yaitu APBN diarahkan untuk mengurangi pengangguran dan


pemborosan sumber daya, meningkatkan efisiensi dan efektivitas
perekonomian.

5)

Fungsi distribusi, yaitu APBN harus memperhatikan rasa keadilan dan


kepatutan.

6)

Fungsi stabilisasi, yaitu APBN harus menjadi alat untuk memelihara dan
mengupayakankeseimbanganfundamentalperekonomian.

b.

PendekatandalamPenyusunanAPBN
PenyusunanAPBNmenggunakantigapendekatansebagaiberikut:
1)

PendekatanPenganggaranTerpadu(UnifiedBudgeting).
Penyusunan

anggaran

dilakukan

dengan

mengintegrasikan

proses

perencanaan dan penganggaran di lingkungan kementerian/lembaga untuk


menghasilkandokumenrencanakerja,dengantidakadalagidikotomiantara
anggaranbelanjarutindananggaranbelanjapembangunan.Dengandemikian,

52

2014 |Pusdiklatwas BPKP


penganggaran menjadi lebih terarah karena dikaitkan langsung dengan
perencanaanprogram/kegiatan.
Dalam kaitan dengan menghitung biaya input dan menaksir kinerja program
sangatpentinguntukmelihatsecarabersamasamabiayasecarakeseluruhan,
baik yang bersifat investasi maupun biaya yang bersifat operasional.
Memadukan (unifying) anggaran sangat penting untuk memastikan bahwa
investasi dan biaya operasional yang berulang (recurrent) dipertimbangkan
secara simultan pada saatsaat pengambilan keputusan dalam siklus
penganggaran.
2)

PendekatanPenganggaranBerbasisKinerja(ABK).
Penyusunan anggaran berorientasi pada pencapaian keluaran dan hasil yang
terukur(kinerja).Disampingitu,dalammerealisasikansuatuanggaranuntuk
membiayai program/kegiatan harus memperhatikan prinsip efisiensi dan
efektivitas. Efisien diukur dengan membandingkan antara input (misalnya
dana) yang digunakan dengan keluaran (output) yang diperoleh. Sedangkan
efektivitas diukur dengan menilai apakah keluaran dapat berfungsi
sebagaimana diharapkan sehingga mendatangkan hasil (outcome) yang
diinginkan. Dengan demikian, dalam anggaran berbasis kinerja, tujuan dan
indikator kinerja dari suatu program/kegiatan harus ditentukan dengan jelas
dan terukur untuk mendukung perbaikan efisiensi dan efektivitas dalam
pemanfaatan sumber daya dan memperkuat proses pengambilan keputusan
tentangkebijakandalamkerangkajangkamenengah.

3)

PendekatanPenganggarandenganPerspektifJangkaMenengah(PPJM).
Penyusunan anggaran dengan perspektif jangka menengah memberikan
kerangka yang menyeluruh, meningkatkan keterkaitan antara proses
perencanaandanpenganggaran,mengembangkandisiplinfiskal,mengarahkan
alokasi sumber daya agar lebih rasional dan strategis, dan meningkatkan
kepercayaan masyarakat kepada Pemerintah dengan pemberian pelayanan
yangoptimaldanlebihefisien.

Manajemen Pemerintahan Pusat

53


Denganmelakukanproyeksijangkamenengah,dapatdikurangiketidakpastian
di masa yang akan datang dalam penyediaan dana untuk membiayai
pelaksanaan berbagai inisiatif kebijakan baru dalam penganggaran tahunan
tetapdimungkinkan,tetapipadasaatyangsamaharuspuladihitungimplikasi
kebijakan baru tersebut dalam konteks keberlanjutan fiskal dalam jangka
menengah (medium term fiskal sustainability). Cara ini juga memberikan
peluang kepada kementerian teknis/lembaga selaku pengguna anggaran dan
kementerian keuangan selaku BUN untuk melakukan analisis apakah perlu
melakukanperubahanterhadapkebijakanyangada,termasukmenghentikan
programprogram yang tidak efektif, agar kebijakankebijakan baru dapat
diakomodasikan.
Denganmemusatkanperhatianpadakebijakankebijakanyangdapatdibiayai,
diharapkan dapat tercapainya disiplin fiskal, yang merupakan kunci bagi
tingkat kepastian ketersediaan sumber daya untuk membiayai kebijakan
kebijakanprioritas.Sebagaikonsekuensidarimenempuhprosespenganggaran
denganperspektifjangkamenengahsecaradisiplin,manajemenmendapatkan
imbalandalambentukkeleluasaanpadatahapimplementasidalamkerangka
kinerjayangdijagadenganketat.
c.

MekanismePenyusunanAPBN
Rancangan APBN merupakan gabungan dari RKAK/L, yaitu dokumen rencana
keuangan tahunan Kementerian Negara/Lembaga yang disusun menurut bagian
anggaran Kementerian Negara/Lembaga. Mekanisme penyusunan APBN dapat
dilihatpadaGambar3.3berikut.

54

2014 |Pusdiklatwas BPKP


Gambar3.3ProsesPenyusunanAPBN

UUAPBN

5
4

DewanPerwakilanRakyat

Usulan
Anggaran
RKA

UUAPBN

RAPBN

2
8

KementerianTeknis

7
KebijakanUmum
&Prioritas
Anggaran

PokokKebijakan
Fiskal&Kerangka
Ekon.Makro

Surat
Edaran

KementerianKeuangan

3
6

Usulan
Anggaran

PenjelasanprosespenyusunanAPBNdapatdijelaskansebagaiberikut:
1)

Pemerintah menyusun kebijakan fiskal dan kerangka ekonomi makro untuk


dibahas dengan DPR. Pembahasan tersebut menghasilkan kebijakan umum
dan prioritas anggaran yang akan diedarkan kepada kemeterian teknis/
lembagasebagaiacuandalampenyusunanRKAK/L.

2)

Denganmengacupadakebijakanumumdanprioritasanggaran,kementerian
teknis/lembaga menyusun RKAK/L yang selanjutnya dibahas dengan DPR.
HasilpembahasanRKAK/Lmenjadiusulananggaranyangakandiproseslebih
lanjutolehkementerianteknissebagaiusulananggaranK/Lyangdisampaikan
kepadaMenteriKeuangan.

3)

Berdasarkan usulan anggaran dari kementerian teknis/lembaga, Kementerian


Keuangan melakukan penelaahan dan menyatukannya ke dalam rancangan
APBN yang selanjutnya disampaikan kepada DPR untuk dimintai
persetujuannyadanditetapkanmenjadiUndangUndangAPBN.

Manajemen Pemerintahan Pusat

55


4)

Selambatlambatnya pada akhir bulan Oktober, DPR sudah harus menyetujui


RUUAPBNmenjadiUUAPBNuntuktahunanggaranberikutnya.

d.

StrukturAPBN
StrukturAPBNmerupakansatukesatuanyangterdiridaripendapatan,belanja,dan
pembiayaan.
1)

Pendapatan
Pendapatan negara adalah hak pemerintah pusat yang diakui sebagai
penambah nilai kekayaan bersih. Pendapatan dalam APBN terdiri atas
penerimaan perpajakan, penerimaan negara bukan pajak (PNBP), dan
penerimaanhibah.

2)

Belanja
Belanja negara adalah kewajiban pemerintah pusat yang diakui sebagai
pengurang nilai kekayaan bersih. Belanja dalam APBN terdiri atas anggaran
belanjapemerintahpusat;dananggarantransferkedaerah.

3)

Pembiayaan
Pembiayaan adalah setiap penerimaan yang perlu dibayar kembali dan/atau
pengeluaran yang akan diterima kembali, baik pada tahun anggaran yang
bersangkutan maupun tahuntahun anggaran berikutnya. Komponen
pembiayaan mencakup pembiayaan dalam negeri dan luar negeri sebagai
berikut:
a)

Pembiayaandalamnegeri
(1)

Perbankandalamnegeri
(a)

Penerimaancicilanpengembalianpenerusanpinjaman

(b)

SaldoAnggaranLebih(SAL)

56

2014 |Pusdiklatwas BPKP


(2)

Nonperbankandalamnegeri
(a)

Hasilpengelolaanaset

(b)

Suratberharganegaraneto

(c)

Pinjaman dalam negeri neto (penarikan pinjaman


pembayarancicilanpokok)

b)

(d)

DanainvestasiPemerintah

(e)

Danapengembanganpendidikannasional

(f)

Kewajibanpenjaminan

(g)

Cadangan

Pembiayaanluarnegeri
(1)

Penarikanpinjamanluarnegeribruto

(2)

Penerusanpinjaman

(3)

Pembayarancicilanpokokutangluarnegeri

Surplus/defisit anggaran yang timbul karena selisih antara pendapatan


dengan belanja ditutup melalui pembiayaan neto. Pembiayaan neto
merupakan selisih lebih penerimaan pembiayaan terhadap pengeluaran
pembiayaan.Jumlahpembiayaannetoharusdapatmenutupdefisitanggaran.
ContohAPBNTahun2014ditetapkanberdasarkanUndangUndangNomor23
Tahun2013,denganringkasansebagaiberikut.

Manajemen Pemerintahan Pusat

57


Tabel3.2APBNTahun2014
(triliunrupiah)

PendapatanNegara

1.667,14

PenerimaanPerpajakan

1.280,39

PenerimaanBukanPajak

385,39

Hibah

1,36

BelanjaNegara

1.842,49

BelanjaPemerintahPusat

1.249,94

TransferkeDaerah

592,55

Pembiayaan

175,35

DalamNegeri

196,25

LuarNegeri

(20,90)


e.

KlasifikasiAPBN
Anggaran belanja merupakan batas tertinggi pengeluaran yang dapat dibebankan
pada APBN. Belanja diklasifikasikan menurut organisasi, fungsi, program dan
kegiatan, serta jenis belanja. Klasifikasi belanja menurut organisasi disesuaikan
dengansusunanorganisasipemerintahan.
Klasifikasibelanjamenurutfungsiterdiridari:
1)

pelayananumum,

7)

kesehatan,

2)

ketertibandankeamanan,

8)

pariwisatadanbudaya,

3)

pertahanan,

9)

agama,

4)

ekonomi,

10)

pendidikan,dan

5)

lingkunganhidup,

11)

perlindungansosial.

6)

perumahandanfasilitasumum,

Klasifikasibelanjamenurutprogramdankegiatandisesuaikandenganrencanakerja
masingmasingkementerian/lembaga.

58

2014 |Pusdiklatwas BPKP


Klasifikasibelanjamenurutjenisbelanjaterdiridari:

f.

1)

belanjapegawai,

5)

subsidi,

2)

belanjabarangdanjasa,

6)

hibah,

3)

belanjamodal,

7)

bantuansosial,dan

4)

bunga,

8)

belanjalainnya.

SiklusAnggaran
Siklus APBN terdiri dari perencanaan dan penganggaran, penetapan APBN,
pelaksanaan APBN, pemeriksaan pengelolaan dan tanggung jawab APBN, dan
pertanggungjawabanAPBNsebagaimanaGambar3.4berikut.
Gambar3.4KerangkaWaktuSiklusAPBN

PenjelasankerangkawaktusiklusAPBNdiatasadalahsebagaiberikut:
1)

PerencanaandanPenganggaran
Perencanaan dan penganggaran merupakan suatu rangkaian kegiatan yang
terintegrasi. Program yang akan dilaksanakan oleh pemerintah wajib
dituangkan dalam suatu rencana kerja. Ketentuan tentang perencanaan ini

Manajemen Pemerintahan Pusat

59


diatur dalam UndangUndang Nomor 25 Tahun 2004 tentang Sistem
Perencanaan Pembangunan Nasional. Rencana kerja terdiri dari RPJP untuk
masa 20 tahun, RPJM untuk masa 5 tahun, dan RKP untuk masa 1 tahun. Di
tingkat kementerian/lembaga untuk rencana jangka menengah disebut
RenstraKementerian/LembagadanuntukrencanakerjatahunandisebutRKA
KLsebagaimanadiaturdalamPeraturanPemerintah20Tahun2004.
Berdasarkan UndangUndang Nomor 17 Tahun 2003 anggaran disusun
berdasarkan rencana kerja. Dengan demikian, yang memperoleh alokasi
anggaran adalah program/ kegiatan prioritas yang tertuang dalam rencana
kerja (RKA K/L) dan program/kegiatan pemerintah yang direncanakan itulah
yang akan dilaksanakan. Selanjutnya, RKA K/L disampaikan ke Menteri
Keuangan untuk dihimpun menjadi RAPBN. RAPBN ini selesai disusun pada
awalAgustusuntukdisampaikankeDPRdisertaiNotaKeuangan.
Hasil dari tahapan perencanaan dan penganggaran adalah UndangUndang
APBN dan Keppres Rincian APBN. Selanjutnya, disusun RKA K/L dan Daftar
IsianPelaksanaanAnggaran(DIPA)sebagaidasarpelaksanaananggaran.
Penyusunan APBN berpedoman kepada rencana kerja pemerintah dalam
rangka mewujudkan pelayanan kepada masyarakat untuk tercapainya tujuan
bernegara. APBN, perubahan APBN, dan pertanggungjawaban pelaksanaan
APBN setiap tahun ditetapkan dengan undangundang. Dalam menyusun
APBN, penganggaran pengeluaran harus didukung dengan adanya kepastian
tersedianya penerimaan dalam jumlah yang cukup. Pendapatan, belanja dan
pembiayaanyangdianggarkandalamAPBNharusberdasarkanpadaketentuan
peraturanperundangundangandandianggarkansecarabrutodalamAPBN.
2)

PenetapanAPBN
Pembahasan RAPBN di DPR dilaksanakan dari bulan Agustus sampai dengan
Oktober. Sehubungan dengan pembahasan RAPBN ini, DPR mempunyai hak
budget yaitu hak untuk menyetujui anggaran. Dalam hal DPR tidak setuju
denganRAPBNyangdiajukanolehpemerintah,DPRdapatmengajukanusulan
perubahan atau menolaknya, namun DPR tidak berwenang untuk mengubah
danmengajukanusulanRAPBN.ApabilaDPRtetaptidakmenyetujuinyamaka

60

2014 |Pusdiklatwas BPKP


yang berlaku adalah APBN tahun sebelumnya. APBN yang disetujui oleh DPR
terincisampaidenganorganisasi,fungsi,program/kegiatandanjenisbelanja.
Hal ini berarti bahwa DPR telah memberikan otorisasi kepada kementerian/
lembaga untuk melaksanakan program/kegiatan dengan pagu anggaran yang
dimilikinya.Selanjutnya,APBNyangtelahdisetujuiolehDPRdandisahkanoleh
PresidenmenjadiUndangUndangAPBNdandimuatdalamLembaranNegara.
UndangUndangAPBNdilengkapidenganrincianAPBNyangdituangkandalam
peraturanPresidententangRincianAPBN.
Penuangan dalam peraturan Presiden tersebut terutama menyangkut halhal
yang belum dirinci di dalam undangundang APBN, seperti alokasi anggaran
untuk kantor pusat dan kantor daerah kementerian negara/lembaga,
pembayaran gaji dalam belanja pegawai, dan pembayaran untuk tunggakan
yang menjadi beban kementerian negara/lembaga. Selain itu, penuangan
dimaksud

meliputi

pula

alokasi

dana

perimbangan

untuk

provinsi/kabupaten/kota dan alokasi subsidi sesuai dengan keperluan


perusahaan/badanyangmenerima.
3)

PelaksanaanAPBN
APBN dilaksanakan oleh pemerintah untuk periode satu tahun anggaran.
TahunanggaranNegaraKesatuanRepublikIndonesiaadalah1Januarisampai
dengan 31 Desember. Artinya, setelah berakhirnya tahun anggaran yaitu
tanggal 31 Desember anggaran ditutup dan tidak berlaku untuk tahun
anggaranberikutnya.
Berdasarkan UndangUndang APBN dan Perpres Rincian APBN disiapkan
dokumen pelaksanaan anggaran untuk setiap kementerian/lembaga. APBN
walaupun telah diundangkan sebagai undangundang, tetap merupakan
anggaran. Oleh karena itu, asas anggaran yang dikenal dengan nama asas
flexibilitas tetap berlaku. Dalam rangka pelaksanaan asas ini maka untuk
mengakomodasikondisiriilyangdapatsajaberbedadenganyangdiasumsikan
padasaatpenyusunananggaran,setiaptengahtahunberjalandilakukanrevisi
APBNyangdikenaldenganAPBNPerubahan(APBNP).

Manajemen Pemerintahan Pusat

61


Untuk keperluan penyusunan APBNP, pemerintah menyampaikan realisasi
anggaran semester I disertai prognosis penerimaan dan pengeluaran untuk
semester

II.

Untuk

keperluan

internal

pemerintah,

seluruh

kementerian/lembaga diwajibkan menyusun laporan keuangan semesteran.


Dalamkeadaandarurat,pemerintahdapatmelakukanpengeluaranyangtidak
tersedia anggarannya. Apabila pengeluaran tersebut terjadi sebelum
disahkannya APBNP maka pengeluaran ini dimasukkan dalam APBNP dan
dilaporkan di Laporan Realisasi Anggaran disertai penjelasan. Apabila
pengeluaran terjadi setelah APBNP diundangkan, maka pengeluaran ini
dilaporkandalamLaporanRealisasiAnggarandisertaidenganpenjelasan.
Apabila pada akhir tahun terdapat program/kegiatan yang belum selesai
dilaksanakanatauanggaranbelumterserap,tidakdapatdilanjutkanketahun
anggaranberikutnyakecualiadakebijakanpemerintahuntukluncuranAPBN.
Akantetapi,berdasarkanketentuanbahwaAPBNhanyaberlakuuntukperiode
satu tahun, maka apabila ada kebijakan luncuran APBN wajib dimasukkan
dalamAPBNtahunanggaranberikutnya.
Pelaksanaan

APBN

didokumentasikan

dalam

bentuk

laporan

pertanggungjawaban berupa laporan keuangan. Laporan keuangan dimaksud


setidaktidaknyaterdiridariLaporanRealisasiAnggaran,Neraca,LaporanArus
Kas,danCatatanatasLaporanKeuangan.Laporankeuanganyangdisampaikan
ke DPR adalah laporan keuangan yang telah diaudit oleh BPK. Laporan
keuangantersebutdilampiridenganlaporankeuanganperusahaannegaradan
badanlainnya.
Untuk penyusunan LKPP, setiap kementerian/lembaga sebagai pengguna
anggaran/barang wajib menyampaikan pertanggungjawabannya kepada
PresidenberupaNeraca,LaporanRealisasiAnggarandanCatatanatasLaporan
Keuangan. Kementerian/Lembaga merupakan entitas pelaporan sehingga
terhadap laporan keuangannya dilakukan pemeriksaan oleh BPK untuk
memberikanopiniataskewajaranpenyajianlaporankeuangan.

62

2014 |Pusdiklatwas BPKP


4)

PemeriksaanPengelolaandanTanggungJawabAPBN
Pemeriksaan atas pertanggungjawaban pelaksanaan anggaran dilaksanakan
oleh BPK. Pemeriksaan ini dilaksanakan selama dua bulan setelah laporan
pertanggungjawaban atas pelaksanaan anggaran yang berupa laporan
keuangan, selesai disusun. Di samping itu, terdapat pemeriksaan dan
pengelolaan keuangan yang dapat dilaksanakan sepanjang tahun.
PemeriksanaaninidapatdilaksanakanolehBPKataupunAPIP.

5)

PertanggungjawabanatasPelaksanaanAPBN
UndangUndang Nomor 17 Tahun 2003 Pasal 30 menyatakan: Presiden
menyampaikan rancangan undangundang tentang pertanggungjawaban
pelaksanaanAPBNkepadaDPRberupalaporankeuanganyangtelahdiperiksa
olehBadanPemeriksaKeuangan,selambatlambatnya6(enam)bulansetelah
tahun anggaran berakhir. Berdasarkan rancangan undangundang tersebut,
DPR akan menetapkannya menjadi UndangUndang Pertanggungjawaban
APBN.
Untuk Tahun 2012, laporan keuangan (audited) sebagai bentuk
pertanggungjawaban pengelolaan APBN Tahun Anggaran (TA) 2012 selesai
disusunolehpemerintahpadaMei2013.PadaSeptember2013,berdasarkan
UndangUndang Nomor 22 Tahun 2013 pertanggungjawaban tersebut
ditetapkan oleh DPR menjadi UndangUndang Pertanggungjawaban atas
PelaksanaanAPBNTahunAnggaran2012.

Manajemen Pemerintahan Pusat

63

64

2014 |Pusdiklatwas BPKP

BabIV
PENGORGANISASIAN

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenaiprinsip
pengelolaankeuanganorganisasi(1.18).

A.

PENGORGANISASIANPELAKSANAANTUGASDANFUNGSI

Pengorganisasianmerupakanprosespengaturansumberdayaorganisasiuntukmencapaitujuan
yang diinginkan dengan memperhatikan lingkungan yang ada. Dalam rangka mewujudkan
tujuan bernegara UUD 1945 telah menetapkan kelembagaan negara dengan peran dan
kewenangannya serta menetapkan pola hubungan di antara lembaga tersebut. Di bidang
keuangan negara, peran dan kewenangan lembaga tersebut dipertegas melalui UU Nomor 17
Tahun2003,UUNomor1Tahun2004,danNomor15Tahun2004.
1.

LembagaNegara
Lembaga negara merupakan perangkat dalam sistem pemerintahan di Indonesia yang
menganut paham pembagian kekuasaan (bukan pemisahan kekuasaan). Sesuai paham
pembagian kekuasaan tersebut, lembaga negara dikelompokkan kedalam tiga kelompok
yaitu legeslatif, eksekutif dan yudikatif. Berikut ini susunan lembaga negara sesudah
AmandemenUUD1945.
Gambar4.1StrukturKelembagaanNegara

UUD1945

Legislatif:
MPR,DPR,DPD

Eksekutif:
Presiden&Wapres

Yudikatif:
MK,MA,KY

Inspektif
BPK

Manajemen Pemerintahan Pusat

65


a.

LembagaLegislatif
Lembaga legislatif adalah lembaga negara yang memegang kekuasaan membentuk
undangundang.LembagainiterdiriatasDPR,MPR,danDPD.
1)

MajelisPermusyawaratanRakyat(MPR)
MajelisPermusyawaratanRakyatmerupakanlembagatingginegara.Susunan
MPRterdiriatasanggotaDewanPerwakilanRakyat(DPR)dananggotaDewan
Perwakilan Daerah (DPD) yang dipilih melalui pemilihan umum. Sebelum
adanyaamandemenUUD1945,MPRmerupakanlembagatertingginegara.
KeanggotaanMPRdiresmikandengankeputusanPresiden.Sebelumreformasi,
MPRterdiriatasanggotaDPR,utusandaerah,danutusangolongan,menurut
aturan yang ditetapkan undangundang. Jumlah anggota MPR periode 2009
2014 adalah 692 orang yang terdiri atas 560 Anggota DPR dan 132 anggota
DPD. Masa jabatan anggota MPR adalah 5 tahun, dan berakhir bersamaan
padasaatanggotaMPRyangbarumengucapkansumpah/janji.
TugasdanwewenangMPRadalahsebagaiberikut:
a)

MengubahdanmenetapkanUndangUndangDasar;

b)

Melantikpresidendanwakilpresidenberdasarkanhasilpemilihanumum
dalamsidangparipurnaMPR;

c)

MemutuskanusulDPRberdasarkanputusanMahkamahKonstitusiuntuk
memberhentikan presiden dan atau wakil presiden dalam masa
jabatannya setelah presiden dan atau wakil presiden diberi kesempatan
untukmenyampaikanpenjelasandidalamsidangparipurnaMPR;

d)

Melantik wakil presiden menjadi presiden apabila presiden mangkat,


berhenti, diberhentikan, atau tidak dapat melaksanakan kewajibannya
dalammasajabatannya;

e)

Memilih wakil presiden dari dua calon yang diajukan presiden apabila
terjadi kekosongan jabatan wakil presiden dalam masa jabatannya,
selambatlambatnyadalamwaktuenampuluhhari.

66

2014 |Pusdiklatwas BPKP

2)

DewanPerwakilanRakyat(DPR)
DPRterdiriatasanggotapartaipolitikpesertapemilihanumum(pemilu)yang
dipilih berdasarkan hasil pemilihan umum (sejak 2004). DPR merupakan
lembaga yang menyerap, menampung, menghimpun, dan menindaklanjuti
aspirasirakyatIndonesia.JumlahanggotaDPR,yaitu550orang.Keanggotaan
DPR diresmikan dengan keputusan presiden. Anggota DPR berkedudukan di
Jakarta.
TugasdanwewenangDPRadalahsebagaiberikut:
a)

membentuk undangundang yang dibahas dengan presiden untuk


mendapatpersetujuanbersama;

b)

membahas dan memberikan persetujuan peraturan pemerintah


penggantiundangundang;

c)

menerima dan membahas usulan rancangan undangundang yang


diajukanDPD;

d)

memperhatikan pertimbangan DPD atas rancangan undangundang


Anggaran Pendapatan Belanja Negara (APBN) dan rancangan undang
undangyangberkaitandenganpajak,pendidikan,danagama;

e)

menetapkan APBN bersama presiden dengan memperhatikan


pertimbanganDPD.

3)

DewanPerwakilanDaerah(DPD)
DewanPerwakilanDaerah(DPD)terdiriataswakilwakildaerahprovinsiyang
dipilihmelaluipemilihanumum.AnggotaDPDdarisetiapprovinsiditetapkan
sebanyak empat orang. Jumlah seluruh anggota DPD tidak lebih dari 1/3
jumlahanggotaDPR.
TugasdanwewenangDPDadalahsebagaiberikut.

Manajemen Pemerintahan Pusat

67


a)

Mengajukan kepada DPR tentang rancangan undangundang yang


berkaitan dengan otonomi daerah, hubungan pusat dan daerah,
pembentukan dan pemekaran, penggabungan daerah, pengelolaan
sumberdayaalam,dansumberdayaekonomi.

b)

Membahas rancangan undangundang yang berkaitan dengan


pelaksanaan otonomi daerah, hubungan pusat dan daerah
pembentukan, pemekaran, dan penggabungan daerah pengelolaan
sumber daya alam, dan sumber daya ekonomi lainnya serta yang
berkaitan dengan perimbangan keuangan pusat dan daerah yang
diajukan,baikolehDPRmaupunolehpemerintah.

c)

MemberikanpertimbangankepadaDPRatasrancanganundangundang
APBN dan rancangan undangundang yang berkaitan dengan pajak,
pendidikan,danagama.

d)

Melakukan pengawasan atas pelaksanaan undangundang mengenai


otonomidaerah,pembentukan,pemekaran,danpenggabungandaerah,
hubungan pusat dan daerah, pengelolaan sumber daya alam, dan
sumber daya ekonomi lainnya, pelaksanaan APBN, pajak, pendidikan,
danagama.

b.

LembagaEksekutif
Lembaga eksekutif artinya lembaga yang memegang kekuasaan pemerintahan.
Lembaga ini merupakan lembaga yang paling luas wewenang dan tugasnya
dibanding lembaga negara legislatif dan yudikatif. Lembaga inilah yang
mengendalikan dan melaksanakan pembangunan sesuai UU. Lembaga ekskutif
dipimpinolehpresidendanwakilpresiden.Presidendanwakilpresidenjugadibantu
menterimenteridanlembaganegaralainnya.Lembagaeksekutifitulahyangdisebut
denganpemerintahpusat.PresidendanwakilpresidendipiliholehrakyatIndonesia
dalampemilihanpresiden.
Presiden merupakan pemimpin sebuah negara.Presiden termasuk lembaga
eksekutif.Dalammenjalankantugasdantanggungjawabnya,Presidendibantuoleh
wakilpresidendanparamenteri.Menterimenteritersebuttundukdanbertanggung

68

2014 |Pusdiklatwas BPKP


jawab kepada Presiden.Lembaga eksekutif bertugas mengurusberbagai urusan
pemerintah. Urusan pemerintahantersebut mencakup enam bidang sebagai
berikut:

c.

1)

bidangpolitikluarnegeri,

2)

pertahanandankeamanan,

3)

peradilan,

4)

moneterdanfiskal,

5)

agama,serta

6)

kewenanganbidanglain

LembagaYudikatif
Lembagayudikatifadalahlembagayangmemegangkekuasaandibidangkehakiman.
Lembaga ini bebas dari campur tangan siapa pun. Lembaga yudikatif juga yang
menyelenggarakan peradilan guna menegakkan hukum dan keadilan. Lembaga
yudikatifterdiriatas:
1)

MahkamahAgung(MA)
MahkamahAgung(MA)adalahbadanyangmelakukankekuasaankehakiman.
SusunanMahkamah Agung terdiri atas pimpinan, hakimanggota, panitera,
danseorangsekretaris.PimpinandanhakimanggotaMahkamahAgungadalah
Hakim Agung. Jika masalah hukum tidakselesai di pengadilan negeri dan
pengadilantinggi,masalahtersebutdapatdiselesaikandiMahkamahAgung.

2)

MahkamahKonstitusi(MK)
Mahkamah Konstitusi (MK) merupakan salahsatu lembaga negara yang
melakukan kekuasaankehakiman. Susunan Mahkamah Konstitusiterdiri atas
seorang ketua merangkap anggota,seorang wakil ketua merangkap anggota,
dantujuhoranganggotahakimkonstitusi.
MahkamahKonstitusiberwenangmengadilipadatingkatpertamadanterakhir
yangputusannyabersifatfinaluntuk:

Manajemen Pemerintahan Pusat

69


a)

menguji undangundang terhadap UndangUndang Dasar Negara


RepublikIndonesiaTahun1945;

b)

memutus sengketa kewenangan lembaganegara yang kewenangannya


diberikanolehUUDNegaraRepublikIndonesiaTahun1945;

3)

c)

memutuspembubaranpartaipolitik;

d)

memutusperselisihantentanghasilpemilihanumum.

KomisiYudisial(KY)
Komisi Yudisial merupakan lembaga negarayang bersifat mandiri. Dalam
pelaksanaanwewenangnya, Komisi Yudisial bebas dari campurtangan atau
pengaruh kekuasaan lainnya. PimpinanKomisi Yudisial terdiri atas seorang
ketua danseorang wakil ketua yang merangkap anggota.Komisi Yudisial
mempunyaitujuhoranganggotakomisi,yangmempunyaiwewenangsebagai
berikut.
a)

MengusulkanpengangkatanHakimAgungkepadaDPR,dan

b)

Menegakkan kehormatan dan keluhuranmartabat serta menjaga


perilakuhakim.

d.

LembagaInspektifBadanPemeriksaKeuangan(BPK)
Badan Pemeriksa Keuangan adalah badanyang bertugas memeriksa tentang
keuangannegara. Dalam pelaksanaan tugasnya, BPKterlepas dari pengaruh
kekuasaanpemerintah.HaltersebutdinyatakandalamPasal23EAyat1UUD1945
bahwa untuk memeriksa pengelolaandan tanggung jawab keuangan negara
diadakansuatuBadanPemeriksaKeuanganyangbebasdanmandiri.
Adapun anggota BPK berjumlah sembilanorang yang terdiri atas seorang ketua,
wakilketua, dan tujuh orang anggota. AnggotaBPK dipilih oleh DPR dengan
memperhatikanpertimbangan DPD dan disahkan oleh presiden.Pemimpin BPK
dipilih dari dan oleh anggota BPK.Anggota BPK memegang jabatan selama
limatahundandapatdipilihkembaliuntuksatukalimasajabatan.

70

2014 |Pusdiklatwas BPKP


BadanPemeriksaKeuanganmempunyaikewenangansebagaiberikut.
1)

Memeriksapengelolaandantanggungjawabkeuangannegara.

2)

Menyerahkan hasil pemeriksaan keuangannegara kepada DPR, DPD, dan


DPRDsesuaidengankewenangannya.

Dengan demikian, BPK merupakanlembaga yang mengawasi keluar dan


masuknyakeuangan negara. Melalui adanya pengawasanBPK, diharapkan
pelaksanaan pembangunandi seluruh Indonesia berjalan sesuai dengananggaran
yang telah ditetapkan oleh presiden danDPR. Dengan demikian, tidak terjadi
penyimpangandalampenggunaananggarannegara.
2.

LembagaPemerintahan
Pemerintah pusat biasanya disebut pemerintah adalah perangkat Negara Kesatuan
Republik Indonesia yang terdiri atas Presiden dan para pembantu presiden. Pembantu
presiden adalah wakil presiden dan para menteri. Pemerintah mempunyai tugas
menjalankanpemerintahanuntukmencapaitujuannasional.
Organisasipemerintahan terdiri dari presiden, wakil presiden, kabinet, Lembaga
Pemerintah Non Kementerian, kejaksaan, Badan Ekstra Struktural, badan independen,
sertaTentaraNasionalIndonesia(TNI)danKepolisianNegaraRI(Polri).
a.

Presiden
PresidenRepublikIndonesiamemegangkekuasaanpemerintahanmenurutundang
undangdasar. Dalam melakukan kewajibannya,presiden dibantu oleh satu orang
wakil presiden.Presiden dan wakil presiden dipilih dalamsatu pasangan secara
langsung oleh rakyat.Pasangan calon presiden dan wakil presidendiusulkan oleh
partai

politik

atau

gabunganpartai

politik

peserta

pemilihan

umum

sebelumpemilihan umum.Presiden memiliki tugas yang besar demikemajuan


bangsa.Berikutiniyangtermasuktugastugaspresiden.
1)

Presidenberhakmengajukanrancanganundangundang.

2)

Menetapkan peraturan pemerintah sebagaipengganti undangundang jika


keadaanmemaksa.

Manajemen Pemerintahan Pusat

71


3)

Presiden berhak menetapkan peraturanpemerintah untuk melaksanakan


undangundang.

Berdasarkan UUD 1945, dalam bidang kehakiman, presiden mempunyaitujuh


kewenangansebagaiberikut.
1)

Memberigrasiataupenguranganmasahukumanbaginarapidana.

2)

Memberi amnesti atau pengampunankepada orang yang telah dijatuhi


hukuman

3)

Memberikanabolisiataupenghapusansuatutuntutanpidana

4)

Memberikanrehabilitasiataupemulihannamabaikseseorang

5)

Menetapkanhakimagung

6)

Menetapkanhakimkonstitusi

7)

Mengangkat

dan

memberhentikan

anggotakomisi

yudisial

dengan

persetujuanDPR
Presidenmempunyaikewenanganyanglaindiantaranyasebagaiberikut.
1)

Mengangkatdutadankonsul.
Duta adalah orang yang mewakili suatu negaradi negara lain. Konsul adalah
orangyangmewakilisuatunegaradikotanegaralain.Konsulberadadibawah
kedutaanbesar.

2)

Menerimapenempatandutanegaralain.
Dalam pengangkatan duta dan penerimaanduta negara lain, presiden harus
memperhatikanpertimbanganDPR.

Presiden,selainsebagaikepalapemerintahan,jugaberperansebagaikepalanegara
dan

panglima

tertinggi

angkatanbersenjata.

Sebagai

kepala

negara,

presidenmemiliki kekuasaan membuat perjanjian dengannegara lain dengan


persetujuan DPR. Presidenjuga dapat memberikan tanda jasa, gelar, dantanda

72

2014 |Pusdiklatwas BPKP


kehormatan lainnya.Sebagai seorang panglima tertinggi angkatanbersenjata,
presiden

mempunyai

kekuasaanuntuk

menyatakan

keadaan

bahaya,

menyatakanperang, dan membuat perdamaian denganpersetujuan DPR. Masa


jabatanpresidenadalahlimatahun.
b.

WakilPresiden
Dalam menjalankanpemerintahan, presiden dibantu oleh wakilpresiden.Wakil
presidenmempunyaitugassebagaiberikut.
1)

Melaksanakantugasteknispemerintahanseharihari

2)

Melaksanakan tugastugas khusus kenegaraanyang diberikan presiden, jika


presidenberhalangan

3)

Menggantikan jabatan presiden apabilapresiden berhenti, diberhentikan,


ataumeninggaldunia.

Untuk membantu pelaksanaan tugas, wakilpresiden dibantu oleh sekretariat wakil


presiden(setwapres).
c.

Kabinet
Kabinetadalahsuatubadanyangterdiridaripejabatpemerintahsenior/leveltinggi,
biasanya mewakili cabang eksekutif. Kabinet dapat pula disebut sebagai dewan
menteri, dewan eksekutif, atau komite eksekutif, penyebutan ini tergantung pada
sistem pemerintahannya dan diketuai oleh presiden atau perdana menteri sebagai
pimpinankabinet.
Di Indonesia kabinet dipimpin oleh presiden dengan anggota terdiri dari para
menteri yang memimpin kementerian. Kementerian merupakanbadan pelaksana
pemerintah yang dibagimenurut bidangbidangnya masingmasing, misalnya,
menteri perhubungan, menteri perdagangan, dan sebagainya. Pada pemerintahan
Presiden Susilo Bambang Yudhoyono periode 20092014 dibentuk `Kabinet
Indonesia Bersatu II`. Sesuai ketentuan Undangundang Nomor 39 Tahun 2008
tentang Kementerian Negara, jumlah kementerian tetap 34, terdiri atas 3 menteri
koordinator, 1 orang sekretaris negara, dan 30 orang menteri yang memimpin
kementerian.

Manajemen Pemerintahan Pusat

73


d.

LembagaPemerintahNonkementerian
Lembaga pemerintah nonkementerian adalah lembaga pemerintah pusat yang
dibentukuntukmelaksanakantugaspemerintahantertentudanbertanggungjawab
langsung kepada presiden. Lembaga pemerintah nonkementerian meliputi antara
lain:
1)

ArsipNasionalRepublikIndonesia(ANRI)

2)

BadanIntelejenNegara(BIN)

3)

BadanKepegawaianNegara(BKN)

4)

BadanKoordinasiKeluargaBerencanaNasional(BKKBN)

5)

BadanKoordinasiPenanamanModal(BKPM)

6)

BadanKoordinasiSurveidanPemetaanNasional(BAKOSURTANAL)

7)

BadanMeteorologidanGeofisika(BMG)

8)

BadanNarkotikaNasional(BNN)

9)

BadanNasionalPenanggulanganBencana(BNPB)

10)

BadanNasionalPenanggulanganTerorisme(BNPT)

11)

Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia


(BNP2TKI)

74

12)

BadanPengawasObatdanMakanan(BPOM)

13)

BadanPengawasPemilu(Bawaslu)

14)

BadanPengawasPerdaganganBerjangkaKomoditi

15)

BadanPengawasTenagaNuklir(BAPETEN)

16)

BadanPengawasanKeuangandanPembangunan(BPKP)

17)

BadanPengkajiandanPenerapanTeknologi(BPPT)

18)

BadanPerencanaanPembangunanNasional(BAPPENAS)

19)

BadanPertanahanNasional(BPN)

20)

BadanPusatStatistik(BPS)

21)

BadanSARNasional(BASARNAS)

2014 |Pusdiklatwas BPKP


22)

BadanStandarisasiNasional(BSN)

23)

BadanTenagaNuklirNasional(BATAN)

24)

BadanUrusanLogistik(BULOG)

25)

KomisiPemilhanUmum(KPU)

26)

LembagaAdministrasiNegara(LAN)

27)

LembagaIlmuPengetahuanIndonesia(LIPI)

28)

LembagaKetahananNasional(LEMHANNAS)

29)

LembagaPenerbanganAntariksaNasional(LAPAN)

30)

LembagaSandiNegara(LEMSANEG)

31)

PerpustakaanNasionalRepublikIndonesia(PERPUSNAS)

e.

Kejaksaan
Kejaksaan dipimpin oleh Jaksa Agung. Jaksa Agung dipilih langsung oleh presiden.
Karena itu jaksa agung bertanggung jawab terhadap presiden. Lembaga kejaksaan
adalah lembaga yang bertugas mengajukan tuntutan di muka pengadilan terhadap
parapelakukejahatan.

f.

BadanEkstraStruktural
Badan ekstra struktural adalah lembaga yang dibentuk untuk memberi
pertimbangan kepada presiden atau menteri dalam rangka koordinasi atau
pelaksanaan kegiatan tertentu. Lembaga ini juga membantu tugas tertentu dari
suatu kementerian. Lembaga ini bersifat ekstra struktural. Jadi, tidak termasuk
dalam struktur organisasi kementerian, ataupun lembaga pemerintah non
kementerian. Lembaga ini dapat dikepalai oleh menteri, wakil presiden, atau
presidensendiri.Badanekstrastrukturalmeliputi:
1)

DewanEkonomiNasional(DEN)

2)

DewanPertimbanganOtonomiDaerah(DPOD)

3)

BadanPertimbanganKepegawaian(Bapek)

4)

BadanPelaksanaAPEC

Manajemen Pemerintahan Pusat

75


5)

BadanPertimbanganJabatanNasional(Baperjanas)

6)

LembagaSensorFilm(LSF)

7)

TimPengembanganIndustriHankam

8)

KomiteOlahragaNasionalIndonesia(KONI)

9)

KomiteOlimpiadeIndonesia(KOI)

10)

KomiteNasionalKeamananTransportasi(KNKT)

11)

KomisiHukumNasionalRepublikIndonesia

12)

DewanPertimbanganPresiden(Wantimpres)

g.

BadanIndependen
Badan independen adalah lembaga yang dibentuk oleh pemerintah pusat, namun
bekerjasecaraindependen.
1)

BadanNasionalSertifikasiProfesi(BNSI)

2)

KomisiNasionalHakAsasiManusia(KomnasHAM)

3)

KomisiNasionalAntikekerasanterhadapPerempuan(KomnasPerempuan)

4)

KomisiNasionalKeselamatanTransportasi(KNKT)

5)

KomisiOmbudsmanNasional(KON)

6)

KomisiPemberantasanKorupsi(KPK)

7)

KomisiPengawasPersainganUsaha(KPPU)

8)

KomisiPenyiaranIndonesia(KPI)

9)

KomisiPerlindunganAnakIndonesia(KPAI)

h.

TentaraNasionalIndonesia(TNI)danKepolisianNegaraRI(Polri)
TNI dipimpin oleh seorang panglima. Panglima TNI dipilih oleh presiden dengan
persetujuan DPR. TNI dibagi menjadi 3 angkatan, yaitu angkatan darat, angkatan
udara, dan angkatan laut. Setiap angkatan dipimpin oleh seorang kepala staff. TNI
bertugas menjaga keutuhan Negara Kesatuan Republik Indonesia (NKRI) dari

76

2014 |Pusdiklatwas BPKP


ancaman dari luar maupun dari dalam. Demikian juga dengan Polri. Polri juga
termasuk lembaga negara. Kepolisian dipimpin oleh Kepala Kepolisian Republik
Indonesia (Kapolri). Kapolri dipilih presiden dengan persetujuan DPR. Kepolisian
bertugasmenjagakeamanandanketertibandimasyarakat.

B.

PENGORGANISASIANPENGELOLAANKEUANGAN

Sistem administrasi keuangan negara, sesuai dengan UUD 1945, UU Nomor 17 Tahun 2003
tentang Keuangan Negara, dan UU Nomor 1 Tahun 2004 tentang Perbendaharaan Negara,
mengaturhubunganantaraDPR(legislatif),Presiden(eksekutif),danBPK(inspektif),termasuk
hubunganantarlembaga/unitorganisasididalampemerintahan(eksekutif).

Gambar4.2 HubunganLembagaKepresidenan,DPR,danBPK
dalamPengelolaanKeuanganNegara

Presiden selaku pemegang kekuasaan keuangan negara menjalankan fungsi perencanaan,


pengorganisasian,pelaksanaan,danpengendalianpengelolaankeuangannegara.Perencanaan
yangdiwujudkandalamRAPBNdisampaikanpresidenkeDPRuntukmendapatkanpersetujuan.
DPR menyetujui RAPBN menjadi APBN yang menjadi pedoman bagi pemerintah untuk
melakasanakanrencanakerjayangtelahditetapkanbesertapendanaannyadalamsatutahun.
Atas pelaksanaan rencana kerja dan pendanaan yang dikelolanya, pemerintah membuat
Manajemen Pemerintahan Pusat

77


pertanggungjawaban dalam bentuk laporan keuangan yang selanjutnya diaudit oleh BPK.
LaporankeuanganyangtelahdiauditBPKselanjutnyadisampaikankepadaDPRsebagaibagian
dariRUUPertanggungjawabanatasPelaksanaanAPBN.
Didalampemerintahandilakukanpemisahanfungsipengelolaankeuangannegarayaitupejabat
pengelola keuangan negara yaitu Menteri Keuangan selaku manajer keuangan negara dan
Bendahara Umum Negara (BUN) dan pimpinan kementerian/lembaga selaku pengguna
anggaran.Organisasidankewenangandalampengelolaankeuangannegaradapatdilihatpada
gambarberikut.
Gambar4.3LingkupKewenanganKemneterianTeknisdanKementerianKeuangan

Anggaran secara teknis dilaksanakan oleh kementerian dan lembaga terkait di mana menteri/
pimpinan lembaga ditetapkan sebagai pengguna anggaran (PA)/pengguna barang(PB).
Menteri/pimpinanlembagaselakupenggunaanggaranberwenangmenetapkanparapejabatdi
lingkungannyayangditunjuksebagai:
1.

kuasapenggunaanggaran/kuasapenggunabarang(KPA/KPB);

2.

pejabat yang bertugas melakukan pemungutan penerimaan negara bukan pajak


(PNBP);

3.

pejabat yang melakukan tindakan yang mengakibatkan pengeluaran anggaran belanja


negara(tidakterikattahunanggarandantidakbolehmerangkapsebagaipejabatnomor4,
5,dan6);

4.

pejabatyangbertugasmelakukanpengujiandanperintahpembayaran;

78

2014 |Pusdiklatwas BPKP


5.

bendahara penerimaan untuk melaksanakan tugas kebendaharaan dalam rangka


pelaksanaananggaranpenerimaan;dan

6.

bendahara pengeluaran untuk melaksanakan tugas kebendaharaan dalam rangka


pelaksanaananggaranbelanja.

StrukturorganisasipengelolaankeuanganpadaK/L(PA)yangidealmenurutUUNomor1Tahun
2004tentangPerbendaharaanNegaradivisualisasikanpadagambarberikut.
Gambar4.4StrukturOrganisasiPengelolaKeuanganNegara

Contoh variasi pejabat yang bisa ditetapkan sebagai pejabat pengelolan keuangan pada
organisasikementerianantaralainsebagaiberikut.

Manajemen Pemerintahan Pusat

79


Tabel4.1VariasiPejabatyangBisaDitetapkanSebagaiPejabatPengelolanKeuangan

UnitOrganisasi
(PemegangDIPA)

No

KPA

PPK

1.

DirektoratJenderal
Kementerian

Dirjen

Direktur

2.

Sekretariat/Inspektorat
JenderalKementerian

Sekjen/Irjen

Ka
Biro/Inspektur

3.

EselonII(pusat,kantor
wilayah,kantorperwakilan,
balaibesar)

Kepala
Pusat/
Kanwil/Balai
Perwakilan

EselonIII/IV(kantor,
madrasah)

Kepala
kantor

4.

Bendahara
Stafbagian
keuangan

Sesdirjen/staf
Biro
keuangan/staf
Kasubag
Keuangan/staf

Kepala
bagian
Kepala
bidang
Kepalaseksi

Pejabat
Penguji/
PenerbitSPM

C.

PENGORGANISASIANWAKTUKEGIATAN

Keuangan/staf

Pengorganisasian waktu kegiatan dalam rangka pelaksanaan APBN diwujudkan dengan


penyusunan jadwal kegiatan (time schedule). K/L harus menyusun jadwal kegiatan mengingat
banyaknya kegiatan yang harus dilaksanakan padahal SDM yang melaksanakan kegiatan dan
waktuyangtersediaterbatas.Manfaatjadwalkegiatanmeliputi:
1.

Mempermudah perumusan permasalahan dengan mengetahui kegiatan yang perlu


menjadiperhatian(criticalactivity);

2.

Mengetahui keterkaitan antar kegiatan sehingga memudahkan koordinasi dan alokasi


sumberdaya;

3.

Menentukanmetode/carayangsesuai;

4.

Membuat kegiatan lebih terorganisir dengan mengetahui kapan kegiatan harus dimulai
dankapandiselesaikansehinggaprosesdanhasilkegiatanlebihoptimal.

Dengan penerapan SPPN dan pelaksanaan penganggaran sesuai ketentuan dalam peraturan
perundangan di bidang keuangan negara, bisa dikatakan semua kegiatan/program yang akan
dilaksanakanunitpemerintahantelahditetapkantargetkinerjadandialokasikananggarannya.

80

2014 |Pusdiklatwas BPKP


Permasalahan yang krusial selanjutnya adalah pelaksanaan dari rencana tersebut sesuai
kebutuhandengantidakmelampauiperiodeyangdibatasitahunanggaran.Darisisipenyebaran
waktu,terjaganyarealisasikegiatansesuaijadwaljugapentinguntukmenghindaripelaksanaan
kegiatan dan/atau penyerapan anggaran yang menumpuk pada akhir tahun yang bisa
mengganggupengelolaankassertahilangnyamanfaatanggaransebagaistimulanpertumbuhan
ekonomi.
Untuk itu perlu dibuat suatu kerangka kerja dan waktu yang jelas dan terukur yang menjadi
acuan pelaksana dalam merealisasikan rencana kegiatan yang telah ditetapkan. Berdasarkan
Permenkeu Nomor 190/PMK.05/2012, salah satu tugas dan wewenang KPK adalah menyusun
jadwalwaktupelaksanaankegiatantermasukrencanapenarikandananya.Setiapkegiatanyang
direncanakanperludibuatkankerangkaacuankerja(KAK)yangmemuat:
1.

Uraianmengenaiapa(what)pengertiandanapakeluaran(output)yangakandicapaidari
kegiatan.

2.

Mengapa(why)kegiatantersebutperludilaksanakandalamhubungandengantugasdan
fungsidansasaranprogramyanghendakdicapai.

3.

Siapa(who)personil/tim/satkeryangbertanggungjawabmelaksanakandalampencapaian
keluaran(output)dansiapayangakanmenerimamanfaatdarikegiatan.

4.

Kapan (when) kegiatan dimulai dan selesai, berapa lama (how long) waktu yang
dibutuhkan dalam menyelesaikan kegiatan. Untuk mengorganisasikan waktu kegiatan
dapatdigunakanTabel4.1sebagaiberikut.
Tabel4.2FormatJadwalKegiatan

BulanI
No

BulanII

BulanIII

BulanIV

Uraian
Kegiatan

Ket.

M M M M M M M M M M M M M M M M
1 2 3 4 1 2 3 4 1 2 3 4 1 2 3 4

1. Kegiatan1

2. Kegiatan2

3. Kegiatan3

4. Kegiatan4

Catatan:m=minggu

Manajemen Pemerintahan Pusat

81


5.

Dimana(where)kegiatantersebutakandilaksanakan.

6.

Bagaimana(how)kegiatantersebutdilaksanakan.

7.

Berapaperkiraan(howmuch)biayayangdibutuhkan.

82

2014 |Pusdiklatwas BPKP

BabV
PELAKSANAANAPBN

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenai
kerangkakerjakeuanganpemerintahpusat,sepertiprosespenganggaran,prosespengeluaran,
prosesreviukeuangan,manajemenkas,strategiinvestasi,sertaprinsipprinsippembiayaan
danpengelolaankeuanganorganisasi

Dalam manajemen pemerintahan, pelaksanaan APBN merupakan kewenangan pemerintah


(sepanjang tidak terdapat batasan yang mengharuskan diperolehnya persetujuan dari DPR
untuk penerimaan/belanja tertentu/tanda bintang). Pelaksanaan anggaran dilakukan oleh
kementerian/lembagaselakupengggunaanggaran(PA)sebagaibagiandarisikluspengelolaan
keuangannegaratingkatK/LsepertipadaGambar5.1berikut.
Gambar5.1SiklusPengelolaanKeuanganNegaraTingkatK/L

Manajemen Pemerintahan Pusat

83


Dari lima tahapan dalam siklus tersebut, K/L menjalankan empat tahapan yaitu perencanaan,
pelaksanaan, reviu laporan keuangan dan pertanggungjawaban. Dalam tahapan perencanaan
terdapat fungsi perencanaan itu sendiri, pengorganisasian, dan pengendalian dengan tujuan
mendapatkanhasilperencanaanyangoptimalsesuaitugasdanfungsimasingmasingK/L.Pada
tahapan pelaksanaan terdapat fungsi pengorganisasian, penggerakan pelaksanaan, dan
pengendalian dengan tujuan terlaksananya rencana yang telah ditetapkan secara optimal
dengan hasil yang dapat dipertanggungjawabkan. Tahapan reviu atas laporan keuangan
merupakan bagian dari fungsi manajemen untuk mengendalikan laporan keuangannya agar
dapat diandalkan sebelum diaudit oleh auditor eksternal dan diserahkan kepada Menteri
Keuangan untuk dikonsolidadi dalam LKPP. Sedangkan tahapan pertanggungjawaban dapat
dipenuhi dengan baik apabila tahapan perencanaan, pelaksanaan, dan reviu atas laporan
keuanganbisadilaksanakandenganbaik.

A.

PERSIAPAN

PadasaatRancanganAnggaranPendapatandanBelanjaNegara(RAPBN)disetujuiolehDPRdan
ditetapkan sebagai UndangUndang APBN berarti tahap kedua siklus anggaran telah selesai.
Berikutnya tahap ketiga yaitu tahap pelaksanaan anggaran (APBN) yang merupakan
kewenangan presiden selaku kepala pemerintah untuk melaksanakan seluruh kebijakan yang
telah tertuang dalam undangundang tersebut. Untuk itu sejalan dengan pemberian peran
kepada para menteri/kepala lembaga selaku chief operational officer, presiden
mendistribusikan anggaran yang telah disetujui dalam APBN tersebut kepada
kementerian/lembagadenganmenerbitkanperaturanpresidenmengenairincianAPBN.Dengan
demikian pelaksanaan anggaran selanjutnya merupakan domain dari kementerian/lembaga
selakupenggunaanggaran.
Padaawalpelaksanaananggarandilakukanpersiapansebagaiberikut:
1.

PenetapanPejabatPengelolaAnggaran
Pada awal tahun anggaran, langkah pertama yang harus dilakukan dalam tahap
pelaksanaananggaranmeliputipenetapanpejabatpengelolaanggaran,mengikutistruktur
organisasi sebagaimana diuraikan pada Bab IV. Pejabat pengelola keuangan meliputi
KuasaPenggunaAnggaran(KPA)danBendaharayangditetapkanolehPenggunaAnggaran
(PA) serta Pejabat Pembuat Komitmen (PPK) dan Pejabat Penguji Surat Perintah

84

2014 |Pusdiklatwas BPKP


Membayar(PPSPM)yangditetapkanolehKPA.KhususuntukPPK,berdasarkanPasal11PP
45Tahun2013,masaberlakupenetapannyabisalebihdarisatutahun.
2.

PenerbitandanPengesahanDokumenPelaksanaanAnggaran
Untuk melaksanakan anggaran yang telah dialokasikan kepada masingmasing K/L
penggunaanggarandiperlukandokumenpelaksanaananggaranyangdisebutDaftarIsian
Pelaksanaan Anggaran (DIPA). Berikut ini diuraikan mengenai konsepsi DIPA, jenis DIPA,
prosedur penyelesaian DIPA, rencana pendapatan, rencana penarikan dana, penetapan
DIPAdanSuratPengesahanDIPA,DIPASementara,RevisiDIPA,sertapenerbitanpetunjuk
pelaksanaan.
a.

KonsepsiDIPA
DIPA merupakan suatu daftar isian yang memuat uraian sasaran yang hendak
dicapai, fungsi, program dan rincian kegiatan, rencana penarikan dana tiaptiap
bulan dalam satu tahun serta pendapatan yang diperkirakan oleh
kementerian/lembaga. DIPA yang lengkap memuat uraian fungsi/subfungsi,
program,hasil(outcome),indikatorkinerjautama(IKU)program,kegiatan,indikator
kinerjakegiatan(IKK),keluaran(output),jenisbelanja,alokasianggarandanrencana
penarikan

dana

serta

perkiraan

penerimaan

per

bulan

kementerian

negara/lembaga. Dengan demikian dokumen DIPA yang lengkap terdiri sebagai


berikut.
SuratPengesahanDIPA

PengesahanDIPAyangditandatanganiDirjen
PerbendaharaanatauKepalaKanwilDJPBatasnama
MenteriKeuangan.

DIPAhalamanI(umum)

Memuatinformasiyangbersifatumumdarisetiapsatuan
kerjatentangrincianfungsi,programdansasaranserta
indikatorkeluaranuntukmasingmasingkegiatan.

DIPAhalamanII

Memuatinformasisetiapsatuankerjatentanguraian
kegiatan/subkegiatan,volumekeluaranyanghendak
dicapaisertaalokasidanapadamasingmasingbelanja
yangdicerminkandalammataanggarankeluaran.
Informasialokasidanaperjenisbelanjaberdasarkan
sumberdanauntuktiaptiapsatker,baikuntukDIPA
kementeriannegara/lembagamaupunDIPABABUN.

DIPAhalamanIII

Memuatinformasitentangrencanapenarikandanadan
penerimaannegarabukanpajakyangmenjaditanggung

Manajemen Pemerintahan Pusat

85


jawabsetiapsatuankerja.
Rencanapenarikandanaolehmasingmasingsatker
sampaidenganjenisbelanjasertarencanapenerimaan
pajak/beadancukai,hibah,PNBPdanpenerimaan
pembiayaanyangmenjaditanggungjawabsetiapsatuan
kerja.
DIPAhalamanIV

Memuatcatatantentanghalhalyangperlumenjadi
perhatianolehpelaksanakegiatan.

SelanjutnyainformasiyangterdapatdalamDIPAdapatdijelaskansebagaiberikut.
1)

StrukturPenganggaran
Anggaran yang telah disetujui oleh DPR dirinci dalam unit organisasi, fungsi,
program,kegiatandanjenisbelanja.
a)

OrganisasidanBagianAnggaran
Klasifikasi organisasi adalah pengelompokan anggaran belanja negara
berdasarkanstrukturorganisasikementeriannegara/lembaga.Klasifikasi
ini sesuai dengan unit yang bertanggung jawab terhadap pelaksanaan
suatu program, unit eselon II dan III yang bertanggung jawab terhadap
suatupelaksanaankegiatanpendukungprogram.
Pelaksanaan, monitoring, dan pelaporan anggaran akan menjadi suatu
sinergiyangpositifapabilaadasinkronisasiantarastrukturprogramdan
kegiatan dengan struktur organisasi. Dengan demikian tanggung jawab
dankewenanganakanlebihjelasbagiparamanajer,walaupuntetapada
sedikit kesulitan apabila program dimaksud dilaksanakan secara lintas
unitorganisasidanlintaskementeriannegara/lembaga.
Bagiananggaranmerupakanklasifikasianggaranberdasarkanorganisasi
antaralainmenurutkementeriannegara/lembaga.

b)

FungsidanSubfungsi
Klasifikasi anggaran dibagi menurut fungsi, hal ini akan sangat
membantu dalam penyusunan struktur program dan kegiatan. Fungsi

86

2014 |Pusdiklatwas BPKP


adalah perwujudan tugas kepemerintahan di bidang tertentu yang
dilaksanakandalamrangkamencapaitujuanpembangunannasional.
Subfungsimerupakanpenjabaranfungsiyangterincikedalambeberapa
kategori. Penggunaan fungsi dan subfungsi disesuaikan dengan tugas
pokokdanfungsimasingmasingkementeriannegara/lembaga.
c)

Program
Program adalah penjabaran kebijakan kementerian negara/lembaga
dalam bentuk upaya yang berisi satu atau beberapa kegiatan dengan
menggunakansumberdayayangdisediakanuntukmencapaihasilyang
terukur sesuai dengan misi yang dilaksanakan instansi atau masyarakat
dalamkoordinasikementeriannegara/lembagayangbersangkutan.

Contohpenetapanorganisasidanbagiananggara,fungsidansubfungsi,serta,
programpadaDIPABPKP(Pusat)TahunAnggaran2013adalahsebagaiberikut:
Struktur
Penganggaran

No

1. BagianAnggaran
2. Organisasi
3. Fungsi
4. Subfungsi
5. Program

Uraian
089 BPKP
089.01 BPKP
01 PelayananUmum
0101 LembagaEksekutif,MasalahKeuangandan
Fiskal,sertaUrusanLuarNegeri
01 ProgramDukunganManajemendan
PelaksanaanTugasTeknisLainnya.

02 ProgramPeningkatanSaranadanPrasarana
AparaturNegara

03 ProgramPengawasanInternAkuntabilitas
KeuanganNegaradanPembinaan
PenyelenggaraanSistemPengendalianIntern
Pemerintah

d)

KegiatandanSubkegiatan
Kegiatan adalah bagian dari program yang dilaksanakan oleh satu atau
beberapa satuan kerja sebagai bagian dari pencapaian sasaran terukur

Manajemen Pemerintahan Pusat

87


padasuatuprogram,yangterdiriatassekumpulantindakanpengerahan
sumber daya, baik berupa personil (sumber daya manusia), barang
modal termasuk peralatan dan teknologi, dana, atau kombinasi dari
beberapa atau semua jenis sumber daya tersebut sebagai masukan
(input)untukmenghasilkankeluaran(output)dalambentukbarang/jasa.
Subkegiatan adalah bagian dari kegiatan yang menunjang usaha
pencapaian sasaran dan tujuan kegiatan tersebut. Timbulnya
subkegiatan adalah sebagai konsekuensi adanya perbedaan jenis dan
satuan keluaran antar subkegiatan dalam kegiatan dimaksud. Dengan
demikian dapat dikatakan bahwa subkegiatan yang satu dipisahkan
dengansubkegiatanlainberdasarkanperbedaankeluaran.
Contoh:
Kegiatandiklataparaturnegaradengansubkegiatan:
penyelenggaraan diklat penjenjangan jabatan fungsional auditor
(JFA)dengankeluaran,antaralainjumlahpesertadidik;
pengembangankurikulumdiklatdengankeluaranjumlahmodul.
e)

JenisBelanja
Jenisbelanjaadalahklasifikasiekonomidalamstandarstatistikkeuangan
pemerintah. Klasifikasi anggaran menurut jenis belanja dibagi dalam
delapankategorisebagaiberikut.
(1)

Belanja pegawai yaitu kompensasi dalam bentuk uang maupun


barangyangdiberikankepadapegawainegeri,pejabatnegara,dan
pensiunan serta pegawai honorer yang akan diangkat sebagai
pegawailingkuppemerintahan,yangbertugasdidalammaupundi
luar negeri sebagai imbalan atas pekerjaan yang telah
dilaksanakan.
Belanja ini antara lain digunakan untuk gaji dan tunjangan, uang
makan, asuransi kesehatan, honorarium, vakasi, lembur dan
kontribusisosial.

88

2014 |Pusdiklatwas BPKP


(2)

Belanjabarangyaitupembelianbarangdanjasayanghabispakai
untuk menghasilkan barang dan jasa yang dipasarkan maupun
yangtidakdipasarkan,sertapengadaanbarangyangdimaksudkan
untuk diserahkan atau dijual kepada masyarakat diluar kriteria
belanja bantuan sosial dan belanja perjalanan. Belanja ini antara
lain digunakan untuk pengadaan barang dan jasa, pemeliharaan,
perjalanan, pengadaan barang badan layanan umum (BLU)
termasukpembayarangajidantunjanganpegawaiBLU.

(3)

Belanja Modal yaitu pengeluaran untuk pembayaran perolehan


aset dan/atau menambah nilai aset tetap/aset lainnya yang
memberi manfaat lebih dari satu periode akuntansi dan melebihi
batasminimalkapitalisasiasettetap/asetlainnyayangditetapkan
pemerintah. Dalam pembukuan nilai perolehan aset dihitung
semua pendanaan yang dibutuhkan hingga aset tersebut tersedia
dan siap untuk digunakan. Termasuk biaya operasional panitia
pengadaan barang/jasa yang terkait dengan pengadaan aset
tersebut. Dalam belanja ini termasuk pembelian tanah, peralatan
danmesin,gedungdanbangunan,jaringan,maupundalambentuk
fisiklainnya,sertabelanjamodaloperasionalBLU.

(4)

Beban Bunga Utang yaitu pembayaran yang dilakukan atas


kewajiban penggunaan pokok utang (principal outstanding), baik
utangdalamnegerimaupunluarnegeriyangdihitungberdasarkan
ketentuan dan persyaratan dari utang yang sudah ada dan
perkiraan utang baru, termasuk untuk biaya terkait dengan
pengelolaanutang.

(5)

Subsidi yaitu alokasi anggaran yang diberikan kepada


perusahaan/lembaga yang menghasilkan, menjual, mengekspor,
atau mengimpor barang dan jasa untuk memenuhi hajat hidup
orang banyak sedemikian rupa, sehingga harga jual dapat
terjangkau oleh masyarakat. Belanja subsidi terdiri dari belanja
subsidienergidanbelanjasubsidinonenergi.

Manajemen Pemerintahan Pusat

89


(6)

Bantuan Sosial yaitu transfer uang atau barang yang diberikan


kepada masyarakat guna melindungi dari kemungkinan terjadinya
risikososial.Risikososialadalahkejadianatauperistiwayangdapat
menimbulkan potensi terjadinya kerentanan sosial yang
ditanggung oleh individu, keluarga, kelompok, dan atau
masyarakat sebagai dampak krisis sosial, krisis ekonomi, krisis
politik,fenomenaalam,danbencanaalamyangjikatidakdiberikan
bantuansosialakansemakinterpurukdantidakdapathidupdalam
kondisi wajar. Bantuan sosial dapat langsung diberikan kepada
anggota masyarakat dan/atau lembaga kemasyarakatan. Bantuan
ini antara lain untuk lembaga non pemerintah bidang pendidikan
dankeagamaan.

(7)

Hibahmerupakanbelanjapemerintahpusatdalambentuktransfer
uang/barang kepada pemerintah negara lain, organisasi
internasional, BUMN/D, dan pemerintah daerah yang bersifat
sukarela, tidak wajib, tidak mengikat, dan tidak perlu dibayar
kembali serta tidak terus menerus. Dilakukan dengan naskah
perjanjianantarapemberidanpenerimahibahdenganpengalihan
hakdalambentukuang,barang,ataujasa.Termasukdalambelanja
hibah adalah pinjaman dan/atau hibah luar negeri yang terus
dihibahkankedaerah.

(8)

BelanjaLainlainyaitupengeluarannegarauntukpembayaranatas
kewajiban pemerintah yang tidak masuk ke dalam jenis belanja
pada huruf (1) sampai dengan huruf (7) tersebut di atas, bersifat
mendesakdantidakdapatdiprediksisebelumnya.Belanjalainlain
dipergunakan antara lain Belanja Lainlain Dana Cadangan dan
RisikoFiskal,BelanjaLainlainLembagaNonKementerian.

2)

Lokasi
DIPA juga menginformasikan lokasi pelaksanaan kegiatan/subkegiatan, yaitu
dengan memberikan informasi alamat pelaksanaan kegiatan seperti provinsi,
kabupaten,kotaataulokasidiluarnegeri.

90

2014 |Pusdiklatwas BPKP


b.

JenisDIPA
Berdasarkan pembagian anggaran dalam APBN, jenis DIPA dapat dikelompokkan
atasDIPAKementerianNegara/LembagadanDIPABendaharaUmumNegara(DIPA
BUN)sebagaiberikut.
1)

DIPAKementerianNegara/Lembagadapatdikategorikanmenjadiberikut.
a)

DIPASatkerPusat/KantorPusat(KP)
DIPA Satker Pusat/Kantor Pusat (KP) adalah DIPA yang dikelola oleh
satker kantor pusat dan atau satker pusat suatu kementerian
negara/lembaga, termasuk di dalamnya DIPA satker badan layanan
umum(BLU),danDIPAsatkernonvertikaltertentu(SNVT).

b)

DIPASatkerVertikal/KantorDaerah(KD)
DIPASatkerVertikal/KantorDaerah(KD)adalahDIPAyangdikelolaoleh
kantor/instansi vertikal kementerian negara/lembaga di daerah
termasukdidalamnyauntukDIPAsatkerBLU.

c)

DIPADanaDekonsentrasi(DK)
DIPA Dana Dekonsentrasi (DK) adalah DIPA dalam rangka pelaksanaan
danadekonsentrasi,yangdikelolaolehSKPDprovinsiyangditunjukoleh
gubernur.

d)

DIPATugasPembantuan(TP)
DIPA Tugas Pembantuan (TP) adalah DIPA dalam rangka pelaksanaan
tugas pembantuan, yang dikelola oleh SKPD provinsi/kabupaten/kota
yang ditunjuk oleh menteri/pimpinan lembaga yang memberi tugas
pembantuan.

e)

DIPAUrusanBersama(UB)
DIPA Urusan Bersama (UB) adalah DIPA yang memuat rincian
penggunaan anggaran kementerian negara/lembaga dalam rangka

Manajemen Pemerintahan Pusat

91


pelaksanaanurusanbersama,yangpelaksanaannyadilakukanolehSKPD
provinsi/kabupaten/kotayangditunjukolehmenteri/pimpinanlembaga
berdasarkanusulankepaladaerah.
2)

DIPABendaharaUmumNegara(DIPABUN)
DIPABendaharaUmumNegara(DIPABUN)adalahDIPAyangmemuatrincian
penggunaan anggaran yang bersumber dari Bagian Anggaran Bendahara
Umum Negara (BABUN) yang dikelola Menteri Keuangan selaku Pengguna
Anggaran.Terdiriataspengelolaan:
a)

UtangPemerintah;

b)

Hibah;

c)

InvestasiPemerintah;

d)

PenerusanPinjaman;

e)

TransferkeDaerah;

f)

BelanjaSubsidi;

g)

BelanjaLainlain;

h)

TransaksiKhusus.

DIPA BUN disusun dan ditetapkan oleh Pembantu Pengguna Anggaran (PPA)
yangditunjukdanditetapkanolehMenteriKeuanganselakuPA.
c.

ProsedurPenyelesaianDIPA
1)

DokumenPenyusunanDIPA
Dokumen yang digunakan sebagai dasar dalam penyusunan DIPA, yaitu
sebagaiberikut.

92

a)

KeputusanPresidenmengenairincianAPBN.

b)

RKAKLyangtelahditelaahdanditetapkanolehDirjenAnggaran.

2014 |Pusdiklatwas BPKP


c)

Rencana Dana Pengeluaran Bendahara Umum Negara (RDPBUN) yang


telahditelaahdanditetapkanolehDirekturJenderalAnggaranRDPBUN
merupakan rencana kerja dan anggaran Bagian Anggaran Bendahara
Umum Negara yang memuat rincian kebutuhan dana baik yang
berbentuk anggaran belanja maupun pembiayaan, dalam rangka
pemenuhan kewajiban pemerintah pusat dan transfer kepada daerah
yang pengelolaannya dikuasakan oleh Presiden kepada Menteri
KeuanganselakuBendaharaUmumNegara.

d)

BaganAkunStandar
Penyusunan DIPA harus memerhatikan standar dalam Bagan Akun
Standaruntukmemastikanbahwarencanakerjatelahdituangkansesuai
dengan standar kode dan uraian yang diatur dalam ketentuan tentang
akuntansipemerintahan.

e)

DaftarNominatifAnggaran(DNA)
DNA ditetapkan oleh Direktur Jenderal Perbendaharaan untuk satker
yang DIPAnya disahkan oleh Kantor Wilayah Direktorat Jenderal
Perbendaharaan.
PenyusunanDIPAmenggunakanAplikasiRKAKLDIPA.Sumberdatayang
digunakan dalam penyusunan DIPA berasal dari analisis data komputer
(ADK) atas RKAKL yang telah ditetapkan oleh DJA dan tidak dapat
dilakukan perubahan/revisi, kecuali apabila terdapat kesalahan kode
kabupaten/kota,kodekewenangan,dankodekantorbayar.

2)

ProsedurPenyelesaianDIPA
a)

MenteriKeuanganmemberitahukankepadamenteri/pimpinanlembaga
untuk menyampaikan DIPA kepada Direktur Jenderal Perbendaharaan
setelahditerimanyaSPRKAKL.

b)

Berdasarkan pemberitahuan dari Menteri Keuangan, Direktur Jenderal


Perbendaharaan menyusun jadwal validasi DIPA kementerian

Manajemen Pemerintahan Pusat

93


negara/lembagadandisampaikankepadaSekretarisJenderal/Sekretaris
UtamaKementerianNegara/Lembaga.
c)

Sekretaris Jenderal/Sekretaris Utama memerintahkan para KPA satker


agar menyampaikan DIPA dan ADK kepada Direktur Jenderal
Perbendaharaansesuaidenganjadwalvalidasiyangtelahditetapkan.

d)

Untuk proses penyelesaian DIPA Tugas Pembantuan, DIPA Urusan


Bersama,DIPA

e)

Satker Kantor Pusat di luar DKI Jakarta dan DIPA satker pusat yang
beradadidaerah,

f)

Direktur Jenderal Perbendaharaan memerintahkan Kepala Kantor


Wilayah Direktorat Jenderal Perbendaharaan untuk menyusun jadwal
validasiDIPAdandisampaikankepadaKPAsatkerdiwilayahkerjanya.

d.

RencanaPendapatan
Penatausahaan pendapatan dimulai dari satuan kerja dikoordinasikan oleh
kementerian negara/lembaga dengan mengikuti kelompok pendapatan sebagai
berikut:
1)

tigadigitpertamamerupakankelompokpendapatan;

2)

limadigitpertamamerupakansubkelompokpendapatan;

3)

enamdigitmerupakanmataanggaranpenerimaan(MAP).

Contoh:pendapatanjasacatatansipildengankode423154,penjelasannyasebagai
berikut:
kelompokpendapatan423untukPNBPlainnya;
subkelompokpendapatan42315untukpendapatanjasaII;
MAP423154untukpendapatanjasacatatansipil.

94

2014 |Pusdiklatwas BPKP


e.

RencanaPenarikanDana
PencantumanangkarencanapenarikandanapadahalamanIIIDIPAdidasarkanpada
rencana kerja bulanan satker sesuai dengan kebutuhan riil. Berkenaan dengan hal
tersebut,kiranyaperludiperhatikanhalsebagaiberikut.
1)

Untuk Belanja Pegawai, karena sifat penarikan cenderung tetap maka


penyusunanrencanapenarikandapatdibuatsecararataratadibagisebanyak
13 bulan, dengan menempatkan pembayaran belanja pegawai bulan ke13
padabulanJuli;

2)

Untukbelanjaselainbelanjapegawai,pencantumanrencanapenarikansesuai
rencana penarikan/pembayaran dalam rangka pelaksanaan kegiatan yang
meliputi rencana penarikan uang persediaan (UP) dan rencana penarikan
pembayaranlangsung(LS)setiapbulan.

f.

PenetapanDIPAdanSuratPengesahanDIPA
Pengesahan DIPA merupakan penetapan oleh BUN atas DIPA yang disusun oleh
PA/KPA dan memuat pernyataan bahwa rencana kerja dan anggaran pada DIPA
berkenaantersediadananyadalamAPBNdanmenjadidasarpembayaran/pencairan
danaatasbebanAPBN.
Pengesahan DIPA dilakukan dengan penerbitan Surat Pengesahan DIPA yang
ditandatanganioleh:
1)

DirekturJenderalPerbendaharaanatasnamaMenteriKeuanganselakuKuasa
Bendahara Umum Negara, untuk DIPA satker kantor pusat yang berlokasi di
DKIJakartadanDIPABagianAnggaranBendaharaUmumNegara;

2)

Kepala Kantor Wilayah Direktorat Jenderal Perbendaharaan atas nama


MenteriKeuanganselakuKuasaBendaharaUmumNegara,untukDIPAsatker
vertikal/unitpelaksanateknistermasuksatkerkantorpusatdiluarDKIJakarta
dan satker pusat yang ada di daerah, DIPA Dekonsentrasi, DIPA Tugas
Pembantuan,danDIPAUrusanBersama.

Manajemen Pemerintahan Pusat

95


Untuk kelancaran pelaksanaan kegiatan yang tercantum dalam DIPA, setelah DIPA
disahkanolehDirekturJenderalPerbendaharaan/KepalaKantorWilayahDirektorat
Jenderal Perbendaharaan, PA/KPA menerbitkan petunjuk operasional kegiatan
(POK). POK adalah dokumen yang memuat uraian rencana kerja dan biaya yang
diperlukanuntukpelaksanaankegiatan,disusunolehKPAsebagaipenjabaranlebih
lanjutdariDIPA.
g.

DIPASementara
Jika KPA belum menyampaikan DIPA sampai dengan batas waktu yang ditentukan,
maka:
1)

Direktur Jenderal Perbendaharaan menerbitkan Surat Pengesahan DIPA


dilampiri DIPA yang diterbitkan oleh Direktur Jenderal Perbendaharaan
berdasarkankeppresmengenairincianAPBNsebagaiDIPASementara.Kepala
Kantor Wilayah Dirjen Perbendaharaan menerbitkan Surat Pengesahan DIPA
dilampiri DIPA yang diterbitkan oleh Kepala Kantor Wilayah Dirjen
Perbendaharaan berdasarkan Daftar Nominatif Anggaran (DNA) sebagai DIPA
Sementara;

2)

DIPASementaratidakperluditandatanganiPA/KPA;

3)

Dana yang dapat dicairkan dibatasi untuk pembayaran gaji pegawai,


pengeluaran keperluan seharihari perkantoran, daya dan jasa, serta lauk
pauk/bahanmakanan,sedangkandanauntukjenispengeluaranlainnyaharus
diblokir;

4)

ApabilaDIPAtelahditerimadariPA/KPAsetelahDIPASementaraditerbitkan,
makadilakukanvalidasidanpengesahanrevisipertamaDIPAbersangkutan.

h.

RevisiDIPA
DIPAyangtelahdisahkanolehDJPBN/KepalaKanwilDJPBNapabiladiperlukandapat
direvisiolehsatkeryangbersangkutan.

96

2014 |Pusdiklatwas BPKP


1)

Revisianggaranterdiridari:
a)

perubahan rincian anggaran yang disebabkan penambahan atau


pengurangan pagu anggaran belanja termasuk pergeseran rincian
anggaranbelanjanya;

b)

perubahan atau pergeseran rincian anggaran dalam hal pagu anggaran


tetap;

c)

perubahan/ralatkarenakesalahanadministrasi.

SelainiturevisiDIPAjugadapatdilakukandalamhal:
a)

terjadiperubahanAPBNtahunanggaranberjalan;

b)

penerapanpemberianpenghargaan dan pengenaan sanksi (reward and


punishmentsystem);

2)

c)

instruksipresidenmengenaipenghematananggaran;dan/atau

d)

kebijakanpemerintahlainnya.

Revisianggarandapatdilakukansepanjangtidakmengakibatkanpengurangan
alokasianggaranterhadap:
a)

kebutuhan biaya operasional satker, kecuali sepanjang masih dalam


peruntukan yang sama dan kebutuhan biaya operasional masih
mencukupi;

b)

alokasi tunjangan profesi guru/dosen dan tunjangan kehormatan


profesorkecualiuntukmemenuhitunjanganguru/dosendantunjangan
kehormatanprofesorpadasatkerlain;

c)

pembayaranberbagaitunggakan;

d)

paketpekerjaanyangbersifatmultiyears;

e)

alokasi dana pendamping PHLN sepanjang paket pekerjaan masih


berlanjutdan/atauperawatantahananuntuktahanan/narapidana;

f)

kebutuhan pengadaan bahan makanan dan/atau perawatan tahanan


untuktahanan/narapidana;

Manajemen Pemerintahan Pusat

97


g)

paketpekerjaanyangtelahdikontrakandan/ataudirealisasikandananya
sehinggamenjadiminus.

3)

Revisi anggaran dapat dilaksanakan oleh PA/KPA sepanjang tidak mengubah


DIPAdenganketentuansebagaiberikut:
a)

pergeseran antar akun/antar subkomponen dalam satu komponen


dan/atauantarkomponenuntukmemenuhikebutuhanbiayaoperasional
sepanjangdalamjenisbelanjayangsama;

b)

antarakun/antara subkomponen dalam satu komponen dan/atau


pergeseranantarkomponen dalam satu keluaran sepanjang dalam jenis
belanjayangsama;dan/atau

c)

perubahan/pengurangan akun/subkomponen/komponen dalam satu


keluaran.

Revisi anggaran oleh PA/KPA dilakukan dengan cara mengubah ADK


RKASatker berkenaan melalui aplikasi RKAK/L, mencetak petunjuk
operasionalkegiatan(POK),danKPAmenetapkanperubahanPOK.
i.

Penerbitanpetunjukpelaksanaan
Setelah DIPA disahkan, unit organisasi/satuan kerja dapat menerbitkan petunjuk
pelaksanaansebagaipedomanpelaksanaanlebihlanjutDIPA.

B.

MEKANISMEPELAKSANAANPENDAPATAN

UU Nomor 17 Tahun 2003 tentang Keuangan Negara menyatakan bahwa pendapatan negara
merupakan hak pemerintah pusat yang diakui sebagai penambah nilai kekayaan bersih. Salah
satu hak pemerintah pusat adalah menggali sumbersumber penerimaan bagi negara untuk
membiayai berbagai belanja/pengeluaran negara yang berkaitan dengan kegiatan
penyelenggaraan pemerintahan. Berdasarkan struktur APBN, pendapatan negara terdiri atas
penerimaanperpajakan,penerimaanbukanpajak,danhibah.

98

2014 |Pusdiklatwas BPKP


1.

PenerimaanPerpajakan(PNPajak)
Penerimaan perpajakan adalah semua penerimaan negara yang terdiri dari penerimaan
pajak dalam negeri dan pajak perdagangan internasional. Penerimaan perpajakan dalam
negeri meliputi semua penerimaan negara yang berasal dari pajak penghasilan, pajak
pertambahan nilai barang/jasa dan pajak penjualan atas barang mewah, bea materai.
Sedangkanpajak perdagangan internasional merupakan semua penerimaan negara yang
berasaldaribeamasukdanpajak/pungutanekspor.
Pelaksanaananggaranpendapatanyangberasaldaripenerimaanperpajakanmerupakan
kewenangan dan tugas Menteri Keuangan selaku Bendahara Umum Negara (BUN).
Penerimaanuangnegaradariperpajakanwajibdisetorkanolehwajibpajakdanatauwajib
pungut ke kas negara pada bank pemerintah atau lembaga lain yang ditetapkan oleh
MenteriKeuangan.
Mekanisme pelaksanaan penerimaan perpajakan diatur secara tersendiri dalam
UndangUndangPerpajakan,denganmenerapkanmetodeberikut.
a.

Sistempemungutanselfassessment.
Sistempenerimaanperpajakandenganmekanismeinimengaturwajibpajakuntuk
menghitung pajaknya sendiri, kemudian menyetornya ke kas negara dan
melaporkannyadalamlaporansuratpemberitahuanpajak(SPT).

b.

Penerimaan perpajakan yang berkaitan dengan mekanisme pelaksanaan anggaran


negara/daerah,dilakukandenganmekanismepemotongan/pemungutanpajakoleh
setiapinstansipemerintahyangmelakukanpembayaranatasbebannegara/daerah.
Oleh karena itu, dalam rangka intensifikasi penerimaan pajak negara, setiap
bendahara instansi pemerintah baik pusat maupun daerah, BUMN/BUMD dan
badan lainnya ditetapkan sebagai wajib pungut yang wajib menyetorkan seluruh
penerimaanpajakyangdipungutdalamwaktuselambatlambatnyasatuharisetelah
uangpajakditerima.

Selanjutnya dalam rangka meningkatkan intensifikasi penerimaan pajak, setiap instansi


pemerintah, BUMN/BUMD serta badan lainnya diwajibkan untuk memberikan informasi
perpajakan kepada pemerintah, sesuai dengan peraturan perundangan yang berlaku.
Ketentuandatadaninformasiperpajakansebagaiberikut.

Manajemen Pemerintahan Pusat

99


a.

Mewajibkan setiap kementerian/lembaga, pemerintah daerah, kantor dan satuan


kerja,proyek/bagianproyek,danBUMN/Duntukmenyampaikanbahanbahandan
keterangan yang menjadi wewenang dan tanggung jawabnya guna keperluan
perpajakankepadaMenteriKeuanganc.q.DirekturJenderalPajak.

b.

Untuk memadukan dan menyinerjikan data dan informasi perpajakan tersebut


dibentukbankdatanasionaldannomoridentitastunggalolehMenteriKeuangan.

c.

Menteri Keuangan c.q. Dirjen Pajak mengadministrasikan data dan informasi


perpajakandalambankdatanasionaldenganmembentuknomoridentitasbersama
sebagaiembrionomoridentitastunggal.

d.

Menteri Keuangan c.q. Dirjen Pajak wajib memberikan nomor identitas tunggal
kepada masingmasing kementerian/lembaga, pemerintah daerah, kantor/satuan
kerja,proyek/bagianproyek,danBUMN/D.

e.

Menetapkan setiap instansi pemerintah, pemda, BUMN/D, bendahara dan badan


lain yang melakukan pembayaran atas beban APBN/APBD, sebagai wajib pungut
pajak,sesuaidenganketentuanperundanganyangberlaku.

2.

PenerimaanNegaraBukanPajak(PNBP)
Penerimaan negara bukan pajak memiliki arti dan peran yang sangat penting dalam
pembiayaan penyelenggaraan pemerintahan negara dan pembangunan nasional, oleh
karenanya diperlukan langkahlangkah pengadministrasian yang efisien agar penerimaan
tersebutdapatdimanfaatkansecaraoptimal.
a.

PengertianPNBP
Penerimaannegarabukanpajakadalahseluruhpenerimaanpemerintahpusatyang
tidakberasaldaripenerimaanperpajakandanhibah.

b.

JenisdanTarifPenerimaanNegaraBukanPajak(PNBP)
PNBP yang dikelola oleh Kementerian/Lembaga (tidak termasuk pendapatan BLU)
dapatdikelompokmenjadi2(dua),yaitu:

100

2014 |Pusdiklatwas BPKP


1)

PNBPUmum
Setiap kementerian negara/lembaga pada dasarnya mempunyai PNBP yang
bersifat umum yaitu PNBP yang tidak berasal dari pelaksanaan tugas pokok
dan fungsinya. PNBP umum merupakan PNBP yang berlaku umum di semua
kementerian negara/lembaga. PNBP umum sesuai Peraturan Pemerintah
Nomor22Tahun1997antaralain:
a)

penerimaanhasilpenjualanbarang/kekayaannegara,

b)

penerimaanhasilpenyewaanbarang/kekayaannegara,

c)

penerimaanhasilpenyimpananuangnegara(jasagiro/bunga),

d)

penerimaan ganti rugi atas kerugian negara (tuntutan ganti rugi dan
tuntutanperbendaharaan),

2)

e)

penerimaandendaketerlambatanpenyelesaianpekerjaanpemerintah,

f)

penerimaanpengembalianbelanjatahunanggaranlalu.

PNBPFungsional
Selain PNBP umum, pada kementerian/lembaga terdapat PNBP yang bersifat
fungsional, yaitu penerimaan yang berasal dari hasil pungutan kementerian
negara/lembagaatasjasayangdiberikansehubungandengantugaspokokdan
fungsinya dalam melaksanakan fungsi pelayanan kepada masyarakat.
Penerimaan fungsional tersebut terdapat pada sebagian besar kementerian
negara/lembaga, namun macam dan ragamnya berbeda antara satu
kementerian negara/lembaga dengan kementerian negara/lembaga lainnya,
tergantung kepada jasa pelayanan yang diberikan oleh masingmasing
kementeriannegara/lembaga.
MenurutUndangUndangNomor20tahun1997tentangPenerimaanNegara
BukanPajakjenisjenisPNBPfungsionalmeliputi:
a)

Penerimaanyangbersumberdaripengelolaandanapemerintah.

b)

Penerimaandaripemanfaatansumberdayaalam.

c)

Penerimaan dari hasilhasil kegiatan pelayanan yang dilaksanakan


pemerintah.

Manajemen Pemerintahan Pusat

101


d)

Penerimaandarikegiatanpelayananyangdilaksanakanpemerintah.

e)

Penerimaan berdasarkan putusan pengadilan dan yang berasal dari


pengenaandendaadministrasi.

f)

Penerimaanberupahibahyangmerupakanhakpemerintah.

g)

Penerimaanlainnyayangdiaturdalamundangundangtersendiri.

PenetapantarifatasjenisPNBPmemperhatikan:
1)

dampakpengenaanterhadapmasyarakatdankegiatanusahanya;

2)

biaya penyelenggaraan kegiatan pemerintah sehubungan dengan jenis


kegiatan;

3)

penerimaannegarabukanpajakyangbersangkutan;

4)

aspekkeadilandalampengenaanbebankepadamasyarakat.

Penetapan jumlah penerimaan negara bukan pajak yang terutang ditentukan


dengancara:
1)

ditetapkanolehinstansipemerintah;atau

2)

dihitungsendiriolehwajibbayar.

PNBP terutang menjadi kadaluwarsa setelah sepuluh tahun terhitung sejak saat
terutangnya penerimaan negara bukan pajak yang bersangkutan. Ketentuan
kadaluwarsa tertunda apabila wajib bayar melakukan tindak pidana di bidang
penerimaannegarabukanpajak.
c.

PelaporanRencanadanRealisasiPenerimaanPNBP
Instansi yang mengelola PNBP wajib menyampaikan laporan rencana dan realisasi
penerimaan secara periodik, sesuai dengan Peraturan Pemerintah Nomor 1 Tahun
2004 tentang Tata Cara Penyampaian Rencana dan Laporan Realisasi Penerimaan
NegaraBukanPajak.

102

2014 |Pusdiklatwas BPKP


Mekanismetentangpelaporandiatursebagaiberikut.
1)

Pejabat instansi pemerintah wajib menyampaikan rencana PNBP tahun


anggaran yang akan datang secara tertulis di lingkungan instansi pemerintah
yang bersangkutan kepada menteri keuangan paling lambat pada tanggal 15
Julitahunanggaranberjalan.

2)

Dalam hal pejabat instansi pemerintah tidak atau terlambat menyampaikan


rencana PNBP, menteri keuangan dapat menetapkan rencana PNBP instansi
pemerintahyangbersangkutan.

3)

Dalam hal terdapat revisi, pejabat instansi pemerintah wajib menyampaikan


revisi rencana PNBP kepada menteri keuangan, dengan ketentuan sebagai
berikut.
a)

RevisirencanaPNBPtahunyangakandatang,disampaikanpalinglambat
tanggal5Agustustahunanggaranyangbersangkutan.

b)

Revisi rencana PNBP tahun anggaran berjalan, disampaikan paling


lambattanggal15Agustustahunanggaranberjalan.

Dalam hal pejabat instansi pemerintah belum menyampaikan revisi rencana


PNBP menteri keuangan dapat menetapkan rencana PNBP untuk
masingmasinginstansipemerintah.
4)

Laporan realisasi PNBP triwulanan disampaikan secara tertulis oleh pejabat


instansi pemerintah kepada menteri keuangan paling lambat satu bulan
setelahtriwulanyangbersangkutanberakhir.

5)

Laporan perkiraan realisasi PNBP triwulan IV disampaikan kepada menteri


keuanganpalinglambattanggal15Agustustahunanggaranberjalan.

6)

Pejabatinstansipemerintahyangtidak/terlambatmenyampaikanrencanadan
laporan realisasi PNBP, dikenakan sanksi sesuai dengan peraturan
perundangundanganyangberlaku.

Manajemen Pemerintahan Pusat

103


d.

PenerimaandanPenyetoranPNBP
Seluruh PNBP dikelola dalam sistem anggaran pendapatan dan belanja negara,
melalui

dokumen

pelaksanaan

anggaran

(DIPA)

masingmasing

kementerian/lembaga.PengelolaanPNBPtersebutdiaturdenganketentuansebagai
berikut.
1)

Setiap kementerian negara/lembaga/satuan kerja yang mempunyai sumber


pendapatan wajib mengintensifkan perolehan pendapatan yang menjadi
wewenangdantanggungjawabnya.

2)

Menteri keuangan dapat menunjuk instansi pemerintah untuk menagih dan


ataumemungutpenerimaannegarabukanpajakyangterutang.

3)

Instansi pemerintah yang ditunjuk tersebut wajib menyetor langsung PNBP


yangditerimakekasnegara.

4)

Instansipemerintahyangditunjukwajibmenyampaikanrencanadanlaporan
realisasiPNBPsecaratertulisdanberkalakepadamenterikeuangan.

5)

Apabila kewajiban instansi pemerintah untuk menagih dan atau memungut


sertamenyetortidakdipenuhiakandikenakansanksisesuaidenganperaturan
perundangundanganyangberlaku.

e.

PenggunaanSebagianDanaPNBP
Pada dasarnya, seluruh PNBP wajib disetor langsung secepatnya ke kas negara.
Namun demikian, untuk beberapa kegiatan tertentu sebagian dana dari jenis
penerimaan negara bukan pajak dapat digunakan untuk kegiatan tertentu yang
berkaitandenganjenispenerimaannegarabukanpajaktersebutolehinstansiyang
bersangkutan. Penggunaan sebagian dana PNBP tersebut dapat dilakukan setelah
memerolehpersetujuandarimenterikeuangan.
KegiatanyangdapatmenggunakansebagiandanaPNBPmeliputi:

104

1)

penelitiandanpengembanganteknologi;

2)

pelayanankesehatan;

2014 |Pusdiklatwas BPKP


3)

pendidikandanpelatihan;

4)

penegakanhukum;

5)

pelayananyangmelibatkankemampuanintelektualtertentu;

6)

pelestariansumberdayaalam.

Proses permohonan untuk menggunakan sebagian dana PNBP diatur dalam PP


Nomor 73 Tahun 1999 tentang Tatacara Penggunaan PNBP yang bersumber dari
kegiatantertentusebagaiberikut.
1)

Pimpinan instansi pemerintah mengajukan permohonan penggunaan PNBP


kepadamenterikeuangandilengkapidengan:
a)

tujuanpenggunaandanapenerimaannegarabukanpajak;

b)

rincian kegiatan pokok instansi dan kegiatan yang akan dibiayai


penerimaannegarabukanpajak;

c)

jenispenerimaannegarabukanpajakbesertatarifyangberlaku;

d)

laporanrealisasidanperkiraantahunanggaranberjalansertaperkiraan
untukduatahunanggaranmendatang.

2)

Setelahmemperoleh persetujuandari menteri keuangan instansi pemerintah


mengajukan

rencana

penggunaan

untuk

setiap

tahun

anggaran

selambatlambatnyatanggal15November.
3)

Rencana penggunaan penerimaan negara bukan pajak tersebut diteliti dan


dibahasolehKementerianKeuanganbersamasamainstansipemerintahyang
bersangkutansebelumditetapkanolehmenterikeuangan.

4)

Sebagian dana penerimaan negara bukan pajak disediakan dalam suatu


dokumenanggarantahunanyangberlakusebagaisuratkeputusanotorisasi.

5)

Sebagian dana penerimaan negara bukan pajak tersebut dapat digunakan


untukmenyelenggarakankegiatantertentupadainstansibersangkutandalam
rangkapembiayaan:

Manajemen Pemerintahan Pusat

105

6)

a)

operasionaldanapemeliharaan;danatau

b)

investasi,termasukpeningkatankualitassumberdayamanusia.

Pembayaran atas pelaksanaan kegiatan instansi yang bersangkutan dianggap


sebagai pembayaran langsung kepada yang berhak atau melalui penyediaan
uang yang harus dipertanggungjawabkan (UYHD). Batas jumlah pembayaran
ditetapkanolehmenterikeuangan.

7)

SaldolebihdarisebagiandanaPNBP,padaakhirtahunanggaranwajibdisetor
seluruhnyakekasnegara.

8)

PembiayaansebagiandanaPNBPyangtelahdisediakandalamsuatudokumen
anggaran dan belum dilaksanakan atau belum diselesaikan dalam tahun
anggaran yang bersangkutan dapat dicantumkan pada dokumen anggaran
tahunberikutnyamelaluirevisianggaran.

9)

Pimpinaninstansipemerintahyangbersangkutansetiapawaltahunanggaran
menetapkan:
a)

atasanlangsungbendaharawanpenerima/pengguna;

b)

bendaharawanpenerima;

c)

bendaharawanpengguna.

Dalam hal bendaharawan belum ditunjuk, KPPN dilarang melakukan


pembayaran.
10)

Kewajibanpenyusunanlaporan
Pimpinan instansi pemerintah wajib menyampaikan laporan triwulan
mengenai seluruh penerimaan dan penggunaan dana oleh instansi yang
bersangkutankepadamenterikeuangan.

106

2014 |Pusdiklatwas BPKP


f.

Pemeriksaan
Ketentuanpemeriksaanantaralainsebagaiberikut.
1)

Atas permintaan pimpinan instansi pemerintah, instansi pemeriksa dapat


melaksanakan pemeriksaan terhadap wajib bayar yang menghitung sendiri
kewajibannya.

2)

Permintaan pimpinan instansi pemerintah sebagaimana dimaksud pada butir


1)dilakukanberdasarkan:
a)

hasil pemantauan instansi pemerintah terhadap wajib bayar yang


bersangkutan;

3)

b)

laporandaripihakketiga;atau

c)

permintaanwajibbayarataskelebihanpembayaranPNBP.

Hasil pemeriksaan atas instansi pemerintah disampaikan kepada menteri


keuangan dan selanjutnya diberitahukan kepada instansi pemerintah yang
bersangkutangunaditindaklanjuti.

4)

Hasil pemeriksaan terhadap wajib bayar untuk PNBP disampaikan kepada


instansi pemerintah untuk penetapan jumlah PNBP yang terutang oleh wajib
bayaryangbersangkutan.

5)

Jika wajib bayar kurang membayar jumlah PNBP yang terutang sebagaimana
hasil pemeriksaan, wajib bayar yang bersangkutan wajib melunasi
kekurangannya dan ditambah sanksi berupa denda administrasi sebesar 2%
sebulanuntukpalinglama24bulandarijumlahkekurangantersebut.

6)

Dalam hal berdasarkan hasil pemeriksaan terhadap wajib bayar untuk jenis
PNBP terdapat kelebihan pembayaran jumlah PNBP yang terutang, jumlah
kelebihan tersebut diperhitungkan sebagai pembayaran dimuka atas jumlah
PNBPyangterutangwajibbayaryangbersangkutanpadaperiodeberikutnya.

7)

Dalam hal terjadi pengakhiran kegiatan usaha wajib bayar, maka jumlah
kelebihan pembayaran PNBP dikembalikan kepada wajib bayar selambat
lambatnyasatubulansejakdikeluarkanketetapankelebihanpembayaran.

Manajemen Pemerintahan Pusat

107


8)

Dalam hal pengembalian kelebihan pembayaran dilakukan melampaui batas


waktu sebagaimana dimaksud dalam butir 7) di atas, kelebihan pembayaran
tersebut dikembalikan kepada wajib bayar ditambah imbalan bunga sebesar
2%sebulanuntukpalinglama24bulan.

g.

PNBPMelaluiPolaPengelolaanKeuanganBadanLayananUmum(PPKBLU)
Pada prinsipnya setiap penerimaan negara harus disetorkan ke Kas Negara atau
tidak diperkenankan untuk digunakan secara langsung untuk mendanai kegiatan.
Pada beberapa organisasi pemerintah yang memiliki fungsi pelayanan langsung
kepada masyarakat ketentuan tersebut cukup merepotkan karena pendanaan
kegiatan menjadi tidak fleksibel yang pada gilirannya dapat mengganggu aktivitas
pelayanan. Untuk mengatasi masalah tersebut, sesuai PP Nomor 23 Tahun 2005,
oraganisasi pemerintah dimungkinkan menerapkan Pola Pengelolaan Keuangan
BadanLayananUmum(PPKBLU).
BLU dibentuk dalam rangka memajukan kesejahteraan umum dan mencerdaskan
kehidupan bangsa. Kekayaan BLU merupakan kekayaan negara yang tidak
dipisahkan serta dapat dikelola sepenuhnya untuk pelayanan kepada masyarakat.
Oleh karena itu, BLU tetap menyusun anggaran sebagaimana instansi pemerintah
padaumumnyauntukdigabungkandalamRencanaKerjadanAnggaranKementerian
Negara/LembagamaupunAPBN.Pendapatandanbelanjayangdilakukandilaporkan
dalam laporan keuangan kementerian negara/lembaga yang membawahinya dan
dikonsolidasikandalamlaporanKeuanganPemerintahPusat.
Upaya peningkatan kinerja pelayanan maupun kinerja keuangan dilakukan dengan
memberikan fleksibilitas dalam pengelolaan keuangan. Pendapatan BLU dapat
bersumber dari APBN, jasa layanan, hibah atau sumbangan dari masyarakat.
Pendapatan BLU dapat digunakan secara langsung untuk membiayai belanjanya.
Dalampelaksanaananggaranbelanja,BLUjugadiberikanpengecualianuntuktidak
mengikuti ketentuan pengadaan barang/jasa sebagaimana yang berlaku di
pemerintahan karena alasan efisiensi dan produktivitas. Di samping itu, BLU juga
diperkenankanmemperolehpinjamanuntukmendanaikegiatannya.Untukmenjaga
kinerja pelayanan dan kinerja keuangan BLU maka diperlukan adanya pembinaan.

108

2014 |Pusdiklatwas BPKP


PembinaankeuanganBLUdilakukanolehMenteriKeuangansedangkanpembinaan
teknisdilakukanolehkementerianteknisyangmembawahinya.
1)

PenetapanBLU
Suatu satuan kerja instansi pemerintah dapat diizinkan mengelola keuangan
dengan PPKBLU apabila memenuhi persyaratan substantif, teknis, dan
administratif.
Persyaratan substantif terpenuhi apabila instansi pemerintah yang
bersangkutanmenyelenggarakanlayananumumyangberhubungandengan:
a)

penyediaanbarangdan/ataujasalayananumum;

b)

pengelolaan wilayah/kawasan tertentu untuk tujuan meningkatkan


perekonomianmasyarakatataulayananumum;dan/atau

c)

pengelolaandanakhususdalamrangkameningkatkanekonomidan/atau
pelayanankepadamasyarakat.

Persyaratanteknisterpenuhiapabila:
a)

kinerjapelayanandibidangtugaspokokdanfungsinyalayakdikeloladan
ditingkatkan

pencapaiannya

melalui

BLU

sebagaimana

direkomendasikan oleh menteri/pimpinan lembaga/kepala SKPD sesuai


dengankewenangannya;dan
b)

kinerja keuangan satuan kerja instansi yang bersangkutan adalah sehat


sebagaimanaditunjukkandalamdokumenusulanpenetapanBLU.

Persyaratan administratif terpenuhi apabila instansi pemerintah yang


bersangkutandapatmenyajikanseluruhdokumenberikut:
a)

pernyataan kesanggupan untuk meningkatkan kinerja pelayanan,


keuangan,danmanfaatbagimasyarakat;

b)

polatatakelola;

c)

rencanastrategisbisnis;

Manajemen Pemerintahan Pusat

109


d)

laporankeuanganpokok;

e)

standarpelayananminimum;dan

f)

laporan audit terakhir atau pernyataan bersedia untuk diaudit secara


independen.

Dokumen tersebut disampaikan kepada menteri/pimpinan lembaga/kepala


SKPD untuk mendapatkan persetujuan sebelum disampaikan kepada menteri
keuangan/gubernur/bupati/walikota,sesuaidengankewenangannya.
Ketentuan lebih lanjut mengenai persyaratan administratif diatur dengan
peraturan menteri keuangan/gubernur/bupati/walikota sesuai dengan
kewenangannya.
ProsespenetapanPPKBLUadalahsebagaiberikut.
a)

Menteri/pimpinan

lembaga/kepala

SKPD

mengusulkan

instansi

pemerintah yang memenuhi persyaratan substantif, teknis, dan


administratif untuk menerapkan PPKBLU kepada Menteri Keuangan/
gubernur/bupati/walikota,sesuaidengankewenangannya.
b)

Menteri Keuangan/gubernur/bupati/walikota menetapkan instansi


pemerintah yang telah memenuhi persyaratan untuk menerapkan PPK
BLU.

c)

Penetapan tersebut dapat berupa pemberian status BLU secara penuh


ataustatusBLUbertahap.
Status BLU secara penuh diberikan apabila seluruh persyaratan telah
dipenuhidenganmemuaskan.SedangkanstatusBLUBertahapdiberikan
apabila persyaratan substantif dan teknis telah terpenuhi, namun
persyaratan administratif belum terpenuhi secara memuaskan. Status
BLUBertahapberlakupalinglama3(tiga)tahun.

d)

Menteri

Keuangan/gubernur/bupati/walikota,

sesuai

dengan

kewenangannya, memberi keputusan penetapan atau surat penolakan

110

2014 |Pusdiklatwas BPKP


terhadap usulan penetapan BLU paling lambat 3 bulan sejak diterima
darimenteri/pimpinanlembaga/kepalaSKPD.
2)

PencabutanPenerapanPPKBLU
PenerapanPPKBLUberakhirbila:
a)

Dicabut oleh Menteri Keuangan/gubernur/bupati/walikota sesuai


dengankewenangannya;

b)

Dicabut oleh Menteri Keuangan/gubernur/bupati/walikota berdasarkan


usul dari menteri/pimpinan lembaga/kepala SKPD, sesuai dengan
kewenangannya;atauberubahstatusnyamenjadibadanhukumdengan
kekayaannegarayangdipisahkan.
Pencabutan penerapan PPKBLU dilakukan apabila BLU yang
bersangkutan sudah tidak memenuhi persyaratan substantif, teknis,
dan/atauadministratif.

Pencabutan status dilakukan berdasarkan penetapan ketentuan peraturan


perundangundangan,yaitu:
a)

Menteri

Keuangan/gubernur/bupati/walikota,

sesuai

dengan

kewenangannya, membuat penetapan pencabutan penerapan PPKBLU


atau penolakannya paling lambat 3 (tiga) bulan sejak tanggal usul
diterima. Dalam hal jangka waktu 3 (tiga) bulan terlampaui, usul
pencabutandianggapditolak.
b)

Instansi pemerintah yang pernah dicabut dari status PPKBLU dapat


diusulkankembaliuntukmenerapkanPPKBLUsesuaidenganketentuan
dalam Pasal 4 PP No.23 Tahun 2005 tentang Pengelolaan Keuangan
BadanLayananUmum.

3)

FleksibilitasBLU
SeluruhpendapatanoperasionalBLUadalahPNBP.Pendapatantersebutdapat
digunakan langsung, sesuai Rencana Bisnis dan Anggaran (RBA)nya tanpa

Manajemen Pemerintahan Pusat

111


terlebih dahulu disetorkan ke Rekening Kas Negara/Daerah. Anggaran BLU
dimasukkan dalam RKAK/L dan RBA definitif BLU merupakan lampiran DIPA
BLU. Dengan demikian penggunaan PNBP harus sesuai dengan peruntukan
yang telah ditetapkan dalam DIPA dan RBA BLU. Khusus untuk BLU di
lingkunganPemerintahPusat,selanjutnyasetiaptriwulan,BLUtersebutwajib
mempertanggungjawabkan penggunaan dana secara langsung tersebut,
dengan menyampaikan SPM pengesahan yang dilampiri Surat Pernyataan
Tanggung Jawab (SPTJ) kepada KPPN selambatlambatnya tanggal 10 setelah
akhirtriwulanyangbersangkutanuntukmemperolehpengesahan.
PadaSatkerPPKBLUPenuhdapatmenggunakanPNBPyangditerimanyauntuk
mendanai kegiatan Satker dengan ambang batas penggunaan untuk belanja
melampaui Rencana Bisnis dan Anggara (RBA) maksimal sebesar persentase
kelebihan realisasi dari target penerimaan. Penggunaan tersebut
dipertanggungjawabkan ke KPPN dengan mengajukan SPM Pengesahan.
Dalam hal realisasi belanja melampaui anggaran belanjanya (dengan
memperhatikanambangbatas),padaakhirtahundilakukanrevisiDIPAuntuk
mengesahkanpengeluaran/belanjatersebut
Pada Satker PPK BLU Bertahap dapat menggunakan PNBP yang diterimanya
untuk mendanai kegiatan Satker sebesar persentase yang disetujui Menteri
Keuangan. Dari jumlah yang disetujui penggunaannya tersebut sebagian
diantaranya (persentase sesuai ketetapan sebagai BLU) boleh digunakan
secara langsung tanpa disetorkan terlebih dahulu ke Kas Negara. Sedangkan
selebihnya wajib disetorkan ke Kas Negara dan bisa digunakan kembali oleh
SatkerdenganmekansimepencairanPNBP.Mekanismepenggunaansebagian
PNBP untuk mendanai kegiatan Satker mengikuti ketentuan belanja yang
berlaku.
Contoh:
BLU Bertahap A mempunyai target PNBP sebesar Rp100 miliar dan
mendapatkan persetujuan Menkeu untuk penggunaan 90% dari target
penerimaan tersebut. Keputusan Menkeu tentang penetapan BLU
menyebutkan Satker A dapat menggunakan PNBP secara langsung sebesar
60%.ApabilarealisasiPNBPsebesarRp30miliar,maka:

112

2014 |Pusdiklatwas BPKP


PNBPyangdapatdigunakansecaralangsung=Rp16,2miliar.
(Rp30miliarx90%x60%)
PNBPyangharusdisetorsecepatnyakeKasNegara=Rp13,8miliar
(Rp30miliarRp16,2miliar)
PNBP yang dapat digunakan dengan mekansime pencairan PNBP =
10,8miliar
(Rp30miliarx90%x40%)

3.

PenerimaanHibah(Hibah)
Penerimaanhibahadalahsemuapenerimaannegarabaikdalambentukdevisadan/atau
devisayangdirupiahkan,rupiah,maupundalambentukbarang,jasa,dansuratberharga
yang diperoleh dari pemberi hibah yang tidak perlu dibayar kembali dan yang tidak
mengikat,baikyangberasaldaridalamnegerimaupundariluarnegeri.
HibahmerupakanbagiandaripendapatandalamAPBNyangditerimapemerintahdalam
bentukuangtunai,uanguntukmembiayaikegiatan,barang/jasa,dansuratberharga.
a.

Uangtunai,penerimannyadisetorkanlangsungkeRekeningKasUmumNegaraatau
rekeningyangditentukanolehmenterikeuangan.

b.

Uang untuk membiayai kegiatan, penerimaannya dicantumkan dalam dokumen


pelaksanaananggaran.

c.

Barang/jasa, penerimaannya dicatat dalam Laporan Keuangan Pemerintah Pusat


yangdinilaidenganmatauangrupiahpadasaatserahterimabarang/jasa.

d.

Surat berharga, dicatat dalam Laporan Keuangan Pemerintah Pusat yang dinilai
denganmatauangrupiahberdasarkannilainominalyangdisepakatipadasaatserah
terimaolehpemberihibahdanpemerintah.

Penerimaanhibahmenurutjenisnyaterdiriatas:
a.

Hibah yang direncanakan, adalah hibah yang dilaksanakan melalui mekanisme


perencanaan.

b.

Hibah langsung, adalah hibah yang dilaksanakan tidak melalui mekanisme


perencanaan.

Manajemen Pemerintahan Pusat

113


Menurutsumbernyahibahdapatdibedakanmenjadidua,yaitu:
a.

Hibahdalamnegeri,yaituhibahyangbersumberdaridalamnegeriberasaldari:
1)

lembagakeuangandalamnegeri;

2)

lembaganonkeuangandalamnegeri;

3)

pemerintahdaerah;

4)

perusahaanasingyangberdomisilidanmelakukankegiatandiwilayahNegara
RepublikIndonesia;

b.

5)

lembagalainnya;dan

6)

perorangan.

Hibahluarnegeri,yaituhibahyangbersumberdariluarnegeriberasaldari:
1)

negaraasing;

2)

lembagadibawahPerserikatanBangsaBangsa;

3)

lembagamultilateral;

4)

lembagakeuanganasing;

5)

lembaganonkeuanganasing;

6)

lembagakeuangannasionalyangberdomisilidanmelakukankegiatanusahadi
luarwilayahNegaraRepublikIndonesia;

7)

perorangan.

Hibah yang bersumber dari luar negeri dapat diterushibahkan/dipinjamkan kepada


pemerintah daerah atau dipinjamkan kepada BUMN, sepanjang diatur dalam
perjanjianhibah.
Tatacarapenarikandanahibahyangbersumberdariluarnegeridibahaslebihlanjutpada
butirE.PROSESPEMBIAYAANmengenaipinjaman/hibahluarnegeri.

114

2014 |Pusdiklatwas BPKP


4.

Pembukuan,Penatausahaan,danAkuntansiPendapatan
a.

Pembukuan
Instansi pemerintah yang ditunjuk untuk menagih, memungut dan menyetorkan
PNBP wajib menyelenggarakan pembukuan, yaitu mengadakan suatu pencatatan
yangdapatmenyajikanketeranganyangcukupuntukdijadikandasarpenghitungan
PNBP.Pembukuandiselenggarakanolehbendahara.BerdasarkanPeraturanMenteri
Keuangan Nomor PER3/PB/2014, pembukuan bendahara terdiri dari Buku Kas
Umum (BKU), buku pembantu, dan Buku Pengawasan Anggaran. Pembukuan
tersebut dilakukan dengan aplikasi yang dibuat dan dibangun oleh kementerian
Keuangancq.DirektoratJenderalPerbendaharaan.Dalamhalaplikasitersebuttidak
dapatdigunakan,bendaharadapatmenyelenggarakanpembukuansecaramanual.
Halhalyangdiperhatikandalampembukuanolehbendaharayaitu:
Setiap transaksi harus segera dicatat dalam BKU sebelum dibukuan dalam
bukubukupembantudanpengawasananggaran.
PA/KPAdapatmenentukanbukubukubantu/registerselainBKU.
Pembukuandilaksanakanberdasarkanasasbruto.
KPAmelaksanakanpemeriksaankassekurangkurangnyasatukalidalamsatu
bulan dalam rangka pengawasan penatausahaan kas dan ketertiban
pembukuan.
Buku,catatandandokumenlainyangmenjadidasarperhitunganPNBPwajib
disimpan selama sepuluh tahun. Terhadap instansi pemerintah yang ditunjuk
atas permintaan menteri untuk menagih, memungut dan menyetorkan PNBP
jugadapatdiperiksakhususolehinstansiyangberwenang.
Pembukuan oleh bendahara dilakukan berdasarkan dokumen sumber. Dokumen
sumberadalahseluruhdokumenterkaitdenganuangyangdikelolaBendaharaserta
transaksidalamrangkapelaksanaananggaransatuankerja,antaralain:
DIPAyangtelahmendapatpengesahan.
SPMUP/SPMTUP/SPMGUP/SPMLSyangtelahditerbitkanSP2D

Manajemen Pemerintahan Pusat

115


SSP/SSBP/SSPByangtelahmendapatNTPNdanNTB/NTP/NPP
Kwitansi/dokumen pembayaran atas uang yang bersumber dari UP atau LS
Bendahara
FakturpajakataspotonganuangyangbersumberdariUPatauLSBendahara
SBS/buktipenerimaanBendaharaPenerimaan
BendaharapenerimaanwajibmenyusunLPJBendaharaatasuangyangdikelolanya
secarabulanan.LPJtersebutdibuatberdasarkanpembukuanyangdiselenggarakan
bendahara yang telah diperiksa dan direkonsiliasi oleh KPA atau pejabat yang
bertugas melakukan pemungutan penerimaan negara. LPJ Bendahara Penerimaan
dituangkan sebagaimana Format 1b Lampiran VIII Peraturan Menteri Keuangan
NomorPER3/PB/2014.
b.

Penatausahaan
Penatausahaanpenerimaannegaraperludilakukansecaracepat,tepat,danefisien
agar menghasilkan laporan yang dapat dipertanggungjawabkan. Penatasusahaan
penerimaan melibatkan BUN (Kuasa BUN), Wajib Pajak/Wajib Bayar/Wajib
Setor/Bendahara Penerimaan, dan bank persepsi/kantor pos yang ditunjuk. Untuk
menunjang kegiatan penatusahaan tersebut digunakan suatu sistem penerimaan
negarayangterpaduyangdikenaldenganModulPenerimaanNegara(MPN).
MPN adalah modul penerimaan yang memuat serangkaian prosedur mulai dari
penerimaan, penyetoran, pengumpulan data, pencatatan, pengikhtisaran sampai
dengan pelaporan yang berhubungan dengan penerimaan negara dan merupakan
bagian dari Sistem Perbendaharaan dan Anggaran Negara (Peraturan Menteri
KeuanganNomorPER02/PMK.05/2007).
Wajib Pajak/Wajib Bayar/Wajib Setor/Bendahara Penerimaan dapat melakukan
pembayaran setiap saat melalui Bank/Pos yang terhubung dengan MPN.
Penerimaan negara yang disetor oleh Wajib Pajak/Wajib Bayar/Wajib
Setor/Bendahara Penerimaan diakui pada saatmasuk ke Rekening Kas Negara dan
mendapatkan NTPN (nomor yang tertera pada bukti penerimaan negara yang
diterbitkanmelaluiMPN).

116

2014 |Pusdiklatwas BPKP


TerkaitdengandiperkenankannyapenggunaanPNBPsesuaiketentuanyangberlaku,
penatausahaanPNBPditingkatSatkerdapatdikelompokkansebagaiberikut.
Pada Satker yang tidakmempunyai hak penggunaan (izinMenteri Keuangan)
PNBP yang diterimanya, seluruh realisasi penerimaannya disetorkan ke Kas
NegaradantidakadapenggunaanPNBPuntukmendanaikegiatanSatker.
Pada Satker yang mempunyai hak penggunaan sebagaian PNBP yang
diterimanya (dari Menteri Keuangan), seluruh realisasi penerimaannya
disetorkan ke Kas Negara dan diperkenankan menggunakan PNBP untuk
mendanai kegiatan Satker sebesar persentase yang disetujui Menteri
Keuangan dengan mekansime pencairan PNBP. Sedangkan mekanisme
penggunaan sebagian PNBP untuk mendanai kegiatan Satker mengikuti
ketentuanbelanjayangberlaku.
Pada Satker BLU, penerimaannya bisa langsung digunakan dengan ketentuan
sebagaimanadiuraikanpadabutirB.2.g.3).
c.

Akuntansi
Penyelenggaraan akuntansi terkait dengan kewajiban Satuan Kerja sebagai unit
akuntansi untuk dapat menyampaikan laporan keuangan yang akan dikonsolidasi
sampaiketingkatPenggunaAnggara(K/L).Sistemakuntansiyangdigunakanadalah
SistemAkuntansiInstansi,yangdalamkaitanpenerimaannegaraakanmenghasilkan
LaporanRealisasiAnggaranyangmenyajikananggarandanrealisasipendapatandan
belanjasatuankerjadalamsatutahunanggaran.
Dalam pencatatan transaksi akuntansi penerimaan sebagai dasar pencatatan
estimasi pendapatan adalah DIPA Kementerian Negara/Lembaga atau dokumen
pelaksanaananggaranlainnyayangdipersamakandenganDIPA.
Dokumensumbersebagaidasarpencatatanrealisasipenerimaannegaraantaralain
meliputiSuratSetoranPajak(SSP),SuratSetoranBukanPajak(SSBP),SuratSetoran
Pabean,Cukai,danPajak(SSPCP),SuratTandaBuktiSetor(STBS),danSuratSetoran
Pengembalian Belanja (SSBP) dan Bukti Penerimaan Negara (BPN)yang diterbitkan
olehBankPersepsi/DevisaPersepsi/PosPersepsidan/atauKPPN.

Manajemen Pemerintahan Pusat

117


Seluruh dokumen sumber penerimaan negara dinyatakan sah setelah mendapat
Nomor Transaksi Penerimaan Negara (NTPN) dan Nomor Transaksi Bank
(NTB)/NomorTransaksiPos(NTP)/NomorPenerimaanPotongan(NPP).
Beberapaketentuanakuntansiterkaitpenerimaanyaitusebagaiberikut:
Penerimaan negara diakui pada saat diterima pada Rekening Kas Negara
(dibuktikandenganNTPN).
Penetapan penerimaan perpajakan dan bukan pajak yang belum dan/atau
sudah jatuh tempo tetapi belum disetor ke Rekening Kas Negara pada saat
tanggalNeracadiakuisebagaipiutang.
Pembahasan lebih lanjut mengenai akuntansi terkait SAI dan Pelaporan Keuangan
padaBABVIPELAPORANPENGELOLAANDANPERTANGGUNGJAWABANKEUANGAN
NEGARA.

C.

MEKANISMEPELAKSANAANBELANJA

1.

PedomanPelaksanaanAnggaranBelanja
Anggaran belanja negara adalah semua pengeluaran negara yang digunakan untuk
membiayaibelanjapemerintahpusatdanbelanjauntukdaerah.Belanjapemerintahpusat
dikelompokkan menurut organisasi/bagian anggaran, fungsi, dan jenis belanja. Belanja
daerah adalah semua pengeluaran untuk membiayai dana perimbangan serta dana
otonomikhususdanpenyesuaian.Danaperimbanganadalahsemuapengeluarannegara
yang dialokasikan kepada daerah untuk membiayai kebutuhan daerah dalam rangka
pelaksanaandesentralisasi,yangterdiriatasdanabagihasil,danaalokasiumum,dandana
alokasikhusus.
Pelaksanaananggaranbelanjadiwujudkanmelaluipembayaranatasrealisasibelanjadari
rekening kas umum negara (KUN) kepada pihak III yang secara visual dapat dilihat pada
Gambar5.1berikut.

118

2014 |Pusdiklatwas BPKP


Gambar5.2MekanismePembayaran

Padaprinsipnyasemuapengeluarannegaradilakukansecaragiral(lalulintasperbankan)
atas beban rekening kas negara/kas umum negara melalui transfer dana atau
pemindahbukuandanaantarrekeningbank(mekanismeLS),termasukmembayartagihan
pihak ketiga yang dilakukan oleh kantor/satuan kerja kementerian negara/lembaga.
Dengan demikian, penyaluran dana APBN kepada yang berhak dilakukan transfer dana
atau pemindahbukuan dana langsung dari rekening kas negara/kas umum negara ke
rekening yang berhak pada bank. Pengecualian diberikan untuk pembelian atau
pengadaanbarang/jasakeperluankantor/satuankerjakementeriannegara/lembagayang
nilainya kecilkecil sampai dengan Rp50.000.000,00 dapat dibayar melalui uang
persediaan yang dikelola bendahara pengeluaran/bendahara pengeluaran pembantu
(BPP).
2.

PenyelesaianTagihanNegara/PengeluaranNegara
Penyelesaiantagihansegeradilakukansetelahdiwujudkannyakomitmenyangditunjukkan
dari prestasi kerja serta adanya tagihan dari penyedia barang/jasa. Berdasarkan tagihan
tersebut,PPKmengajukanSPP(SuratPermintaanPembayaran)yangselanjutnyadiujioleh
PPSPM (Pejabat Penandatangan Surat Perintah Membayar). Apabila telah memnuhi
persyaratan dan ketentuan yang berlaku, selanjutnya PPSPM menerbitkan SPM untuk

Manajemen Pemerintahan Pusat

119


selanjutnya disampaikan ke KPPN. KPPN dengan kewenangan selaku kuasa BUN
selanjutnya melakukan pengujian, dan apabila memenuhi ketentuan, KPPN menerbitkan
SP2D (Surat Perintah Pencairan Dana) sebagai dasar pencairan dana untuk penyelesaian
tagihan/pengeluaran negara. Visualisasi dari proses tersebut sebagaiman pada Gambar
5.2berikut.
Gambar5.3MekanismePenyelesaianTagihan/PengeluaranNegara

Penjelasan lembih rinci dari proses penyelesaian tagihan negara/pengeluaran negara


adalahsebagaiberikut.
a.

PembuatanKomitmen
Pelaksanaan kegiatan dan penggunaan anggaran pada DIPA yang mengakibatkan
pengeluarannegaradilakukanmelaluipembuatankomitmen.Pembuatankomitmen
tersebut dalam bentuk perjanjian/kontrak untuk pengadaan barang/jasa dan/atau
penetapankeputusan,sebagaimanapadaGambar5.3berikut.

120

2014 |Pusdiklatwas BPKP


Gambar5.4JenisjenisPembuatanKomitmen

1)

Pembuatan Komitmen dalam Bentuk Perjanjian/Kontrak untuk Pengadaan


Barang/Jasa
Satker di lingkungan kementerian negara/lembaga dapat memulai proses
pelelangan dalam rangka perjanjian/kontrak untuk pengadaan barang/jasa
untuk tahun anggaran berikutnya, setelah rencana kerja dan anggaran
kementerian negara/lembaga disetujui oleh Dewan Perwakilan Rakyat. Biaya
proses pelelangan dalam rangka pengadaan barang/jasa pemerintah yang
membebanibelanjamodaldialokasikandalambelanjamodaltahunanggaran
berjalan.Untukbiayaprosespelelangandalamrangkapengadaanbarang/jasa
tahun anggaran berikutnya yang membebani belanja barang/bantuan sosial
dialokasikandalambelanjabarangtahunanggaranberjalan.Realisasibelanja
atasalokasianggaranbiayaprosespelelanganyangberasaldaribelanjamodal
padatahunanggaranberjalan,dicatatdalamneracasebagaiKonstruksiDalam
Pengerjaan(KDP).
Proses lelang pengadaan barang/jasa yang dibiayai melalui dana tahun
anggaran berjalan dilaksanakan oleh panitia pengadaan atau unit layanan
pengadaan (ULP) yang dibentuk pada tahun anggaran berjalan.
Penandatanganan perjanjian/ kontrak atas pelaksanaan pengadaan
barang/jasa sebagai tindak lanjut atas pelaksanaan lelang dilakukan setelah
DIPAtahunanggaranberikutnyadisahkandanberlakuefektif.Dalamhalbiaya
proses pelelangan dalam rangka pengadaan barang/jasa tidak dialokasikan

Manajemen Pemerintahan Pusat

121


pada tahun anggaran berjalan, biaya proses pelelangan dimaksud dapat
dialokasikanpadaDIPAtahunanggaranberjalandenganmelakukanrevisiDIPA
sesuai ketentuan yang diatur dalam Peraturan Menteri Keuangan mengenai
revisiDIPA.
Bentukperjanjian/kontrakuntukpengadaanbarang/jasasampaidenganbatas
nilaitertentusesuaidenganketentuanperaturanperundangundangandapat
berupa buktibukti pembelian/pembayaran. Ketentuan mengenai batas nilai
tertentutersebutmengikutiketentuandalamperaturanperundangundangan
mengenai pengadaan barang/jasa pemerintah. Berdasarkan Peraturan
PemerintahNomor70Tahun2012tanggal1Agustus2012tentangPerubahan
Kedua atas Peraturan Presiden Nomor 54 Tahun 2010 tentang Pengadaan
Barang/Jasa Pemerintah, dinyatakan bahwa tanda bukti perjanjian terdiri
sebagaimanaberikutini.
a)

Bukti pembelian, digunakan untuk pengadaan barang/jasa dengan nilai


sampaidenganRp10.000.000,00.

b)

Kuitansi, digunakan untuk pengadaan barang/jasa dengan nilai sampai


denganRp50.000.000,00.

c)

SuratPerintahKerja(SPK)digunakanuntukpengadaanbarang/pekerjaan
konstruksi/jasa lainnya dengan nilai sampai dengan Rp200.000.000,00
danjasakonsultasidengannilaisampaidenganRp50.000.000,00.

d)

Suratperjanjian/kontrak,digunakanuntukpengadaanbarang/pekerjaan
konstruksi/jasa lainnya dengan nilai di atas Rp200.000.000,00 dan jasa
konsultasidengannilaidiatasRp50.000.000,00.

Pada dasarnya, perjanjian/kontrak pengadaan barang/jasa dibebankan pada


DIPA tahun anggaran berkenaan. Akan tetapi, perjanjian/kontrak juga dapat
membebani lebih dari satu anggaran. Perjanjian/kontrak yang pelaksanaan
pekerjaannya membebani DIPA lebih dari satu tahun anggaran tersebut
dilakukan setelah mendapat persetujuan pejabat yang berwenang.
Persetujuan atas perjanjian/kontrak yang membebani lebih dari satu tahun
anggarantersebutdiaturdalamPeraturanMenteriKeuangantersendiri.

122

2014 |Pusdiklatwas BPKP


Perjanjian/kontrak atas pengadaan barang/jasa dapat dibiayai sebagian atau
seluruhnya dengan rupiah murni dan/atau pinjaman dan/atau hibah.
Perjanjian/kontrak tersebut, dilaksanakan berdasarkan ketentuan peraturan
perundangundanganmengenaipengadaanbarang/jasapemerintah.
2)

PembuatanKomitmendalambentukPenetapanKeputusan
Pembuatan komitmen melalui penetapan keputusan yang mengakibatkan
pengeluarannegaraantaralaindilakukanuntuk:
a)

pelaksanaanbelanjapegawai;

b)

pelaksanaanperjalanandinasyangdilaksanakansecaraswakelola;

c)

pelaksanaan kegiatan swakelola, termasuk pembayaran honorarium


kegiatan;atau

d)

belanja bantuan sosial yang disalurkan dalam bentuk uang kepada


penerimabantuansosial.

Penetapankeputusantersebutdilakukanolehpejabatyangberwenangsesuai
ketentuanperaturanperundangundanganyangberlaku.
b.

PencatatanKomitmenolehPPKdanKantorPelayananPerbendaharaanNegara
1)

DataPerjanjian/Kontrak
Untuk perjanjian/kontrak yang pembayarannya akan dilakukan secara
langsung melalui SPMLS, PPK mencatatkan perjanjian/kontrak tersebut ke
dalamsuatusistemyangdisediakanolehDirektoratJenderalPerbendaharaan
yangpalingkurangmeliputidatasebagaiberikut:
a)

namadankodesatkersertauraianfungsi/subfungsi,program,kegiatan,
output,danakunyangdigunakan;

b)

nomorsuratpengesahandantanggalDIPA;

c)

nomor, tanggal, dan nilai perjanjian/kontrak yang telah dibuat oleh


satker;

Manajemen Pemerintahan Pusat

123


d)

uraianpekerjaanyangdiperjanjikan;

e)

data penyedia barang/jasa yang tercantum dalam perjanjian/kontrak


antara lain nama rekanan, alamat rekanan, NPWP, nama bank, nama,
dannomorrekeningpenerimapembayaran;

f)

jangka waktu dan tanggal penyelesaian pekerjaan serta masa


pemeliharaanapabiladipersyaratkan;

g)

ketentuansanksiapabilaterjadiwanprestasi;

h)

addendum perjanjian/kontrak apabila terdapat perubahan data pada


perjanjian/kontraktersebut;dan

i)

carapembayarandanrencanapelaksanaanpembayaran:
(1)

sekaligus(misal,sebesartotalnilaikontrakRp280jutapadabulan
berakhirnyakontrakSeptember2014);atau

(2)

secara bertahap (misal, tahap I Rp80 juta pada bulan pertama


kontrak,tahapIIRp100jutapadapertengahankontrak,dantahap
IIIRp100jutapadabulanberakhirnyakontrak).

Selanjutnya,dataperjanjian/kontrakbesertaADKnyatersebutdisampaikanke
KPPN secara langsung atau melalui email. Alokasi dana yang sudah tercatat
dan terikat dengan perjanjian/kontrak tersebut tidak dapat digunakan lagi
untukkebutuhanlain.
Data perjanjian/kontrak yang memuat informasi sebagaimana dimaksud di
atas, disampaikan kepada KPPN paling lambat lima hari kerja setelah
ditandatanganinya perjanjian/kontrak untuk selanjutnya dicatat dalam Kartu
PengawasanKontrakKPPN.
Data perjanjian/kontrak dalam Kartu Pengawasan Kontrak KPPN digunakan
untukmengujikesesuaiantagihanyangtercantumpadaSPMyangmencakup:

124

a)

pihakyangberhakmenerimapembayaran;

b)

nilaipembayaran;dan

c)

jadwalpembayaran.

2014 |Pusdiklatwas BPKP


2)

PerubahanDataPegawai
Untukkeperluanbelanjapegawaipadasatker,dalamhalterdapatperubahan
datapegawaiberupapenetapankeputusanyangmengakibatkanpengeluaran
negara untuk pelaksanaan belanja pegawai, Petugas Pengelola Administrasi
Belanja Pegawai (PPABP) mencatat perubahan data pegawai tersebut ke
dalamsuatusistemyangdisediakanolehDirektoratJenderalPerbendaharaan.
Perubahandatapegawaidimaksudterkaitdengan:
a)

pengangkatan/pemberhentiansebagaicalonpegawainegeri;

b)

pengangkatan/pemberhentiansebagaipegawainegeri;

c)

kenaikan/penurunanpangkat;

d)

kenaikan/penurunangajiberkala;

e)

pengangkatan/pemberhentiandalamjabatan;

f)

mutasipindahkesatkerlain;

g)

pegawaibarukarenamutasipindah;

h)

perubahandatakeluarga;

i)

datautangkepadanegara;dan/atau

j)

pengenaansanksikepegawaian.

Setelahdilakukanpencatatanperubahandatapegawai,satkermenyampaikan
DaftarPerubahanDataPegawaiyangtelahdisahkanPPSPMbesertaADKnya
kepada KPPN paling lambat bersamaan dengan pengajuan SPM Belanja
Pegawai. Daftar perubahan data pegawai dimaksud bukan merupakan
lampirandariSPMBelanjaPegawai.Daftartersebutdigunakandalamrangka
pemutakhiran data antara KPPN dengan satker untuk pembayaran belanja
pegawaidanuntukmengujikesesuaiandengantagihan.
c.

MekanismePenyelesaianTagihandanPenerbitanSPP
1)

PengajuanTagihan
Setelah kegiatan atas dasar komitmen selesai dilaksanakan, penerima hak
(pihakketigaataubendaharapengeluaran/pihaklainnya)mengajukantagihan

Manajemen Pemerintahan Pusat

125


kepada negara berdasarkan buktibukti yang sah untuk memperoleh
pembayaran.Selanjutnya,PPKmelakukanpengujianatasbuktibuktitersebut.
Pelaksanaan pembayaran tagihan kepada penerima hak dilakukan dengan
pembayaran langsung (LS) kepada pihak ketiga atas dasar perjanjian/kontrak
untuk pengadaan barang/jasa atau bendahara pengeluaran/pihak lainnya
untukkeperluanbelanjapegawainongajiinduk,pembayaranhonorarium,dan
perjalanandinas atas dasar surat keputusan. Dalam hal pembayaran LS tidak
dapatdilakukan,pembayarantagihankepadapenerimahakdilakukandengan
menggunakanuangpersediaan(UP).
Khususuntukpembayarankomitmenberupaperjanjian/kontrakdalamrangka
pengadaanbarang/jasaberlakuketentuansebagaiberikut.
a)

Pembayarantidakbolehdilakukansebelumbarang/jasaditerima.

b)

Dalamhalpengadaanbarang/jasayangkarenasifatnyaharusdilakukan
pembayaran terlebih dahulu, pembayaran atas beban APBN dapat
dilakukan sebelum barang/jasa diterima setelah terlebih dahulu
penyedia barang/jasa menyampaikan jaminan atas pembayaran yang
akan dilakukan. Nilai jaminan tersebut minimal sama dengan nilai
pembayaranatasbebanAPBNtersebut.

Pembayarantagihankepadapihakketiga/penyediabarang/jasa,dilaksanakan
berdasarkanbuktibuktiyangsahyangmeliputi:
a)

buktiperjanjian/kontrak,

b)

referensi bank yang menunjukkan nama dan nomor rekening penyedia


barang/jasa,

126

c)

beritaacarapenyelesaianpekerjaan,

d)

beritaacaraserahterimapekerjaan/barang,

e)

buktipenyelesaianpekerjaanlainnyasesuaiketentuan,

f)

beritaacarapembayaran,

g)

kuitansiyangtelahditandatanganiolehpenyediabarang/jasadanPPK,

2014 |Pusdiklatwas BPKP


h)

fakturpajakbesertasuratsetoranpajak(SSP)yangtelahditandatangani
olehwajibpajak/bendaharapengeluaran,

i)

jaminan yang dikeluarkan oleh bank atau lembaga keuangan lainnya


sebagaimana dipersyaratkan dalam peraturan perundangundangan
tentangpengadaanbarang/jasapemerintah,dan/atau

j)

dokumen lain yang dipersyaratkan khususnya untuk perjanjian/kontrak


yang dananya sebagian atau seluruhnya bersumber dari pinjaman atau
hibah dalam/luar negeri sebagaimana dipersyaratkan dalam naskah
perjanjianpinjamanatauhibahdalam/luarnegeri.

Buktibukti yang sah untuk pembayaran tagihan kepada bendahara


pengeluaran/pihak lainnya untuk keperluan belanja pegawai non gaji induk,
pembayaranhonorarium,danperjalanandinasatasdasar:

2)

a)

suratkeputusan,

b)

surattugas/suratperjalanandinas,

c)

daftarpenerimapembayaran,dan/atau

d)

dokumenpendukunglainnyasesuaiketentuan.

NormaWaktuPengajuanTagihan
Tagihan atas pengadaan barang/jasa dan/atau pelaksanaan kegiatan yang
membebani APBN diajukan dengan surat tagihan oleh penerima hak kepada
PPKpalinglambatlimaharikerjasetelahtimbulnyahaktagihkepadanegara.
Dalamhallimaharikerjasetelahtimbulnyahaktagihkepadanegarapenerima
hak belum mengajukan surat tagihan, PPK harus segera memberitahukan
secara tertulis kepada penerima hak untuk mengajukan tagihan. Apabila
belum mengajukan tagihan, penerima hak pada saat mengajukan tagihan
harusmemberikanpenjelasansecaratertuliskepadaPPKatasketerlambatan
pengajuantagihantersebut.
DalamhalPPKmenolak/mengembalikantagihankarenadokumenpendukung
tagihantidaklengkapdanbenar,PPKharusmenyatakansecaratertulisalasan

Manajemen Pemerintahan Pusat

127


penolakan/pengembalian tersebut paling lambat dua hari kerja setelah
diterimanyasurattagihan.
3)

MekanismePenerbitanSPPLS
Setelah pengujian yang dilakukan memenuhi persyaratan, PPK mengesahkan
dokumentagihandanmenerbitkanSPP.PenerbitanSPPLSuntukpembayaran
belanjapegawai(gajiinduk)dannonpegawaidiatursebagaiberikut.
a)

PembayaranGajiInduk
Pembayarangajiindukdilengkapidengandokumenpendukungsebagai
berikut:
(1)

DaftarGaji,RekapitulasiDaftarGaji,danHalamanLuarDaftarGaji
yang ditandatangani oleh PPABP, Bendahara Pengeluaran, dan
KPA/PPK;

(2)

DaftarPerubahanDataPegawaiyangditandatanganiPPABP;

(3)

DaftarPerubahanPotongan;

(4)

Daftar Penerimaan Gaji Bersih Pegawai untuk pembayaran gaji


yang dilaksanakan secara langsung pada rekening masingmasing
pegawai;

(5)

fotokopidokumenpendukungperubahandatapegawaiyangtelah
dilegalisasi oleh kepala satker/pejabat yang berwenang meliputi
surat keputusan (SK) terkait dengan pengangkatan CalonPegawai
Negeri, SK Pegawai Negeri, SK Kenaikan Pangkat, Surat
Pemberitahuan Kenaikan Gaji Berkala, SK Mutasi Pegawai, SK
MendudukiJabatan,SuratPernyataanMelaksanakanTugas,Surat
atau Akta terkait dengan anggota keluarga yang mendapat
tunjangan,SuratKeteranganPenghentianPembayaran(SKPP),dan
surat keputusan yang mengakibatkan penurunan gaji, serta SK
PemberianUangTunggusesuaiperuntukannya;

(6)

128

ADKterkaitdenganperubahandatapegawai;

2014 |Pusdiklatwas BPKP


(7)

ADK perhitungan pembayaran belanja pegawai sesuai perubahan


datapegawai;dan

(8)
b)

suratsetoranPajakPenghasilanPasal21.

PenerbitanSPPLSuntukpembayarannonbelanjapegawai
Berikut ini dicontohkan kelengkapan dokumen untuk beberapa
pembayarannonbelanjapegawai.
(1)

Pembayaranhonorariumdilengkapidengandokumenpendukung,
meliputi:
suratkeputusanyangterdapatpernyataanbahwabiayayang
timbul akibat penerbitan surat keputusan dimaksud
dibebankanpadaDIPA;
daftar nominatif penerima honorarium yang memuat paling
sedikit nama orang, besaran honorarium, dan nomor
rekening masingmasing penerima honorarium yang
ditandatanganiolehKPA/PPKdanbendaharapengeluaran;
surat setoran PPh Pasal 21 yang ditandatangani oleh
bendaharapengeluaran;dan
surat keputusan sebagaimana dimaksud pada angka (1)
dilampirkan pada awal pembayaran dan pada saat terjadi
perubahansuratkeputusan.

(2)

Untukpembayaranperjalanandinasdiatursebagaiberikut.
Perjalanandinasjabatanyangsudahdilaksanakan,dilampiri:
-

daftarnominatifperjalanandinas;dan

dokumen pertanggungjawaban biaya perjalanan dinas


jabatan sebagaimana diatur dalam Peraturan Menteri
Keuangan mengenai perjalanan dinas dalam negeri
bagipejabatnegara,pegawainegeri,danpegawaitidak
tetap.

Manajemen Pemerintahan Pusat

129


Perjalanandinasjabatanyangbelumdilaksanakan,dilampiri
daftarnominatifperjalanandinas.
Daftarnominatifsebagaimanadimaksudpadaangka(1)dan
(2) ditandatangani oleh PPK yang memuat paling kurang
informasi mengenai pihak yang melaksanakan perjalanan
dinas

(nama,

pangkat/golongan),

tujuan,

tanggal

keberangkatan, lama perjalanan dinas, dan biaya yang


diperlukanuntukmasingmasingpejabat.
Untuk perjalanan dinas pindah, dilampiri dengan dokumen
pertanggungjawaban

biaya

perjalanan

dinas

pindah

sebagaimana diatur dalam Peraturan Menteri Keuangan


mengenaiperjalanandinasdalamnegeribagipejabatnegara,
pegawainegeri,danpegawaitidaktetap.
(3)

PenerbitanSPPLSuntukpembayaranpengadaanbarang/jasaatas
bebanbelanjabarang,belanjamodal,belanjabantuansosial,dan
belanja lainlain dilengkapi dengan dokumen/bukti pengeluaran
yangsahsebagaimanadijelaskandalampengajuantagihan.

(4)

Penerbitan SPPLS untuk pembayaran belanja bantuan sosial


kepada penerima bantuan sosial diatur dalam Peraturan Menteri
Keuangantersendiri.

(5)

Penerbitan SPPLS untuk pembayaran belanja pembayaran


kewajiban utang, belanja subsidi, belanja hibah, masingmasing
diaturdalamPeraturanMenteriKeuangantersendiri.

NormawaktupenyelesaianSPPLSdiatursebagaiberikut.
(1)

SPPLS untuk pembayaran belanja pegawai diterbitkan oleh PPK


dan disampaikan kepada PPSPM paling lambat empat hari kerja
setelahdokumenpendukungditerimasecaralengkapdanbenar.

(2)

SPPLSuntukpembayarangajiinduk/bulananditerbitkanolehPPK
dan disampaikan kepada PPSPM paling lambat tanggal 5 sebelum

130

2014 |Pusdiklatwas BPKP


bulan pembayaran. Dalam hal tanggal 5 sebagaimana dimaksud
padaayat(5)merupakanhariliburatauhariyangdinyatakanlibur,
penyampaianSPPLSkepadaPPSPMdilakukanpalinglambatpada
harikerjasebelumtanggal5.
(3)

SPPLS untuk pembayaran non belanja pegawai diterbitkan oleh


PPKdandisampaikankepadaPPSPMpalinglambatlimaharikerja
setelah dokumen pendukung diterima secara lengkap dan benar
daripenerimahak.

4)

Mekanisme Pembayaran dengan Uang Persediaan dan Tambahan Uang


Persediaan(UPdanTUP)
Uang Persediaan (UP) digunakan untuk membiayai kegiatan operasional
seharihari satker dan membiayai pengeluaran yang tidak dapat dilakukan
melalui mekanisme pembayaran LS. UP merupakan uang muka kerja dari
Kuasa BUN kepada Bendahara Pengeluaran yang dapat dimintakan
penggantiannya(revolving).
Pembayaran dengan UP yang dapat dilakukan oleh Bendahara Pengeluaran/
BPP kepada satu penerima/penyedia barang/jasa paling banyak sebesar
Rp50.000.000,00kecualiuntukpembayaranhonorariumdanperjalanandinas.
Pembayaran dengan UP oleh Bendahara Pengeluaran/BPP kepada satu
penerima/penyedia barang/jasa dapat melebihi Rp50.000.000,00 setelah
mendapat

persetujuan

Menteri

Keuangan

c.q.

Direktur

Jenderal

Perbendaharaan.Padasetiapakhirharikerja,uangtunaiyangberasaldariUP
yang ada pada Kas Bendahara Pengeluaran/BPP paling banyak sebesar
Rp50.000.000,00UPdapatdiberikanuntukpengeluaranpengeluaran:
a)

belanjabarang;

b)

belanjamodal;dan

c)

belanjalainlain.

Bendaharapengeluaran/BPPmelakukanpenggantian(revolving)UPyangtelah
digunakan sepanjang dana yang dapat dibayarkan dengan UP masih tersedia
dalam DIPA. Penggantian UP tersebut dilakukan apabila UP telah digunakan

Manajemen Pemerintahan Pusat

131


palingsedikit50%.Untukbendaharapengeluaranyangdibantuolehbeberapa
BPP, dalam pengajuan UP ke KPPN harus melampirkan daftar rincian yang
menyatakanjumlahuangyangdikelolaolehmasingmasingBPP.
KepalaKPPNmenyampaikansuratpemberitahuankepadaKPA,dalamhaldua
bulan sejak SP2DUP/SP2DGUP diterbitkan belum dilakukan pengajuan
penggantian UP. Apabila dalam satu bulan sejak disampaikan surat
pemberitahuan belum dilakukan pengajuan penggantian UP, Kepala KPPN
memotong UP sebesar 25%. Pemotongan dana UP dilakukan dengan cara,
Kepala KPPN menyampaikan surat pemberitahuan kepada KPA untuk
memperhitungkan potongan UP dalam SPM dan/atau menyetorkan ke kas
negara.KetentuaniniberlakuSP2DGUPselanjutnya.
Dalam hal satu bulan setelah surat pemberitahuan untuk melakukan
pemotongan UP sebesar 25%, KPA tidak memperhitungkan potongan UP
dalam SPM dan/atau menyetorkan ke kas negara, selanjutnya Kepala KPPN
memotongUPsebesar50%dengancaramenyampaikansuratpemberitahuan
kepada KPA untuk memperhitungkan potongan UP dalam SPM dan/atau
menyetorkankekasnegara.
KPA mengajukan UP kepada KPPN sebesar kebutuhan operasional satker
dalam satu bulan yang direncanakan dibayarkan melalui UP. Pemberian UP
diberikanpalingbanyak:
a)

Rp50.000.000,00untukpagujenisbelanjayangbisadibayarkanmelalui
UPsampaidenganRp900.000.000,00;

b)

Rp100.000.000,00untukpagujenisbelanjayangbisadibayarkanmelalui
UPdiatasRp900.000.000,00sampaidenganRp2.400.000.000,00;

c)

Rp200.000.000,00untukpagujenisbelanjayangbisadibayarkanmelalui
UPdiatasRp2.400.000.000,00sampaidenganRp6.000.000.000,00atau

d)

Rp500.000.000,00untukpagujenisbelanjayangbisadibayarkanmelalui
UPdiatasRp6.000.000.000,00.

132

2014 |Pusdiklatwas BPKP


Kepala Kantor Wilayah Direktorat Jenderal Perbendaharaan atas permintaan
KPA, dapat memberikan persetujuan UP melampaui besaran sebagaimana
dimaksuddiatasdenganmempertimbangkan:
a)

frekuensi penggantian UP tahun yang lalu lebih dari ratarata satu kali
dalamsatubulanselamasatutahun;dan

b)

perhitungan kebutuhan penggunaan UP satu bulan melampaui besaran


UP.

5)

TambahanUangPersediaan(TUP)
KPA dapat mengajukan TUP kepada Kepala KPPN dalam hal sisa UP pada
bendaharapengeluarantidakcukuptersediauntukmembiayaikegiatanyang
sifatnyamendesak/tidakdapatditunda,denganketentuan:
a)

digunakan dan dipertanggungjawabkan paling lama satu bulan sejak


tanggalSP2Dditerbitkan;dan

b)

tidak digunakan untuk kegiatan yang harus dilaksanakan dengan


pembayaranLS.

KPA mengajukan permintaan TUP kepada Kepala KPPN selaku Kuasa BUN
disertaidengan:
a)

rincianrencanapenggunaanTUP;dan

b)

surat yang memuat syarat penggunaan TUP yaitu digunakan dan


dipertanggungjawabkan paling lama satu bulan sejak tanggal SP2D
diterbitkandantidakdigunakanuntukkegiatanyangharusdilaksanakan
denganpembayaranLS.

Sebelum memberikan persetujuan permintaan TUP, Kepala KPPN terlebih


dahulumelakukanpenilaianterhadap:
a)

pengeluaran pada rincian rencana penggunaan TUP bukan merupakan


pengeluaranyangharusdilakukandenganpembayaranLS;

Manajemen Pemerintahan Pusat

133


b)

pengeluaran pada rincian rencana penggunaan TUP masih/cukup


tersediadananyadalamDIPA;

c)

TUPsebelumnyasudahdipertanggungjawabkanseluruhnya;dan

d)

TUPsebelumnyayangtidakdigunakantelahdisetorkekasnegara.

Dalam hal TUP sebelumnya belum dipertanggungjawabkan seluruhnya


dan/atau belum disetor, KPPN dapat menyetujui permintaan TUP berikutnya
setelah mendapat persetujuan Kepala Kantor Wilayah Direktorat Jenderal
Perbendaharaan. Dalam hal diperlukan, KPA dapat mengajukan permintaan
TUPuntukkebutuhanmelebihiwaktusatubulan.KepalaKPPNdapatmemberi
persetujuan permintaan TUP melebihi satu bulan dengan pertimbangan
kegiatanyangakandilaksanakanmemerlukanwaktumelebihisatubulan.
Kepala KPPN dapat memberikan persetujuan sebagian atau seluruh
permintaan TUP melalui surat persetujuan pemberian TUP. Kepala KPPN
menolak permintaan TUP dalam hal pengajuan permintaan TUP tidak
memenuhi ketentuan. Persetujuan atau penolakan tersebut disampaikan
palinglambatsatuharikerjasetelahsuratpengajuanpermintaanTUPditerima
KPPN.
TUP harus dipertanggungjawabkan dalam waktu satu bulan (sesuai jangka
waktuyangdisetujui)dandapatdilakukansecarabertahap.Dalamhalselama
satu bulan (sesuai jangka waktu yang disetujui) sejak SP2D TUP diterbitkan
belum dilakukan pengesahan dan pertanggungjawaban TUP, Kepala KPPN
menyampaikan surat teguran kepada KPA. Sisa TUP yang tidak habis
digunakan harus disetor ke kas negara paling lambat dua hari kerja setelah
bataswaktupertanggungjawabanTUP.
Untuk perpanjangan pertanggungjawaban TUP melampaui satu bulan, KPA
mengajukan permohonan persetujuan kepada Kepala KPPN. Kepala KPPN
memberikan persetujuan perpanjangan pertanggungjawaban TUP dengan
pertimbangan:

134

2014 |Pusdiklatwas BPKP


a)

KPAharusmempertanggungjawabkanTUPyangtelahdipergunakan;dan

b)

KPA menyampaikan pernyataan kesanggupan untuk mempertanggung


jawabkansisaTUPtidaklebihdarisatubulanberikutnya.

6)

MekanismePenerbitanSPPUP/GUP/GUPNIHIL
Berdasarkan rencana kegiatan yang telah disusun, Bendahara Pengeluaran
menyampaikan kebutuhan UP kepada PPK. Atas dasar kebutuhan UP
sebagaimana dimaksud, PPK menerbitkan SPPUP untuk pengisian UP yang
dilengkapi dengan perhitungan besaran UP sesuai pengajuan dari bendahara
pengeluaran. SPPUP diterbitkan oleh PPK dan disampaikan kepada PPSPM
paling lambat dua hari kerja setelah diterimanya permintaan UP dari
bendaharapengeluaran.
Bendahara pengeluaran/BPP melakukan pembayaran atas UP berdasarkan
surat perintah bayar (SPBy) yang disetujui dan ditandatangani oleh PPK atas
namaKPA.SPBysebagaimanadimaksuddilampiridenganbuktipengeluaran:
a)

kuitansi/bukti pembelian yang telah disahkan PPK beserta faktur pajak


danSSP;dan

b)

nota/bukti penerimaan barang/jasa atau dokumen pendukung lainnya


yangdiperlukanyangtelahdisahkanPPK.

Dalam hal penyedia barang/jasa tidak mempunyai kuitansi/bukti pembelian,


bendahara pengeluaran/BPP membuat kuitansi. Berdasarkan SPBy yang
disetujui dan ditandatangani oleh PPK, bendahara pengeluaran/BPP
melakukanpengujianatasSPByyangmeliputi:
a)

menelitikelengkapanperintahpembayaranyangditerbitkanolehPPK;

b)

pemeriksaankebenaranatashaktagih,meliputi:
(1)

pihakyangditunjukuntukmenerimapembayaran,

(2)

nilaitagihanyangharusdibayar,

(3)

jadwalwaktupembayaran,dan

(4)

mengujiketersediaandanayangbersangkutan;

Manajemen Pemerintahan Pusat

135


c)

pemeriksaan kesesuaian pencapaian keluaran antara spesifikasi teknis


yang disebutkan dalam penerimaan barang/jasa dan spesifikasi teknis
yangdisebutkandalamdokumenperjanjian/kontrak;dan

d)

pemeriksaandanpengujianketepatanpenggunaankodemataanggaran
pengeluaran(akun6digit).

e)

pemungutan/pemotongan pajak/bukan pajak atas tagihan dalam SPBy


yangdiajukandanmenyetorkankekasNegara.

Dalam hal pembayaran yang dilakukan bendahara pengeluaran merupakan


uangmukakerja,SPBydimaksuddilampiri:
a)

rencanapelaksanaankegiatan/pembayaran;

b)

rinciankebutuhandana;

c)

batas waktu pertanggungjawaban penggunaan uang muka kerja dari


penerimauangmukakerja.

Atasdasarrencanapelaksanaankegiatan/pembayarandanrinciankebutuhan
dana dimaksud, bendahara pengeluaran/BPP melakukan pengujian
ketersediaan

dananya.

Penerima

uang

muka

kerja

harus

mempertanggungjawabkan uang muka kerja sesuai batas waktu


pertanggungjawabanpenggunaanuangmukakerjadenganbuktipengeluaran.
Bendaharapengeluaran/BPPmelakukanpembayaranatastagihandalamSPBy
apabilatelahmemenuhipersyaratan.Dalamhaltidakmemenuhipersyaratan
untuk dibayarkan, bendahara pengeluaran/BPP harus menolak SPBy yang
diajukan.
Jika sampai batas waktu pertanggungjawaban penggunaan uang muka kerja,
penerima uang muka kerja belum menyampaikan bukti pengeluaran maka
bendahara pengeluaran/BPP menyampaikan permintaan tertulis agar
penerima uang muka kerja segera mempertanggungjawabkan uang muka
kerja. Tembusan permintaan tertulis tersebut disampaikan kepada PPK. BPP
menyampaikan SPBy beserta bukti pengeluaran kepada bendahara

136

2014 |Pusdiklatwas BPKP


pengeluaran. Bendahara pengeluaran selanjutnya menyampaikan bukti
pengeluarankepadaPPKuntukpembuatanSPPGUP/GUPNihil.
PPK menerbitkan SPPGUP untuk pengisian kembali UP. Penerbitan SPPGUP
dilengkapidengandokumenpendukungsebagaiberikut.
a)

DaftarRincianPermintaanPembayaran;

b)

buktipengeluaran;dan

c)

SSPyangtelahdikonfirmasiKPPN.

DalampengajuanSPPGUP,untukperjanjian/kontrakbesertafakturpajaknya
dilampirkanuntuknilaitransaksiyangharusmenggunakanperjanjian/kontrak
sebagaimana diatur dalam peraturan perundangundangan mengenai
pengadaan barang/jasa pemerintah. SPPGUP disampaikan kepada PPSPM
paling lambat lima hari kerja setelah buktibukti pendukung diterima secara
lengkapdanbenar.
Sisa dana dalam DIPA yang dapat dilakukan pembayaran dengan UP minimal
sama dengan nilai UP yang dikelola oleh bendahara pengeluaran. Dalam hal
pengisian kembali UP akan mengakibatkan sisa dana dalam DIPA yang dapat
dilakukanpembayarandenganUPlebihkecildariUPyangdikelolabendahara
pengeluaran:
a)

pengisian kembali UP dilaksanakan maksimal sebesar sisa dana dalam


DIPAyangdapatdibayarkandenganUP;dan

b)

selisih antara sisa dana dalam DIPA yang dapat dilakukan pembayaran
dengan UP dan UP yang dikelola Bendahara Pengeluaran dibukukan/
diperhitungkansebagaipotonganPenerimaanPengembalianUP.

Penerbitan SPPGUP nihil merupakan pengesahan/pertanggungjawaban UP


dandilakukandalamhal:
a)

sisa dana pada DIPA yang dapat dibayarkan dengan UP minimal sama
denganbesaranUPyangdiberikan;

b)

sebagaipertanggungjawabanUPyangdilakukanpadaakhirtahun;atau

c)

UPtidakdiperlukanlagi.

Manajemen Pemerintahan Pusat

137


SPPGUP nihil dilengkapi dengan dokumen pendukung sebagaimana
pengajuanSPPGUP.
7)

MekanismePenerbitanSPPTUP/PTUP
PPKmenerbitkanSPPTUPdandilengkapidengandokumenmeliputi:
a)

rincian penggunaan dana yang ditandatangani oleh KPA/PPK dan


bendaharapengeluaran;

b)

suratpernyataandariKPA/PPK;dan

c)

surat permohonan TUP yang telah memperoleh persetujuan TUP dari


KepalaKPPN.

SPPTUP diterbitkan oleh PPK dan disampaikan kepada PPSPM paling lambat
dua hari kerja setelah diterimanya persetujuan TUP dari Kepala KPPN. Untuk
mengesahkan/ mempertanggungjawabkan TUP, PPK menerbitkan SPPPTUP.
SPPPTUP disampaikan kepada PPSPM paling lambat lima hari kerja sebelum
batasakhirpertanggungjawabanTUP.
Penerbitan SPPPTUP dilengkapi dokumen pendukung sebagaimana
penerbitanSPPGUP/GUPNihil.
d.

MekanismePengujianSPPdanPenerbitanSPM
1)

PengujianSPP
PejabatPenandatanganSPM(PPSPM)melakukanpemeriksaandanpengujian
SPP beserta dokumen pendukung yang disampaikan oleh PPK. Pemeriksaan
danpengujianSPPbesertadokumenpendukungSPPmeliputi:
a)

kelengkapandokumenpendukungSPP;

b)

kesesuaian penanda tangan SPP dengan spesimen tanda tangan PPK;


kebenaranpengisianformatSPP;

138

2014 |Pusdiklatwas BPKP


c)

kesesuaian kode BAS pada SPP dengan DIPA/POK/Rencana Kerja


Anggaransatkertermasukmengujikesesuaianantarapembebanankode
mataanggaranpengeluaran(akun6digit)denganuraiannya;

d)

ketersediaanpagusesuaiBASpadaSPPdenganDIPA/POK/RencanaKerja
Anggaransatker;

e)

kebenaranformaldokumen/suratkeputusanyangmenjadipersyaratan/
kelengkapanpembayaranbelanjapegawai;

f)

kebenaran formal dokumen/surat bukti yang menjadi persyaratan/


kelengkapansehubungandenganpengadaanbarang/jasa;

g)

kebenaran pihak yang berhak menerima pembayaran pada SPP


sehubungandenganperjanjian/kontrak/suratkeputusan;

h)

kebenaran perhitungan tagihan serta kewajiban di bidang perpajakan


daripihakyangmempunyaihaktagih;

i)

kepastian telah terpenuhinya kewajiban pembayaran kepada negara


olehpihakyangmempunyaihaktagihkepadanegara;dan

j)

kesesuaian prestasi pekerjaan dengan ketentuan pembayaran dalam


perjanjian/kontrak.

k)

keabsahan dokumen pendukung yang dipersyaratkan sesuai jenis SPP


yaitu:
(1)

buktiperjanjian/kontrak;

(2)

referensi bank yang menunjukkan nama dan nomor rekening


penyediabarang/jasa;

(3)

BeritaAcaraPenyelesaianPekerjaan;

(4)

BeritaAcaraSerahTerimaPekerjaan/Barang;

(5)

buktipenyelesaianpekerjaanlainnyasesuaiketentuan;

(6)

BeritaAcaraPembayaran;

Manajemen Pemerintahan Pusat

139


(7)

kuitansiyangtelahditandatanganiolehpenyediabarang/jasadan
PPK,

(8)

faktur pajak beserta surat setoran pajak (SSP) yang telah


ditandatanganiolehwajibpajak/bendaharapengeluaran;

(9)

jaminan yang dikeluarkan oleh bank atau lembaga keuangan


lainnya

sebagaimana

dipersyaratkan

dalam

peraturan

perundangundangantentangpengadaanbarang/jasapemerintah;
(10) dokumen

lain

yang

dipersyaratkan

khususnya

untuk

perjanjian/kontrak yang dananya sebagian atau seluruhnya


bersumber dari pinjaman atau hibah dalam/luar negeri
sebagaimana dipersyaratkan dalam naskah perjanjian pinjaman
atauhibahdalam/luarnegeribersangkutan.
(11) suratkeputusan;
(12) surattugas/suratperjalanandinas;
(13) daftarpenerimapembayaran;dan/atau
(14) dokumenpendukunglainnyasesuaiketentuan.
2)

PenerbitandanPenandatangananSPM
Dalam hal pemeriksaan dan pengujian SPP beserta dokumen pendukungnya
telah memenuhi ketentuan, PPSPM menerbitkan/menandatangani SPM.
Penerbitan SPM dilakukan melalui sistem aplikasi yang disediakan oleh
DirektoratJenderalPerbendaharaan.
SPM yang diterbitkan memuat Personal Identification Number (PIN), PPSPM
sebagaipenandatanganelektronikpadaADKSPMdaripenerbitSPMyangsah.
DalampenerbitanSPMmelaluisistem,PPSPMbertanggungjawabatas:
a)

keamanandatapadaaplikasiSPM;

b)

kebenaranSPMdankesesuaianantaradatapadaSPMdenganADKSPM;
dan

c)
140

penggunaanPersonalIdentificationNumber(PIN)padaADKSPM.

2014 |Pusdiklatwas BPKP


Jangka waktu pengujian SPP sampai dengan penerbitan SPMUP/TUP/
GUP/PTUP/LSolehPPSPMdiatursebagaiberikut:
a)

SPPUP/TUPdiselesaikanpalinglambatduaharikerja;

b)

SPPGUPdiselesaikanpalinglambatempatharikerja;

c)

SPPPTUPdiselesaikanpalinglambattigaharikerja;dan

d)

SPPLSdiselesaikanpalinglambatlimaharikerja.

DalamhalPPSPMmenolak/mengembalikanSPPkarenadokumenpendukung
tagihan tidak lengkap dan benar, maka PPSPM harus menyatakan secara
tertulisalasanpenolakan/pengembaliantersebutpalinglambatduaharikerja
setelahditerimanyaSPP.
Seluruh bukti pengeluaran sebagai dasar pengujian dan penerbitan SPM
disimpan oleh PPSPM. Bukti pengeluaran tersebut menjadi bahan
pemeriksaanbagiaparatpemeriksainternaldaneksternal.
3)

PenyampaianSPMkeKPPN
PPSPM menyampaikan SPMUP/TUP/GUP/GUP Nihil/PTUP/LS dalam rangkap
duabesertaADKSPMkepadaKPPN.Penyampaiandiatursebagaiberikut.
a)

SPMUPdilampirisuratpernyataandariKPA;

b)

SPMTUPdilampirisuratpersetujuanpemberianTUPdariKepalaKPPN;
atau

c)

SPMLSdilampirisuratsetoranpajak(SSP)dan/ataubuktisetorlainnya,
dan/ataudaftarnominatifuntukyanglebihdarisatupenerima.

d)

Untuk penyampaian SPM atas beban pinjaman/hibah luar negeri,


disampingdilampiridokumensebagaimanatersebutdiatas,jugadisertai
denganfakturpajak.

e)

SPMGUP/GUPNihildanSPMPTUPtidakmemerlukanlampiran.

Manajemen Pemerintahan Pusat

141


PenyampaianSPMkeKPPNdiatursebagaiberikut.
a)

PPSPM menyampaikan SPM kepada KPPN paling lambat dua hari kerja
setelahSPMditerbitkan.

b)

KhususuntukSPMLSpembayarangajiindukdisampaikankepadaKPPN
palinglambattanggal15sebelumbulanpembayaran.Dalamhaltanggal
15 merupakan hari libur atau hari yang dinyatakan libur, penyampaian
SPMLS untuk pembayaran gaji induk kepada KPPN dilakukan paling
lambat satu hari kerja sebelum tanggal 15, dikecualikan untuk satker
yang

kondisi

geografis

dan

transportasinya

sulit,

dengan

memperhitungkanwaktuyangdapatdipertanggungjawabkan.
PenyampaianSPMkepadaKPPNdilakukanolehpetugaspengantarSPMyang
sahdanditetapkanolehKPAdenganketentuansebagaiberikut.
a)

Petugas pengantar SPM menyampaikan SPM beserta dokumen


pendukung dan ADK SPM melalui front office penerimaan SPM pada
KPPN;

b)

petugas pengantar SPM harus menunjukkan kartu identitas petugas


satker(KIPS)padasaatmenyampaikanSPMkepadapetugasfrontoffice;
dan

c)

dalam hal SPM tidak dapat disampaikan secara langsung ke KPPN,


penyampaian SPM beserta dokumen pendukung dan ADK SPM dapat
melalui kantor pos/jasa pengiriman resmi dan terlebih dahulu KPA
menyampaikankonfirmasi/pemberitahuankepadaKepalaKPPN.

e.

MekanismePenerbitanSP2D
Pengujian SPM oleh KPPN SPM yang diajukan ke KPPN digunakan sebagai dasar
penerbitan SP2D. Dalam pencairan anggaran belanja negara, KPPN melakukan
penelitiandanpengujianatasSPMyangdisampaikanolehPPSPM.

142

2014 |Pusdiklatwas BPKP


1)

PenelitianSPM
KPPNmelakukanpenelitianSPMmeliputi:
a)

menelitikelengkapandokumenpendukungSPMdan,

b)

menelitikebenaranSPM.

DalammenelitikebenaranSPMdilakukanmeliputi:
a)

meneliti kesesuaian tanda tangan PPSPM pada SPM dengan spesimen


tandatanganPPSPMpadaKPPN;

b)

memeriksacarapenulisan/pengisianjumlahangkadanhurufpadaSPM;
dan

c)

memeriksakebenaranpenulisandalamSPM,tidakbolehterdapatcacat
dalampenulisan.

2)

PengujianSPM
KPPNmelakukanpengujianSPMmeliputi:
a)

mengujikebenaranperhitunganangkaatasbebanAPBNyangtercantum
dalam SPM berupa pengujian kebenaran jumlah belanja/pengeluaran
dikurangi dengan jumlah potongan/penerimaan dengan jumlah bersih
dalamSPM;

b)

menguji ketersediaan dana pada kegiatan/output/jenis belanja dalam


DIPAdenganyangdicantumkanpadaSPM;

c)

menguji kesesuaian tagihan dengan data perjanjian/kontrak atau


perubahandatapegawaiyangtelahdisampaikankepadaKPPN;

d)

mengujipersyaratanpencairandanayangmeliputi:
(1)

mengujiSPMUPberupabesaranUPyangdapatdiberikan

(2)

mengujiSPMTUPmeliputikesesuaianjumlahuangyangdiajukan
padaSPMTUPdenganjumlahuangyangdisetujuiKepalaKPPN;

Manajemen Pemerintahan Pusat

143


(3)

menguji SPM PTUP meliputi jumlah TUP yang diberikan dengan


jumlah uang yang dipertanggungjawabkan dan kepatuhan jangka
waktupertanggungjawaban;

(4)

menguji SPM GUP meliputi batas minimal revolving dari UP yang


dikelola

dan

ketentuan

terkait

penggunaan

dan

pertanggungjawabanUP;
(5)

menguji SPM LS Non Belanja Pegawai berupa kesesuaian data


perjanjian/kontrak pada SPM LS dengan data perjanjian/kontrak
yangtercantumdalamKartuPengawasanKontrakKPPN;dan

(6)

menguji SPM LS Belanja Pegawai sesuai dengan prosedur standar


operasional

yang

ditetapkan

oleh

Direktur

Jenderal

Perbendaharaan.
e)

menguji kesesuaian nilai potongan pajak yang tercantum dalam SPM


dengannilaipadaSSP.

DalampengujianSPMUP,jikaterdapatUPtahunanggaransebelumnyabelum
dipertanggungjawabkan,jugadilakukanpengujianyangmeliputi:
a)

kesesuaian jumlah uang dan keabsahan bukti setor pengembalian sisa


UPtahunanggaranyangsebelumnya;atau

b)

kesesuaian jumlah potongan UP pada SPM UP dengan sisa UP tahun


anggaranyangsebelumnya;

Dalam

pengujian

SPMPTUP,

jika

jumlah

uang

yang

harus

dipertanggungjawabkandarijumlahTUPyangdiberikan,harusdisertaidengan
bukti setor pengembalian TUP yang telah dilakukan konfirmasi KPPN.
Ketentuan ini tidak diperlukan dalam hal penyampaian SPMPTUP yang
dilakukansecarabertahapsebelumbatasakhirpertanggungjawaban.

144

2014 |Pusdiklatwas BPKP


3)

PenerbitanSP2D
KPPNmenerbitkanSP2Djikapenelitiandanpengujiantelahmemenuhisyarat.
Dalamhalhasilpenelitiandanpengujiantidakmemenuhisyarat,KepalaKPPN
mengembalikanSPMbesertadokumenpendukungsecaratertulis.KPPNtidak
dapatmenerbitkanSP2Dapabilasatkerbelummengirimkan:
a)

dataperjanjian/kontrakbesertaADKuntukpembayaranmelaluiSPMLS
kepadapihakketiga;atau

b)

daftar perubahan data pegawai beserta ADK yang disampaikan kepada


KPPNuntukpembayaranbelanjapegawai.

Penyelesaian SP2D dilakukan oleh KPPN sesuai prosedur standar operasional


(SOP) dan norma waktu yang ditetapkan oleh Direktur Jenderal
Perbendaharaan.PencairandanaberdasarkanSP2Ddilakukanmelaluitransfer
danadarikasnegarapadabankoperasionalkepadarekeningpihakpenerima
yangditunjukpadaSP2D.
Bank operasional menyampaikan pemberitahuan kepada Kepala KPPN dalam
hal terjadinya kegagalan transfer (retur) dana. Pemberitahuan kegagalan
transfer dana memuat data SP2D dan alasan kegagalan transfer ke rekening
yang ditunjuk. Atas dasar pemberitahuan tersebut, Kepala KPPN
memberitahukan KPA atas terjadinya kegagalan transfer dana ke rekening
yang ditunjuk pada SPM dan alasannya. KPA melakukan penelitian atas
kegagalan transfer dana yang tercantum pada SPM dan selanjutnya
menyampaikanperbaikanatauralatSPM.
Atas dasar perbaikan atau ralat SPM dimaksud, Kepala KPPN menyampaikan
ralat SP2D kepada bank operasional. Tata cara penyelesaian pencairan dana
denganmekanismereturSP2DdiaturolehDirekturJenderalPerbendaharaan.

Manajemen Pemerintahan Pusat

145


f.

PembayaranPengembalianPenerimaan
Setiapketerlanjuransetorankekasnegaradan/ataukelebihanpenerimaannegara
dapat dimintakan pengembaliannya. Permintaan pengembalian dapat dilakukan
berdasarkan suratsurat bukti setoran yang sah. Pembayaran pengembalian
keterlanjuransetorandan/ataukelebihanpenerimaannegaraharusdiperhitungkan
terlebihdahuludenganutangpadanegara.Pembayaranpengembaliandilaksanakan
berdasarkanmekanismeyangdiaturdalamPeraturanMenteriKeuangantersendiri.

g.

PembayaranTagihanyangBersumberdariPenggunaanPNBP
Pembayaran tagihan atas beban belanja negara yang bersumber dari penggunaan
PNBP,dilakukansebagaiberikut.
1)

Satker pengguna PNBP menggunakan PNBP sesuai dengan jenis PNBP dan
batas tertinggi PNBP yang dapat digunakan sesuai yang ditetapkan oleh
MenteriKeuangan.

2)

BatastertinggiPNBPyangdapatdigunakansebagaimanadimaksudpadahuruf
a merupakan maksimum pencairan dana yang dapat dilakukan oleh Satker
berkenaan.

3)

SatkerdapatmenggunakanPNBPsebagaimanadimaksudpadahurufasetelah
PNBPdisetorkekasnegaraberdasarkankonfirmasidariKPPN.

4)

DalamhalPNBPyangditetapkanpenggunaannyasecaraterpusat,pembayaran
dilakukanberdasarkanPaguPencairansesuaiSuratEdaran/PeraturanDirektur
JenderalPerbendaharaan.

5)

Besarnya pencairan dana PNBP secara keseluruhan tidak boleh melampaui


paguPNBPsatkeryangbersangkutandalamDIPA.

6)

Dalam hal realisasi PNBP melampaui target dalam DIPA, penambahan pagu
dalamDIPAdilaksanakansetelahmendapatpersetujuanMenteriKeuanganc.q
DirekturJenderalAnggaran.

Satker pengguna PNBP dapat diberikan UP sebesar 20% dari realisasi PNBP yang
dapat digunakan sesuai pagu PNBP dalam DIPA maksimum sebesar
146

2014 |Pusdiklatwas BPKP


Rp500.000.000,00.RealisasiPNBPtersebuttermasuksisamaksimumpencairan(MP)
danaPNBPtahunanggaransebelumnya.
DalamhalUPtidakmencukupidapatmengajukanTUPsebesarkebutuhanriilselama
satu bulan dengan memerhatikan batas maksimum pencairan (MP). Pembayaran
UP/TUP untuk satker pengguna PNBP dilakukan terpisah dari UP/TUP yang berasal
darirupiahmurni.
Satker pengguna PNBP yang belum memperoleh maksimum pencairan (MP) dana
PNBP dapat diberikan UP sebesar maksimal 1/12 dari pagu dana PNBP pada DIPA,
maksimalsebesarRp200.000.000,00.Ketentuaninidapatdilakukanuntukpengguna
PNBPdenganketentuan:
1)

yangtelahmemperolehmaksimumpencairan(MP)danaPNBPnamunbelum
mencapai1/12daripagudanaPNBPpadaDIPA;atau

2)

yangbelummemperolehpagupencairan.

Penyesuaian besaran UP dapat dilakukan terhadap satker pengguna PNBP yang


telah memperoleh maksimum pencairan (MP) dana PNBP melebihi UP yang telah
diberikan. Penggantian UP atas PNBP dilakukan setelah satker pengguna PNBP
memperolehmaksimumpencairan(MP)danaPNBPpalingsedikitsebesarUPyang
diberikan.
Dana yang berasal dari PNBP dapat dicairkan maksimal sesuai formula sebagai
berikut.
MP = (PPPxJS)JPS

MP : maksimumpencairan
PPP : proporsipagupengeluaranterhadappendapatansesuaidenganyang
ditetapkanolehMenteriKeuangan.
JS

: Jumlahsetoran

JPS : jumlah pencairan dana sebelumnya sampai dengan SPM terakhir


yangditerbitkan

Manajemen Pemerintahan Pusat

147


Sisamaksimumpencairan(MP)danaPNBPtahunanggaransebelumnyadarisatker
pengguna,dapatdipergunakanuntukmembiayaikegiatankegiatantahunanggaran
berjalansetelahDIPAdisahkandanberlakuefektif.
TatacarapenerbitandanpengujianSPPdanSPMUP/TUP/PTUP/GUP/GUPNihil/LS
dari dana yang bersumber dari PNBP mengacu pada mekanisme dalam Peraturan
MenteriKeuanganNomor190Tahun2012.
PPSPM menyampaikan SPMUP/TUP/PTUP/GUP/GUP Nihil/LS beserta ADK SPM
kepadaKPPNdengandilampiridokumensebagaimanadanarupiahmurnidan:
1)

buktisetorPNBPyangtelahdikonfirmasiolehKPPN;

2)

DaftarPerhitunganJumlahMaksimumPencairan(MP)dibuatsesuaiformat.
KPPN melakukan penelitian terhadap kebenaran perhitungan dalam Daftar
PerhitunganJumlahMaksimumPencairan(MP).

Untuk satker pengguna PNBP secara terpusat, penyampaian SPM mengacu


ketentuansesuaiketentuanSPMatasdanarupiahmurni.
h.

Pembayaran Tagihan untuk Kegiatan yang Bersumber dari Pinjaman dan/atau


HibahLuarNegeri
Penerbitan SPP, SPM, dan SP2D untuk kegiatan yang sebagian/seluruhnya
bersumber dari pinjaman dan/atau hibah luar negeri, mengikuti ketentuan
mengenai kategori, porsi pembiayaan, tanggal closing date dan persetujuan
pembayaran dari pemberi pinjaman dan/atau hibah luar negeri sesuai dengan
petunjuk pelaksanaan pencairan dana pinjaman dan/atau hibah luar negeri
berkenaan.
Penerbitan SPPLS, SPMLS, dan SP2DLS atas tagihan berdasarkan perjanjian/
kontrak dalam valuta asing (valas) dan/atau pembayaran ke luar negeri mengikuti
ketentuansebagaiberikut.
1)

Perjanjian/kontrakdalamvalastidakdapatdikonversikedalamrupiah.

2)

PengajuanSPMdisampaikankepadaKPPNKhususJakartaVI.

3)

PenerbitanSPPUP/TUP,SPMUP/TUP,danSP2DUP/TUPmenjadibebandana
rupiahmurni.

148

2014 |Pusdiklatwas BPKP


Pertanggungjawaban dan penggantian dana rupiah murni atas SP2DUP/TU,
dilakukandenganpenerbitanSPPGUP/GUPNihil/PTUP,SPMGUP/GUPNihil/PTUP,
dan SP2DGUP/GUP Nihil/PTUP yang menjadi beban pinjaman dan/atau hibah luar
negeriberkenaan.
Dalam hal terjadi penguatan nilai tukar (kurs) rupiah terhadap valas yang
menyebabkan alokasi dana rupiah pada DIPA melampaui sisa pinjaman dan/atau
hibah luar negeri, sebelum dilakukan penerbitan SPP, satker harus melakukan
perhitungan dan/atau konfirmasi kepada executing agency agar tidak terjadi
pembayaranyangmelampauisisapinjamandan/atauhibahluarnegeriberkenaan.
Pengeluaran atas SP2D dengan sumber dana dari pinjaman dan/atau hibah luar
negeri yang tidak sesuai dengan ketentuan sebagaimana diatur dalam dokumen
perjanjianpinjamandan/atauhibahluarnegeri,ataupengeluaransetelahpinjaman
dan/atau hibah luar negeri dinyatakan closing date dikategorikan sebagai
pengeluaran ineligible. Atas pengeluaran yang dikategorikan ineligible tersebut,
Direktur Jenderal Perbendaharaan menyampaikan surat pemberitahuan kepada
pimpinankementeriannegara/lembagadengantembusankepadaDirekturJenderal
Anggaran.
Penggantianataspengeluaranyangdikategorikanineligiblemenjaditanggungjawab
kementerian negara/lembaga yang bersangkutan dan harus diperhitungkan dalam
revisi DIPA tahun anggaran berjalan atau dibebankan dalam DIPA tahun anggaran
berikutnya.
i.

Koreksi/Ralat,PembatalanSPP,SPMdanSP2D
Koreksi/ralat SPP, SPM, dan SP2D hanya dapat dilakukan sepanjang tidak
mengakibatkanberikut.
1)

perubahanjumlahuangpadaSPP,SPMdanSP2D;

2)

sisapaguanggaranpadaDIPA/POKmenjadiminus;atau

3)

perubahankodebagiananggaran,eselonI,dansatker.

Dalam hal diperlukan perubahan kode bagian anggaran, eselon I, dan satker
sebagaimanadimaksudpadahurufcdiatas,halitudapatdilakukandenganterlebih

Manajemen Pemerintahan Pusat

149


dahulumendapatpersetujuandariDirekturJenderalPerbendaharaan.Koreksi/ralat
SPP,SPM,danSP2Ddapatdilakukanuntuk:
1)

memperbaiki uraian pengeluaran dan kode BAS selain perubahan kode


sebagaimanadimaksudpadaayat(1)hurufc;

2)

pencantumankodepadaSPMyangmeliputikodejenisSPM,carabayar,tahun
anggaran,jenispembayaran,sifatpembayaran,sumberdana,carapenarikan,
nomorregister;atau

3)

koreksi/ralatpenulisannomordannamarekening,namabankyangtercantum
pada SPP, SPM dan SP2D beserta dokumen pendukungnya yang disebabkan
terjadinyakegagalantransferdana(retur).

Koreksi/ralat SPM dan ADK SPM hanya dapat dilakukan berdasarkan permintaan
koreksi/ralat SPM dan ADK SPM secara tertulis dari PPK. Koreksi/ralat kode mata
anggaran pengeluaran (akun 6 digit) pada ADK SPM dapat dilakukan berdasarkan
permintaan koreksi/ralat ADK SPM secara tertulis dari PPK sepanjang tidak
mengubahSPM.Koreksi/ralatSP2Dhanyadapatdilakukanberdasarkanpermintaan
koreksi SP2D secara tertulis dari PPSPM dengan disertai SPM dan ADK yang telah
diperbaiki.
PembatalanSPPhanyadapatdilakukanolehPPKsepanjangSP2Dbelumditerbitkan.
PembatalanSPMhanyadapatdilakukanolehPPSPMsecaratertulissepanjangSP2D
belum diterbitkan. Dalam hal SP2D telah diterbitkan dan belum mendebet kas
negara, pembatalan SPM dapat dilakukan setelah mendapat persetujuan Direktur
JenderalPerbendaharaanataupejabatyangditunjuk.
KoreksiSP2Dataudaftarnominatifuntukpenerimalebihdarisaturekeninghanya
dapatdilakukanolehKepalaKPPNberdasarkanpermintaanKPA.PembatalanSP2D
tidakdapatdilakukandalamhalSP2Dtelahmendebetrekeningkasnegara.
j.

PelaksanaanPembayaranpadaAkhirTahunAnggaran
Dalam kondisi akhir tahun anggaran, batas terakhir pembayaran atas beban APBN
dapat dilakukan sebelum tanggal terakhir pada akhir tahun. Penetapan batas

150

2014 |Pusdiklatwas BPKP


terakhir pembayaran dilakukan dengan mempertimbangkan kebutuhan BUN untuk
menyelesaikanadministrasipengelolaankasnegara.
Dalam pertanggungjawaban UP/TUP pada akhir tahun anggaran, pengajuan SPM
danSP2DGUPNihil/PTUPdapatdilakukanmelampauitahunanggaran.Batasakhir
penerbitanSPMGUPNihil/PTUPditetapkandenganmempertimbangkankelancaran
penyusunanlaporankeuanganpemerintahpusat.
Pelaksanaan pembayaran pada akhir tahun anggaran lebih lanjut mempedomani
Peraturan Menteri Keuangan yang mengatur mengenai langkahlangkah dalam
menghadapiakhirtahunanggaran.
k.

PelaporanRealisasiAnggaran
DalampenyusunanlaporanpertanggungjawabanpelaksanaanAPBNdiperlukandata
realisasi APBN, arus kas, neraca, dan catatan atas laporan keuangan. Untuk
keperluantersebutmaka:
1)

Kepala kantor/satker selaku Unit Akuntansi Kuasa Pengguna Anggaran


(UAKPA) setiap bulan harus melakukan rekonsiliasi data realisasi anggaran
dengan Kepala KPPN selaku Kuasa BUN. Rekonsiliasi data realisasi anggaran
sebagaimanadimaksudpadahurufameliputi:databagiananggaran;eselonI;
satker;sumberdana;carapenarikan;program;kegiatan;output;akun6digit;
tanggaldannomorSPM/SP2D;danjumlahrupiah.

2)

Hasil rekonsiliasi sebagaimana dimaksud huruf a dituangkan dalam Berita


AcaraRekonsiliasi(BAR)danselanjutnyasetiapawalbulan:
a)

kepala kantor/satker menyampaikan Laporan Realisasi Anggaran (LRA)


dan Neraca beserta ADK kepada Unit Akuntansi Pembantu Pengguna
Anggarantingkatwilayah(UAPPAW);atau

b)

kepala KPPN selaku Kuasa BUN membuat Laporan Realisasi Anggaran,


ArusKas,danNeracakepadaKepalaKantorWilayahDirektoratJenderal
Perbendaharaan untuk diproses dan selanjutnya diteruskan kepada
DirekturJenderalPerbendaharaanu.p.DirekturAkuntansidanPelaporan
Keuangan.

Manajemen Pemerintahan Pusat

151


3)

Untuklaporankeuangansemesterdantahunan,LRA,NeracadanADKdisertai
denganCatatanatasLaporanKeuangan(CaLK).

3.

PokokPokokPengadaanBarang/JasaPemerintah
a.

PrinsipDasar,KebijakanUmum,Etika,danRuangLingkupPengadaanBarang/Jasa
Pemerintah membutuhkan barang/jasa untuk meningkatkan pelayanan publik atas
dasar pemikiran logis dan sistematis, mengikuti prinsip dan etika yang berlaku,
berdasarkan metode dan proses pengadaan yang baku. Pelaksanaan pengadaan
barang/jasapemerintahyangsebagianatauseluruhnyadibiayaiAPBN/APBDdiatur
dalam Peraturan Presiden Nomor 54 Tahun 2010 tentang Pedoman Pelaksanaan
Pengadaan Barang/Jasa Pemerintah, yang terakhir diubah dengan Peraturan
PresidenNomor70Tahun2012.
1)

PrinsipPrinsipDasar
Pengadaan barang/jasa harus dilaksanakan berdasarkan prinsipprinsip
pengadaan yang dipraktikkan secara internasional yaitu prinsip efisiensi,
efektivitas, persaingan sehat, keterbukaan, transparansi, tidak diskriminasi,
danakuntabel.
Gambar5.5PrinsipPengadaanBarang/Jasa

152

2014 |Pusdiklatwas BPKP


2)

KebijakanUmum
Kebijakan umum pengadaan barang/jasa pemerintah bertujuan untuk
menyinergikanketentuanpengadaanbarang/jasadengankebijakankebijakan
padasektorlainnya,denganlangkahlangkahsebagaiberikut.
a)

Peningkatan penggunaan produksi barang/jasa dalam negeri, teknologi


informasidantransaksielektronik,peransertausahamikro,usahakecil,
koperasikecildankelompokmasyarakat,profesionalisme,kemandirian,
dan tanggung jawab para pihak yang terlibat, dan penerimaan negara
melaluisektorperpajakan.

b)

Penumbuhkembangan peran usaha nasional, industri kreatif inovatif,


budayadanhasilpenelitianlaboratoriumatauinstitusipendidikandalam
negeri.

c)

Pemanfaatansumberdayaalamdanpelestarianfungsilingkunganhidup
secara arif, sarana/prasarana penelitian dan pengembangan dalam
negeri.

d)

Kemandirian industri pertahanan, industri alat utama sistem senjata


(alutsista)danindustrialatmaterialkhusus(almatsus)

e)

Penyederhanaan ketentuan dan tata cara untuk mempercepat proses


pengambilankeputusan.

f)

Pengadaanbarang/jasadidalamwilayahNKRI.

g)

Pengumuman secara terbuka rencana dan pelaksanaan pengadaan


barang/jasa.

3)

EtikaDalamPengadaanBarang/Jasa
PPK,penyediabarang/jasadanparapihakyangterlibatharusmemenuhietika:
a)

melaksanakantugassecaratertib,disertairasatanggungjawab;

b)

bekerja secara profesional dan mandiri atas dasar kejujuran, serta


menjagakerahasiaandokumenpengadaanbarang;

Manajemen Pemerintahan Pusat

153


c)

tidaksalingmemengaruhibaiksecaralangsungmaupuntidaklangsung;

d)

menerima dan bertanggung jawab atas segala keputusan yang


ditetapkansesuaidengankesepakatanparapihak;

e)

menghindari/mencegah

terjadinya

pertentangan

kepentingan,

pemborosan/ kebocoran keuangan negara, penyalahgunaan wewenang


dankolusi;
f)

tidak menerima, tidak menawarkan/tidak menjanjikan untuk memberi/


menerima hadiah, imbalan berupa apa saja kepada siapapun yang
diketahui/patutdidugaterkaitpengadaanbarangdanjasa.

4)

RuangLingkupdanPembiayaanPengadaan
Ruanglingkuppengadaanbarang/jasapemerintahmencakup:
a)

Pengadaan

barang/jasa

di

lingkungan

kementerian/lembaga/

pemerintah daerah/instansi (K/L/D/I), Bank Indonesia, Badan Hukum


Milik Negara dan Badan Usaha Milik Negara/Daerah yang sebagian/
seluruhnyadibiayaiAPBN/D.
b)

Pengadaanbarang/jasayangdananyabersumberdariAPBN/Dtermasuk
yang sebagian/seluruh dananya dibiayai dari pinjaman/hibah dalam
negeri.

Para pihak dapat menyepakati tata cara pengadaan, apabila terdapat


perbedaan antara Peraturan Presiden Nomor 54 Tahun 2010 dengan
ketentuanpemberipinjaman/hibahluarnegeri(PHLN).
Pembiayaan pengadaan yang disediakan K/L/D/I untuk pemilihan penyedia
dariAPBN/APBDmeliputi:
a)

honorarium personil organisasi pengadaan barang/jasa termasuk tim


teknis,timpendukungdanstafproyek;

b)

biaya

pengumuman

pengadaan

barang/jasa

termasuk

biaya

pengumumanulang;

154

2014 |Pusdiklatwas BPKP


c)

biayapenggandaandokumenpengadaanbarang/jasa;dan

d)

biayalainnyauntukmendukungpengadaanbarang/jasa.

SelainituK/L/D/Idapat:
a)

menyediakan biaya pemilihan penyedia barang/jasa pada tahun


anggaranberikutnya

b)

mengusulkan besaran standar biaya umum (SBU) terkait honorarium


kepadamenterikeuangan/kepaladaerah.

b.

PokokPokokKebijakanPengadaanBarangdanJasa
1)

ParaPihakdalamPengadaanBarangdanJasaPemerintah
a)

OrganisasiPengadaanBarang/JasaPemerintah
Organisasipengadaanbarang/jasamelaluipenyediaterdiriatas:
(1)

PenggunaAnggaran/KuasaPenggunaAnggaran.
Atas dasar pertimbangan besaran beban pekerjaan atau rentang
kendaliorganisasi,penggunaangaran(PA)padaK/L/Imenetapkan
seseorang atau beberapa orang kuasa pengguna anggaran (KPA).
Sedangkan PA pada pemerintah daerah mengusulkan satu atau
beberapaorangKPAkepadakepaladaerahuntukditetapkan.

(2)

PejabatPembuatKomitmen(PPK)
PPK merupakan pejabat yang ditetapkan oleh PA/KPA untuk
melaksanakan pengadaan barang/jasa. PPK dilarang mengadakan
ikatan perjanjian atau menandatangani kontrak dengan penyedia
barang/jasa apabila belum tersedia anggaran atau tidak cukup
tersedia anggaran yang dapat mengakibatkan dilampauinya batas
anggaran yang tersedia untuk kegiatan yang dibiayai dari
APBN/APBD.

Manajemen Pemerintahan Pusat

155


PPK dapat dibantu oleh tim pendukung yang diperlukan untuk
pelaksanaanpengadaanbarang/jasa.
(3)

UnitLayananPengadaan/PejabatPengadaan
Unit layanan pengadaan (ULP) wajib dibentuk untuk pengadaan
barang/pekerjaan konstruksi/jasa lainnya dengan nilai diatas
Rp200.000.000,00 dan jasa konsultasi dengan nilai diatas
Rp50.000.000,00.
Sedangkan pengadaan barang/pekerjaan konstruksi/jasa lainnya
dengan nilai dibawah Rp200.000.000,00 dan jasa konsultasi
dengannilaidibawahRp50.000.000,00sertapengadaanlangsung
dapatdilaksanakanolehpejabatpengadaan.
ULP berjumlah gasal beranggotakan paling kurang tiga orang dan
dapat ditambah sesuai dengan kompleksitas pekerjaan. ULP
ditetapkan sesuai dengan kebutuhan paling kurang terdiri atas:
kepala,sekretariat,stafpendukung,dankelompokkerja.

(4)

Panitia/PejabatPenerimaHasilPekerjaan.
Panitia/PejabatPenerimaHasilPekerjaanditetapkanolehPA/KPA.

Seadangkanorganisasi pengadaanbarang/jasamelaluiswakelolaterdiri
atas:

b)

(1)

PenggunaAnggaran/KuasaPenggunaAnggaran;

(2)

PejabatPembuatKomitmen;dan

(3)

Panitia/PejabatPenerimaHasilPekerjaan.

WewenangdanTugasParaPihak
WewenangdantugasparapihakdalamPBJtelahmemerhatikanprinsip
pengendalian dalam tata kelola kepemerintahan yang baik, karena
PA/KPA sebagai perencana umum, PPK sebagai manajer kegiatan,
ULP/pejabat pengadaan sebagai pelaksana pemilihan penyedia
barang/jasa yang mandiri, dan panitia/pejabat penerima pengadaan

156

2014 |Pusdiklatwas BPKP


sebagai pengawas kegiatan/pekerjaan sekaligus pengguna. Selain itu
jenjang bawah dalam struktur organisasi dapat mengusulkan perbaikan
ketetapan jenjang di atasnya. Misalnya ULP melalui PPK dapat
mengusulkan perubahan paket dan jadwal pengadaan yang sulit
diterapkankepadaPA/KPA.
2)

PerencanaanUmumPengadaanBarang/JasaPemerintah
Rencana umum mencakup kegiatan dan anggaran pengadaan barang/jasa
yang dibiayai oleh K/L/D/I sendiri atau bila diperlukan melalui pembiayaan
bersama (cofinancing). Rencana umum pengadaan barang/jasa meliputi
kegiatankegiatan:
a)

mengindentifikasikebutuhanbarang/jasayangdiperlukanK/L/D/I;

b)

menyusundanmenetapkanrencanaanggaranpengadaan

c)

menetapkankebijakanumumtentang:

d)
3)

(1)

pemaketanpekerjaan;

(2)

carapengadaanbarang/jasa;dan

(3)

pengorganisasianpengadaanbarang/jasa;

menyusunkerangkaacuankerja(KAK).

PelaksanaanPemilihanMendahuluiTahunAnggaran
Pengumuman rencana umum pengadaan barang/jasa pada masingmasing
K/L/Isecaraterbukakepadamasyarakatluasdapatdilakukansetelahrencana
kerja dan anggaran K/L/I disetujui oleh DPR. PA pada K/L/D/I harus
menyediakan biaya pendukung untuk pelaksanaan pemilihan mendahului
tahunanggaran.
Padapelelangan/seleksisebelumtahunanggaran:
a)

Kelompok Kerja ULP dapat mengumumkan pelaksanaan pengadaan


setelahrencanakerjadananggaranK/L/IdisetujuiolehDPR.

b)

PengumumanmencantumkankondisiDIPA/DPAbelumditetapkan.

Manajemen Pemerintahan Pusat

157


c)

Dalam hal DIPA/DPA tidak ditetapkan atau lokasi anggaran dalam


DIPA/DPA yang ditetapkan kurang dari nilai pengadaan yang diadakan,
proses pemilihan dibatalkan dan kepada penyedia barang/jasa tidak
diberikangantirugi.

4)

CaraPengadaanBarang/Jasa
Pengadaanbarang/jasapemerintahdapatdilaksanakanmelaluiswakeloladan
pemilihanpenyediabarang/jasayangmencakupbarang,pekerjaankonstruksi,
jasakonsultasi,danjasalainnyasebagaimanaGambar5.5berikut.
Gambar5.6CaraPengadaanBarang/JasaPemerintah

PenanggungJawabAnggaran
Swakelola

InstansiPemerintahLain
KelompokMasyarakat

P BJ
Barang
Penyedia B/J

PekerjaanKonstruksi
JasaKonsultasi
JasaLainnya

a)

PengadaanBarang/JasadengancaraSwakelola
Swakelola adalah kegiatan pengadaan barang/jasa yang direncanakan,
dikerjakan, dan/atau diawasi sendiri oleh K/L/D/I sebagai penanggung
jawab anggaran, instansi pemerintah lain dan/atau kelompok
masyarakat.
Pekerjaandengancaraswakelolameliputikegiatanberikut:
(1)

bertujuan meningkatkan/memanfaatkan kemampuan teknis SDM


sesuaidengantugaspokokK/L/D/I;

158

2014 |Pusdiklatwas BPKP


(2)

operasi/pemeliharaannya

memerlukan

partisipasi

langsung

masyarakatsetempatataudikelolaolehK/L/D/I;
(3)

segibesaran,sifat,lokasiataupembiayaannyatidakdiminatioleh
penyediabarang/jasa;

(4)

secara rinci tidak dapat dihitung/ditentukan terlebih dahulu,


karenaakanmenimbulkanketidakpastiandanrisikoyangbesar;

(5)

diklat,kursus,penataran,seminar,lokakarya,ataupenyuluhan;

(6)

proyekpercontohan(pilotproject)yangbersifatkhusus;

(7)

survei, pemrosesan data, perumusan kebijakan pemerintah,


pengujiandilaboratoriumdanpengembangansistemtertentu;

(8)

bersifatrahasiabagiK/L/D/Iterkait;

(9)

industrikreatif,inovatifdanbudayadalamnegeri;

(10) penelitiandanpengembangandalamnegeri;
(11) pengembanganindustripertahanan,industrialutsistadanindustri
almatsusdalamnegeri.
Terdapat tiga kelompok pelaksana swakelola yaitu K/L/D/I selaku
penanggung jawab anggaran, instansi pemerintah lain, dan kelompok
masyarakat. Pelaksanaan swakelola meliputi kegiatan perencanaan,
pelaksanaan,

pengawasan,

penyerahan,

pelaporan

dan

pertanggungjawabanpekerjaan.
b)

PengadaanBarang/JasaMelaluiPenyedia
PBJ melalui penyedia barang/jasa dilakukan melalui penyedia (badan
usaha atau orang perseorangan) yang memenuhi syarat dan mampu
menyediakanbarang/jasayangdibutuhkan.Dalamkaitanini,diperlukan
pengelompokkan jenis pengadaan yang meliputi barang, pekerjaan
konstruksi, jasa konsultansi, dan jasa lainnya. Definisi barang/jasa yang
diadakaninstansipemerintahmemilikidefinisisebagaiberikut.

Manajemen Pemerintahan Pusat

159


(1)

Barang adalah setiap benda baik berwujud maupun tidak


berwujud, bergerak maupun tidak bergerak, yang dapat
diperdagangkan, dipakai, dipergunakan atau dimanfaatkan oleh
penggunabarang.

(2)

Pekerjaankonstruksiadalahseluruhpekerjaanyangberhubungan
dengan pelaksanaan konstruksi bangunan atau pembuatan wujud
fisiklainnya.

(3)

Jasalainnyaadalahjasayangmembutuhkankemampuantertentu
yang mengutamakan keterampilan (skillware) dalam suatu sistem
tata kelola yang telah dikenal luas di dunia usaha untuk
menyelesaikan suatu pekerjaan dan/atau penyediaan jasa selain
jasa konsultasi, pelaksanaan pekerjaan konstruksi dan pengadaan
barang.

(4)

Jasakonsultasiadalahjasalayananprofesionalyangmembutuhkan
keahliantertentudiberbagaibidangkeilmuanyangmengutamakan
adanyaolahpikir(brainware).

5)

Metodepemilihanpenyedia
ULP/pejabat pengadaan menyusun dan menetapkan metode pemilihan
penyedia barang/pekerjaan konstruksi/jasa konsultansi/jasa lainnya, dengan
ketentuansebagaiberikut.
a)

Pemilihanpenyediabarangdengan:
(1)

pelelanganumumdanpelelangansederhana;

(2)

pelelanganterbatas;

(3)

penunjukanlangsung;

(4)

pengadaanlangsung;atau

(5)

kontes(untukindustrikreatif,inovatifdanbudayadalamnegeri).

160

2014 |Pusdiklatwas BPKP


b)

Pemilihanpenyediajasalainnyadengan:
(1)

pelelanganumumdanpelelangansederhana;

(2)

penunjukanlangsung;

(3)

pengadaanlangsung;atau

(4)

sayembara (untuk industri kreatif, inovatif, dan budaya dalam


negeri).

c)

d)

6)

Pemilihanpenyediapekerjaankonstruksidengan:
(1)

pelelanganumum;

(2)

pelelanganterbatas;

(3)

pemilihanlangsung;

(4)

penunjukanlangsung;atau

(5)

pengadaanlangsung.

Pemilihanpenyediajasakonsultansi
(a)

seleksiumum;

(b)

seleksiterbatas;

(c)

penunjukanlangsung;atau

(d)

pengadaanlangsung.

SpesifikasiTeknis,HargaPerkiraanSendiri(HPS),danRancanganJenisKontrak
Spesifikasi teknis, HPS, dan rancangan jenis kontrak ditetapkan oleh PPK,
sebelumpelaksanaanpemilihanpenyediabarang/jasa.
a)

SpesifikasiTeknis
PPK menyusun spesifikasi teknis dan gambar sesuai dengan hasil
pengkajian ulang spesifikasi teknis dan gambar brosur, termasuk
perubahan yang telah disetujui oleh PA/KPA. Dalam menetapkan
spesifikasi teknis, PPK memperhatikan spesifikasi teknis dalam Rencana

Manajemen Pemerintahan Pusat

161


Umum Pengadaan dan masukan/rekomendasi dari pengguna/penerima
akhir.
b)

HPS
HPSbarang/jasadisusunberdasarkanmasukandaritimpendukungdan
menetapkannya paling lama 28 hari kerja sebelum batas akhir
pemasukan penawaran atau paling lama 28 hari kerja sebelum batas
akhir pemasukan penawaran ditambah dengan waktu lamanya proses
prakualifikasi untuk pemilihan dengan prakualifikasi. Kecuali untuk
pemilihanpenyediabarang/jasalainnyadengankontes/sayembara.
Penyusunan HPS berdasarkan data harga pasar setempat yaitu harga
barang/jasa di lokasi barang/jasa diproduksi/diserahkan/dilaksanakan,
menjelang dilaksanakannya pengadaan barang/jasa. Harga pasar
setempat diperoleh dari hasil survei dengan mempertimbangkan
informasi:
(1)

biayasatuandariBadanPusatStatistik(BPS);

(2)

biayasatuandariasosiasiterkaitdansumberdatalainyangdapat
dipertanggungjawabkan;

(3)

tarif barang/jasa yang diterbitkan oleh pabrikan/distributor


tunggal;

(4)

biaya

kontrak

sebelumnya/sedang

berjalan

dengan

mempertimbangkanfaktorperubahanbiaya;
(5)

inflasi tahun sebelumnya, suku bunga berjalan dan/atau kurs


tengahBI;

162

(6)

hasilperbandingandengankontraksejenisinstansi/pihaklain;

(7)

perkiraanperhitunganbiayaolehkonsultanperencana;

(8)

normaindeks;dan/atau

(9)

informasilainyangdapatdipertanggungjawabkan.

2014 |Pusdiklatwas BPKP


HPSdisusundenganmemperhitungkankeuntungandanbiayaoverhead
yang dianggap wajar. Nilai total HPS bersifat terbuka dan ULP/pejabat
pengadaan wajib mengumumkannya. HPS bukan sebagai dasar untuk
menentukanbesarankerugiannegara.
HPSdigunakansebagai:
(1)

alatuntukmenilaikewajaranpenawarantermasukrinciannya;

(2)

dasarpenetapanbatastertinggipenawaranyangsahdanjaminan
pelaksanaanbaginilaipenawarandibawah80%nilaitotalHPS.

c)

RancanganKontrakdanPenetapanJenisKontrak
Kontrak Pengadaan Barang/Jasa adalah perjanjian tertulis antara PPK
denganPenyediaBarang/JasaataupelaksanaSwakelola.PPKmenyusun
rancangan kontrak antara lain meliputi: jenis kontrak SyaratSyarat
Umum Kontrak (SSUK), pelaksanaan kontrak, penyelesaian kontrak,
adendum kontrak, pemutusan kontrak, hak dan kewajiban para pihak,
personil dan/atau peralatan penyedia, pembayaran kepada penyedia,
pengawasanmutu,sertaSyaratSyaratKhususKontrak(SSKK).

7)

MetodePenilaianKualifikasi
Kualifikasi merupakan proses penilaian kompetensi dan kemampuan usaha
serta pemenuhan persyaratan tertentu lainnya bagi penyedia barang/jasa.
Kualifikasi dilaksanakan melalui dua cara, yaitu prakualifikasi dan
pascakualifikasi.
Prakualifikasi adalah proses penilaian sebelum pemasukan penawaran dan
dipergunakanuntukpemilihanpenyedia:
a)

jasakonsultasi(badanusaha);

b)

barang/pekerjaankonstruksi/jasalainnyayangbersifatkompleksmelalui
pelelanganumumataupenunjukanlangsung,kecualiuntukpenunjukan
langsungkeadaandarurat.

Manajemen Pemerintahan Pusat

163


Pascakualifikasi: proses penilaian kualifikasi setelah pemasukan penawaran
dandipergunakanuntukpemilihanpenyediamelalui:
a)

pelelanganumum,kecualiuntukpekerjaankompleks;

b)

pelelangansederhana/pemilihanlangsung;dan

c)

jasakonsultasiperorangan.

ULP/pejabat pengadaan wajib menyederhanakan proses kualifikasi dengan


ketentuan:
a)

memintapenyediabarang/jasamengisiformulirkualifikasi;dan

b)

tidak meminta seluruh dokumen yang disyaratkan kecuali pada tahap


pembuktiankualifikasi.

8)

PenetapanPenyediaBarang/JasadanJenisKontrak
a)

PenetapanPenyediaBarang/Jasa
ULP/pejabat pengadaan menetapkan hasil pemilihan penyedia
barang/jasa dan mengumumkannya melalui website K/L/D/I dan Portal
Pengadaan Nasional, sedangkan hasil pemilihan penyedia melalui
penunjukanlangsungdiumumkanmelaluiwebsiteK/L/D/I.
Terhadaphasilpemilihan,pesertadapatmengajukansanggahantertulis
kepada ULP dan ditembuskan kepada PPK, PA/KPA dan APIP K/L/D/I
apabila menemukan: penyimpangan atas ketentuan dan prosedur;
rekayasa

yang

mengakibatkan

persaingan

tidak

sehat;

dan

penyalahgunaanwewenangolehULP/pejabatlainnya.
Terhadap proses pelelangan, ULP dapat menyatakan pelelangan/
pemilihanlangsunggagalapabila:
(1)

jumlah peserta lulus kualifikasi memasukkan penawaran


pengadaan barang/pekerjaan konstruksi/jasa lainnya kurang dari
tigapesertadanataulimapesertauntukjasakonsultasi;

(2)

164

sanggahanpesertaterhadaphasilprakualifikasiternyatabenar;

2014 |Pusdiklatwas BPKP


(3)

tidakadapenawaranyanglulusevaluasipenawaran;

(4)

dalam evaluasi penawaran ditemukan bukti/indikasi persaingan


tidaksehat;

(5)

hargapenawaranterendahterkoreksiuntukkontrakhargasatuan
dankontrakgabunganlebihtinggidariHPS;

(6)

seluruh harga penawaran yang masuk untuk kontrak lumpsum di


atasHPS;

(7)

sanggahanhasilpelelangandaripesertaternyatabenar;

(8)

calon pemenang dan calon pemenang cadangan 1 dan 2, setelah


dievaluasi dengan sengaja tidak hadir dalam klarifikasi dan
pembuktiankualifikasi.

b)

BuktiPerjanjian
Tandabuktiperjanjianpengadaanbarang/jasamenggunakan:
(1)

bukti pembelian untuk pengadaan bernilai sampai dengan


Rp10.000.000,00

(2)

kuitansi untuk pengadaan yang bernilai sampai dengan


Rp50.000.000,00

(3)

surat perintah kerja (SPK) untuk pengadaan barang/pekerjaan


konstruksi/jasalainnyasampaidenganRp200.000.000,00danjasa
konsultasisampaidenganRp50.000.000,00.

(4)

surat perjanjian (kontrak) untuk pengadaan barang/pekerjaan


konstruksi/jasalainnyabernilaidiatasRp200.000.000,00danjasa
konsultasibernilaidiatasRp50.000.000,00.

Manajemen Pemerintahan Pusat

165


4.

PembukuandanAkuntansi
a.

Pembukuan
Pembukuan atas transaksi belanja dilaksanakan oleh Bendahara Pengeluaran.
Bendahara Pengeluaran adalah orang yang ditunjuk untuk menerima, menyimpan,
membayarkan, menatausahakan, dan mempertanggungjawabkan uang untuk
keperluanbelanjanegaradalamrangkapelaksanaanAPBNpadakantor/satuankerja
Kementerian Negara/ Lembaga. Bendahara wajib menatausahakan seluruh uang
yangdikelolanyadanseluruhtransaksidalamrangkapelaksanaananggaransatuan
kerja.
Bendaharawajibmenyelenggarakanpembukuanterhadapseluruhpenerimaandan
pengeluaran dalam rangka pelaksanaan anggaran satuan kerja yang berada di
bawah pengelolaannya. Berdasarkan Peraturan Menteri Keuangan Nomor PER
3/PB/2014, pembukuan bendahara terdiri dari Buku Kas Umum (BKU), buku
pembantu, dan Buku Pengawasan Anggaran. Buku pembantu bendahara
pengeluaran sekurangkurangnya terdiri atas Buku Pembantu Kas, Buku Pembantu
UP/TUP,BukuPembantuLSBendahara,BukuPembantuPajakdanBukuPembantu
Lainlain.
Pembukuan tersebut dilakukan dengan aplikasi yang dibuat dan dibangun oleh
KementerianKeuangancq.DirektoratJenderalPerbendaharaan.Dalamhalaplikasi
tersebut tidak dapat digunakan, bendahara dapat menyelenggarakan pembukuan
secaramanual.
Halhalyangdiperhatikandalampembukuanolehbendaharayaitu:
Setiap transaksi harus segera dicatat dalam BKU sebelum dibukukan dalam
bukubukupembantudanpengawasananggaran.
PA/KPAdapatmenentukanbukubukubantu/registerselainBKU.
Pembukuandilaksanakanberdasarkanasasbruto.
KPAmelaksanakanpemeriksaankassekurangkurangnyasatukalidalamsatu
bulan dalam rangka pengawasan penatausahaan kas dan ketertiban
pembukuan.

166

2014 |Pusdiklatwas BPKP


Buku,catatandandokumenlainyangmenjadidasarperhitunganPNBPwajib
disimpan selama sepuluh tahun. Terhadap instansi pemerintah yang ditunjuk
atas permintaan menteri untuk menagih, memungut dan menyetorkan PNBP
jugadapatdiperiksakhususolehinstansiyangberwenang.
Pembukuan oleh bendahara dilakukan berdasarkan dokumen sumber. Dokumen
sumberadalahseluruhdokumenterkaitdenganuangyangdikelolaBendaharaserta
transaksidalamrangkapelaksanaananggaransatuankerja,antaralain:
DIPAyangtelahmendapatpengesahan.
SPMUP/SPMTUP/SPMGUP/SPMLSyangtelahditerbitkanSP2D
Kwitansi/dokumen pembayaran atas uang yang bersumber dari UP atau LS
Bendahara
FakturpajakataspotonganuangyangbersumberdariUPatauLSBendahara
Bendahara wajib menyusun LPJ Bendahara atas uang yang dikelolanya secara
bulanan. LPJ tersebut dibuat berdasarkan pembukuan yang diselenggarakan
bendahara yang telah diperiksa dan direkonsiliasi oleh KPA. LPJ Bendahara
Pengeluaran dituangkan sebagaimana Format Lampiran IX Peraturan Menteri
KeuanganNomorPER3/PB/2014.
b.

Akuntansi
Penyelenggaraan akuntansi terkait dengan kewajiban Satuan Kerja sebagai unit
akuntansi untuk dapat menyampaikan laporan keuangan yang akan dikonsolidasi
sampaiketingkatPenggunaAnggara(K/L).Sistemakuntansiyangdigunakanadalah
Sistem Akuntansi Instansi, yang dalam kaitan belanja negara akan menghasilkan
LaporanRealisasiAnggaranyangmenyajikananggarandanrealisasipendapatandan
belanja satuan kerja dalam satu tahun anggaran. Untuk menampung transaksi
aset/BarangMilikNegara(BMN)digunakanSistemInformasidanAkuntansiBarang
MilikNegara(SIMAKBMN)yangakanmenyajikannilaiasettetappadaneraca.
Dalam pencatatan transaksi akuntansi belanja sebagai dasar pencatatan estimasi
belanja adalah DIPA Kementerian Negara/Lembaga atau dokumen pelaksanaan
anggaranlainnyayangdipersamakandenganDIPA.Dokumensumbersebagaidasar

Manajemen Pemerintahan Pusat

167


pencatatanrealisasibelanjaantaralainSP2D,beritaacaraserahterimabarang,dan
sebagainya.
Pembahasan lebih lanjut mengenai akuntansi terkait SAI dan Pelaporan Keuangan
padaBABVIPELAPORANPENGELOLAANDANPERTANGGUNGJAWABANKEUANGAN
NEGARA.

D.

MEKANISME PEMOTONGAN/PEMUNGUTAN PAJAKPAJAK NEGARA OLEH


BENDAHARA

Bendahara pada instansi pemerintah telah ditunjuk sebagai pemotong/pemungut atas


penerimaan pajakpajak negara khususnya transaksi belanja yang dilakukan oleh instansi
pemerintah.Dalamperpajakan,kedudukanbendaharapemerintahyangmengelolaAPBNsama
dengankedudukanwajibpajak(WP),sehinggabendaharamempunyaikewajibansebagaimana
WP lainnya, serta mendapatkan sanksi perpajakan jika terjadi pelanggaran. Kewajiban dan
sanksi perpajakan bagi bendahara yang mengelola anggaran pendapatan dan belanja
negara/daerah,sebagaiberikut.
1.

KewajibanPerpajakan
a.

KewajibanmendaftarkandiriuntukmendapatkanNomorPokokWajibPajak(NPWP)
di kantor pelayanan pajak yang sesuai dengan lokasi kedudukannya. Selama masih
melaksanakan pengelolaan anggaran negara NPWP bendahara ini tetap berlaku.
NPWPatasnamabendaharainiakandilakukanpenghapusanjikaterjadi:

b.

1)

perubahanorganisasiyangmengakibatkannamaunitinstansinyaberubah;

2)

proyek/kegiatantelahberakhir(selesai).

Kewajibanuntukmenyetorkanpenerimaanpajakyangdipungut/dipotongpadasaat
dantempatsesuaidenganketentuanumumperpajakanyangberlaku.

c.

Kewajiban melaporkan pemungutan dan pemotongan pajak dengan menyerahkan


suratpemberitahuanpajak(SPT)sesuaiketentuanumumperpajakanyangberlaku.

168

2014 |Pusdiklatwas BPKP


2.

SanksiPerpajakan
Sanksiperpajakanmeliputisanksiadministrasidansanksipidanasebagaiberikut.
a.

Sanksiadministrasi,berupadendayaitu:
1)

dendasebesarRp100.000,00jikaterlambatmenyampaikanSPTMasaPPhdan
Rp500.000,00 untuk SPT Masa PPN sesuai waktu yang telah ditentukan yaitu
20harisetelahmasapajakberakhir;

2)

denda sebesar Rp1.000.000,00 jika terlambat menyampaikan SPT Tahunan


PPh sesuai waktu yang telah ditentukan yaitu tanggal 31 Maret tahun
berikutnya.

Padasejumlahpelanggaran,sanksidendainiakanditambahdengansanksipidana.
Pelanggaran yang juga dikenai sanksi pidana ini adalah pelanggaran yang sifatnya
alpaataudisengaja.
b.

Sanksi administrasi berupa pengenaan bunga sebesar 2% per bulan dihitung dari
tanggal jatuh tempo pembayaran s.d. tanggal pembayaran atas pembayaran atau
penyetoranpajakyangdilakukansetelahtanggaljatuhtempopenyetoran.

c.

Sanksi administrasi berupa kenaikan pajak terutang. Dilihat dari bentuknya, sanksi
administrasi berupa kenaikan adalah sanksi yang cukup memberatkan bagi wajib
pajak, karena dengan pengenaan sanksi ini jumlah pajak yang harus dibayar bisa
menjadi berlipat ganda. Sanksi berupa kenaikan pada dasarnya dihitung dengan
angkapersentasetertentudarijumlahpajakyangtidak/kurangdibayar.Jikadilihat
dari penyebabnya, sanksi kenaikan biasanya dikenakan karena wajib pajak yang
tidak memberikan informasiinformasi yang dibutuhkan dalam menghitung jumlah
pajakterutang.

d.

Sanksi pidana dikenakan terhadap setiap orang karena kealpaannya tidak


menyampaikan SPT atau menyampaikan SPT tetapi isinya tidak benar atau tidak
lengkap sehingga dapat menimbulkan kerugian pada pendapatan negara dan
perbuatan tersebut merupakan perbuatan setelah perbuatan yang pertama kali,
didendapalingsedikitsatukalijumlahpajakterutangyangtidakataukurangdibayar

Manajemen Pemerintahan Pusat

169


dan paling banyak dua kali jumlah pajak terutang yang tidak atau kurang dibayar,
ataudipidanakurunganpalingsingkattigabulanataupalinglamasatutahun.
e.

Sanksi pidana berupa kurungan paling singkat enam bulan dan paling lama enam
tahun. Denda paling sedikit dua kali jumlah pajak terutang yang tidak atau kurang
bayar dan paling banyak empat kali jumlah pajak terutang yang tidak atau kurang
bayar bagi wajib pajak yang dengan sengaja tidak menyampaikan SPT atau
menyampaikan SPT, tetapi isinya tidak benar atau tidak lengkap dan dapat
merugikannegara,sehinggadapatmenimbulkankerugianpadapendapatannegara.

3.

KewajibanPemotongandanPemungutanPajakPusat
Bendahara pemerintah yang melakukan pembayaran dengan dana APBN/APBD wajib
melakukanpemotongandanpemungutanpajaksebagiberikut.

JenisPajak/Ketentuan
Terkait
a. PPhPasal21
PP80/2010
PMK262/2010

UraianTarif
Pemotonganataspenghasilanyangdibayarkankepadaorang
pribadisehubungandenganpekerjaanjabatan,jasa&kegiatan.
Tarif:progresif5%30%

PerdirjanPJ57/2009
b. PPhPasal4(2)

Pemotonganataspenghasilanyangdibayarkansehubunganjasa
tertentudansumbertertentu(jasakonstruksi,sewa
tanah/bangunan,pengalihanhakatastanah/bangunan,hadiah
undian,danlainnya).
Tarif:
1. JasaKonstruksiPelaksanaan
Jasapelaksanaanmemilikikualifikasiusahakecil
Tidakmemilikikualifikasiusaha

4%

Memilikikualifikasiusahamenengahataubesar
2. JasaKonstruksiPerencanaan
Memilikikualifikasiusaha

2%
3%

4%

Tidak`memilikikualifikasiusaha 6%
3. Transaksipengalihanhakatastanah/bangunan 5%xnilai
pengalihanbruto.
4. Penyewaantanah/bangunan 10%xnilaisewabruto
c. PPhPasal22
KMK563/2003
PMK154/2010

170

Pemungutanataspenghasilanyangdibayarkansehubungan
denganpembelianbarang.
Tarif:1,5%nilaipembelian(diatasRp2.000.000).

2014 |Pusdiklatwas BPKP


JenisPajak/Ketentuan
Terkait
d. PPhPasal23
UU36/2008

e. PPhPasal26
UU36/2008
f. PPNdanPPnBM
UU42/2009
KMK563/2003

g. BeaMaterai
PP24/2000

UraianTarif
Pemotonganataspenghasilanyangdibayarkanberupahadiah,
bunga,dividen,sewa,royalti,danjasajasalainnyaselainobjek
PPhPasal21.
Tarif:2%nilaisewadanjasalainnya
Pembayaranataspenghasilankepadawajibpajakluarnegeri.
Tarif:20%jumlahpenghasilanbruto
Pemungutanataspajakkonsumsiyangdibayarsendiri
sehubunganpenyerahanbarangkenapajakdanjasakenapajak.
Tarif:
1. PPN
10%DPP
2. PPnBM
10%,20%,30%,40%,50%,200%
Pembayaranataspemanfaatandokumendokumentertentu
(kuitansi,kontrak).
SesuaiPP24/2000tarifbeamateraiuntukdokumenyang
menyatakannominaluangadalahsebagaiberikut:
nominalsampaiRp250.000tidakdikenakanBeaMeterai
nominal>Rp250.000Rp1.000.000dikenakanBeaMeteraiRp3.0
nominal>Rp1.000.000,dikenakanBeaMeteraiRp6.000,

a.

BendaharaPemotongPphPasal21/26
1)

PengertianPPhPasal21/26
Pengertian PPh Pasal 21 adalah pajak atas penghasilan berupa gaji, upah,
honorarium,tunjangan,danpembayaranlaindengannamadandalambentuk
apapun sehubungan dengan pekerjaan atau jabatan, jasa dan kegiatan yang
diterimaolehWPorangpribadidalamnegeri.PPhPasal26adalahpajakatas
penghasilanberupadividen,bungatermasukpremium,diskonto,premiswap
dan imbalan sehubungan dengan jaminan pengembalian utang, royalti, sewa
dan penghasilan lain sehubungan dengan penggunaan harta, imbalan
sehubungan dengan jasa, pekerjaan dan kegiatan, hadiah dan penghargaan,
pensiundanpembayaranberkalalainnyayangditerimaolehwajibpajakluar
negeriselainbentukusahatetap.

Manajemen Pemerintahan Pusat

171


PenerimapenghasilanyangdipotongPPh Pasal21dan/atau26adalahorang
pribadiyangmerupakan:
a)

pegawai;

b)

penerima uang pesangon, pensiun atau uang manfaat pensiun,


tunjanganharitua,ataujaminanharituatermasukahliwarisnya;

c)

bukan pegawai yang menerima atau memperoleh penghasilan


sehubungandenganpekerjaan,jasa,ataukegiatan,antaralainmeliputi:
tenaga ahli; seniman/pekerja seni; olahragawan pembawa acara;
pengarang,peneliti,danpenerjemah;pemberijasadalamsegalabidang;
agen iklan; pengawas atau pengelola proyek; pembawa pesanan atau
yang menemukan langganan atau yang menjadi perantara; petugas
penjaja barang dagangan; petugas dinas luar asuransi; dan distributor
perusahaanmultilevelmarketingataudirectsellingdankegiatansejenis
lainnya.

d)

peserta kegiatan, meliputi: peserta perlombaan; peserta rapat,


konferensi, sidang, pertemuan, atau kunjungan kerja; peserta atau
anggota dalam suatu kepanitiaan; peserta pendidikan, pelatihan, dan
magang;pesertakegiatanlain.

BendaharawajibmemotongPPhPasal21ataspenghasilanbrutoberikutini.
a)

Penghasilan yang diterima oleh pejabat negara, PNS, TNI/POLRI, dan


pensiunan yang bersifat teratur dan dibebankan kepada keuangan
negara/daerahberupa:
(1)

gaji dan tunjangan lain bersifat tetap yang diterima PNS/TNI/


POLRI;

(2)

gaji kehormatan dan tunjangan lain atau imbalan tetap sejenis


yangditerimapejabatnegara;

(3)

uang pensiun dan tunjangan lain bersifat tetap yang diterima


pensiunantermasukjanda/dudadan/atauanakanaknya.

172

2014 |Pusdiklatwas BPKP


b)

Penghasilan berupa honorarium, uang saku, uang rapat, uang


representasi, hadiah atau penghargaan dan imbalan sejenis dengan
nama dan dalam bentuk apapun yang dibebankan terhadap keuangan
negara/daerah, kecuali jika pembayaran tersebut dibayarkan kepada
PNS golongan IId ke bawah dan anggota TNI/POLRI berpangkat
peltu/ajuninspektursatukebawah.

c)

Penghasilan yang diterima oleh penerima penghasilan selain pejabat


negara,PNS,anggotaTNI/POLRIdanpensiunanyangdibebankankepada
keuangannegara/daerah,berupa:
(1)

upah harian, upah mingguan, upah satuan, upah borongan atau


upahupahyangdibayarsecarabulanan;

(2)

honorarium, komisi, fee, dan imbalan sehubungan dengan


pekerjaan,jasadankegiatan.

Secara ringkas, PPh Pasal 21/26 yang wajib dilakukan pemotongan oleh
bendaharapemerintahdapatdigambarkansebagaiberikut.
Gambar5.7PPhPasal21/26yangWajibDipotongBendahara

Manajemen Pemerintahan Pusat

173


2)

Saatpemungutan,tarifdancaramenghitungPasal21dan26
a)

DasarpengenaandanpemotonganPPhPasal21dan26
(1)

PenghasilanKenaPajak(PKP)
(a)

PejabatNegara,PNS,TNI,POLRI,danPensiunan
PKP dihitung sebesar penghasilan neto dikurangi dengan
penghasilan tidak kena pajak (PTKP). Adapun penghasilan
netodihitungsebesarpenghasilanbrutodikurangi:
biaya

jabatan

setinggitingginya

5%

dari

penghasilan

Rp6.000.000,00

bruto

setahun

atau

Rp500.000,00sebulanbagipejabat/pegawaiaktif;
iuranpensiunbagipejabat/pegawaiaktif;
biaya pensiun sebesar 5% dari penghasilan bruto
setinggitingginya

Rp2.400.000,00

setahun

atau

Rp200.000,00sebulanbagipensiunan.
(b)

Pegawai tidak tetap yang penghasilannya dibayar secara


bulanan atau jumlah kumulatif penghasilan yang diterima
selama satu bulan kalender telah melebihi Rp2.025.000,00,
PKPdihitungsebesarpenghasilanbrutodikurangiPTKP.

(c)

Bukan pegawai selain tenaga ahli yang menerima imbalan


berkesinambungan jumlah PKPnya sebesar penghasilan
brutodikurangiPTKPyangdihitungsecarabulanan.

(2)

Penghasilantidakkenapajak(PTKP)dihitungdenganketentuan:

Jumlah PTKP (Rp)


Jumlah
Tanggungan

174

WP Tidak Kawin

WP Kawin

WP Kawin
Penghasilan Istri
Digabung

0 tanggungan

24.300.000,00

26.325.000,00

50.625.000,00

1 tanggungan

26.325.000,00

28.350.000,00

52.650.000,00

2 tanggungan

28.350.000,00

30.375.000,00

54.675.000,00

3 tanggungan

30.375.000,00

32.400.000,00

56.700.000,00

2014 |Pusdiklatwas BPKP


(3)

Jumlah penghasilan yang melebihi Rp200.000,00 sehari


Penghasilan tersebut berlaku bagi pegawai tidak tetap yang
menerima upah harian, upah mingguan, upah satuan, dan upah
borongan sepanjang penghasilan kumulatif yang diterima dalam
sebulankalenderbelummelebihiRp2.025.000,00.

(4)

50%darijumlahpenghasilanbruto
Penghasilan tersebut berlaku bagi tenaga ahli yang melakukan
pekerjaanbebas.

(5)

Penghasilan bruto khusus untuk penerima penghasilan selain


pegawai, penerima uang pesangon, pensiun atau uang manfaat
pensiun, tunjangan hari tua, atau jaminan hari tua termasuk ahli
warisnya, dan bukan pegawai yang menerima atau memperoleh
penghasilansehubungandenganpekerjaan,jasa,ataukegiatan.

b)

PengenaantarifdancaramenghitungPPhPasal21/26.
(1)

TarifPPhPasal21yangditerapkanatasPKPberdasarkanPasal17
UUNomor7Tahun1983sebagaimanaterakhirdiubahdenganUU
Nomor36Tahun2008sebagaiberikut.
LapisanPKPTarifPajak

(2)

(a)

s.d.Rp50juta

(b)

diatasRp50jutas.d.Rp250juta

15%

(c)

diatasRp250jutas.d.Rp500juta

25%

(d)

diatasRp500juta

30%

5%

Gaji/pensiun/tunjangan terkait bagi pejabat negara, PNS, TNI,


POLRIdanpensiunan,perhitunganpajaknyasebagaiberikut.

PKP=penghasilanbrutobiayajabatan/biayapensiunPTKP

PPh21=tarifPasal17xPKP

Catatan:PPh21iniditanggungolehpemerintah

Manajemen Pemerintahan Pusat

175


(3)

Honorariumdanimbalanlaindengannamaapapunyangditerima
olehpejabatnegara,PNS,TNIdanPOLRIberikutini.

(4)

GolonganIV=tarif15%xpenghasilanbruto(PPhFinal)

GolonganIII=tarif5%xpenghasilanbruto(PPhFinal)

GolonganI/II=tidakdikenakanPPh21

Bagi pegawai tidak tetap atau tenaga kerja lepas yang menerima
penghasilan berupa upah harian, upah mingguan, upah satuan,
upahborongandanuangsakuharianberikutini.
(a)

Upah

harian/mingguan/borongan

tidak

melebihi

Rp200.000,00/hari,PPh21=nihil.
(b)

Upahharian/mingguan/boronganmelebihiRp200.000/hari:

(c)

PPh21=tarif5%x(upahharianRp200.000,00).

Upah harian/mingguan/borongan secara kumulatif dalam


satubulanmelebihiRp2.025.000,00:

PPh 21 = 5% x (brutoPTKP harian sebenarnya)


potongansebelumnya.

(d)

Upahharian/mingguan/borongan,biladibayarbulanan:

PPh 21 = tarif Pasal 17x(brutoPTKP) disetahunkan:12


bulan

(5)

Tarif berdasarkan Pasal 17 UU PPh diterapkan atas jumlah


kumulatifdari:
(a)

PKP = jumlah penghasilan bruto PTKP; yang diterima


berkesinambungan oleh bukan pegawai (selain tenaga ahli)
dengansyarat:

yangbersangkutantelahmemilikiNPWP

hanya memperoleh penghasilan dari hubungan kerja


denganpemotongPPhPasal21

176

tidakmemperolehpenghasilanlain.

2014 |Pusdiklatwas BPKP


Apabila tidak memenuhi syaratsyarat tersebut, maka yang
dijadikan dasar pemotongan hanya jumlah penghasilan
bruto.
(b)

50%darijumlahpenghasilanbrutoyangditerimatenagaahli
(pengacara, akuntan, arsitek, dokter, konsultan, notaris,
penilai,aktuaris).

(6)

Tarif 20% bersifat final atas penghasilan bruto yang diterima


sebagai imbalan atas pekerjaan, jasa, dan kegiatan orang pribadi
(WP luar negeri) mengacu pada ketentuan persetujuan
penghindaran pajak berganda yang berlaku antara RI dengan
negaraWPluarnegeri(PPhPasal26).

(7)

Penerima penghasilan yang tidak memiliki NPWP dikenakan tarif


lebih tinggi 20% dari tarif PPh Pasal 21 bagi WP yang memiliki
NPWP.

3)

Tatacarapemotongan,penyetorandanpelaporanPasal21dan26
a)

TatacaraPemotongan
(1)

Bendahara menghitung, memotong, menyetor dan melapor PPh


Pasal 21/26 yang terutang untuk setiap bulan kalender termasuk
laporanpenghitunganPPhyangnihil.

(2)

Bendahara membuat catatan atau kertas kerja perhitungan PPh


Pasal21untukmasingmasingpenerimapenghasilanyangmenjadi
dasar pelaporan PPh Pasal 21 dan/atau 26 yang terutang untuk
setiapmasapajakdanwajibmenyimpancatatanataukertaskerja
perhitungantersebut.

(3)

DalamhalterjadikelebihanpenyetoranPPhPasal21dan/atau26
yang terutang pada suatu bulan, kelebihan tersebut dapat
diperhitungkan dengan PPh Pasal 21 dan/atau 26 yang terutang
padabulanberikutnyamelaluiSPPmasaPPhPasal21dan/atau26.

Manajemen Pemerintahan Pusat

177


(4)

Bendahara membuat dan memberikan bukti pemotongan pada


saatdilakukanpemotonganPPhPasal21dan/atau26.

(5)

Bendahara wajib meminta surat pernyataan yang berisi jumlah


tanggungan keluarga pada awal tahun kalender atau pada saat
mulai menjadi subjek pajak dalam negeri sebagai dasar penentu
PTKP.

b)

TatacarapenyetorandanpelaporanPPhPasal21/26.
(1)

Bendahara menyetor PPh Pasal 21 yang tidak ditanggung


pemerintah dengan menggunakan surat setoran pajak (SSP) ke
bank persepsi atau kantor pos dan giro selambatlambatnya
tanggal10bulantakwinberikutnya.Apabilatanggal10jatuhpada
hariliburmakapenyetorandilakukanpadaharikerjaberikutnya.

(2)

PPh Pasal 21 yang terutang bagi Pejabat Negara, PNS, Anggota


TNI/POLRIyangPphnyaditanggungpemerintah,bendaharacukup
melaporkanperhitunganPPhPasal21yangterutangdalamdaftar
gajikepadaKPPN.

(3)

BendaharamelaporkanPPhPasal21yangterutangsekalipunnihil
dengan menggunakan SPT Masa selambatlambatnya tanggal 20
bulantakwinberikutnya.Apabilatanggal20jatuhpadaharilibur,
pelaporandilakukanpadaharikerjaberikutnya.

b.

BendaharaPemotongPPhPasal22
1)

PengertianPPhPasal22
PPh Pasal 22 adalah pajak penghasilan yang salah satu objeknya
dipungut/dipotong sehubungan dengan pembayaran atas pembelian barang
olehDirektoratJenderalAnggarandanbendaharapemerintahpusatmaupun
daerah. PPh Pasal 22 dikenakan atas keuntungan penjual/rekanan dan
diperlakukanolehyangbersangkutansebagaikreditpajak.OlehkarenaituPPh
Pasal 22 dilarang membebani harga pembelian barang yang dibiayai oleh
APBN/APBD.

178

2014 |Pusdiklatwas BPKP


PembayaranyangdikecualikandaripemungutanPPhPasal22antaralain:
a)

barang kiriman hadiah keperluan ibadah umum, amal, sosial atau


budaya;

b)

barang keperluan museum, kebun binatang dan tempatumum terbuka


sejenis penelitian dan pengembangan ilmu pengetahuan, khusus tuna
netradanpenyandangcacatlain;

c)

vaksinpoliodalamrangkaprogramPIN(PekanImunisasiNasional);

d)

bukubukupelajaranumum,kitabsucidanbukubukupelajaranagama;

e)

barang/peralatan/perlengkapanmiliteruntukkeperluanhankam;

f)

penyerahan barang paling banyak Rp2.000.000,00 (bukan jumlah yang


dipecahpecah);

g)

pembelian BBM, listrik, gas, pelumas, air minum/PDAM, dan benda


bendapos;

h)

pembayaranuntukpembelianbarangterkaitpenggunaandanabantuan
operasionalsekolah(BOS).

2)

SaatPemungutan,TarifdanCaraMenghitungPPhPasal22
Pajak Penghasilan (PPh) Pasal 22 dipungut pada saat pembayaran atas
pembelianbarangkepadarekananyangdibiayaidariAPBN/APBDdengantarif
1,5%xhargabeli.

3)

TataCaraPemotongan,PenyetorandanPelaporanPPhPasal22
a)

TatacaraPemotongan/PemungutandanPenyetoranPPhPasal22
(1)

PPh Pasal 22 dipungut pada setiap pelaksanaan pembayaran oleh


KPPN atau bendahara atas penyerahan barang oleh wajib pajak
(rekanan).

(2)

PPh Pasal 22 yang pemungutannya dilakukan oleh bendahara


harus disetor pada hari yang sama dengan pelaksanaan

Manajemen Pemerintahan Pusat

179


pembayaran atas penyerahan barang yang dibiayai dari belanja
negara.
(3)

Penyetoran dilakukan ke bank persepsi atau kantor pos dengan


menggunakan SSP yang telah diisi oleh dan atas nama rekanan
sertaditandatanganiolehbendahara.DalamhalpemungutanPPh
Pasal22dilakukanKPPN,SSPjugadiisiolehdanatasnamarekanan
serta ditanda tangani oleh bendahara. Dalam hal rekanan belum
memiliki NPWP dikenakan denda kenaikan 100% dari jumlah PPh
Pasal22yangdipungut.

b)

TataCaraPelaporanPotonganPPhPasal22
(1)

Bendahara sebagai pemungut PPh Pasal 22 wajib menyampaikan


SPTMasaPPhPasal22BelanjaNegara.

(2)

SPT Masa disampaikan selambatlambatnya 14 hari setelah bulan


takwinberakhir.

(3)

Apabilaharike14jatuhpadaharilibur,makapelaporandilakukan
padaharikerjaberikutnya.

c.

BendaharaPemotongPphPasal23/26
1)

PengertianPajakPenghasilan(PPh)Pasal23
PPh Pasal 23 adalah pajak atas penghasilan dengan nama dan dalam bentuk
apapun yang berasal dari modal, penyerahan jasa atau penyelenggaraan
kegiatan selain yang telah dipotong PPh Pasal 21. Pihak yang dikenakan
pemotongan PPh Pasal 23 adalah WP dalam negeri dan badan usaha tetap
(BUT)tanpamengenalbatasannilaipengadaansepertipadaPPhPasal22.PPh
Pasal 23 dikenakan atas pembayaran terkait pengadaan jasa, sewa, bunga,
deviden,royaltidanhadiahsedangkanPPhPasal22ataspembelianbarang.
PenghasilanyangdipotongPPhPasal23antaralainberikutini.

180

2014 |Pusdiklatwas BPKP


a)

Dividen dengan nama dan dalam bentuk apapun, termasuk dividen


perusahaan asuransi ke pemegang polis, pembagian sisa hasil usaha
koperasi.

b)

Hadiah/penghargaan/bonus/sejenisnya selain yang dipotong PPh Pasal


21.

c)

Sewadanpenghasilanlainsehubungandenganpenggunaanharta,selain
sewaatastanahdanataubangunan.

d)

Imbalan sehubungan dengan jasa teknik, jasa manajemen, jasa


konstruksi, jasa konsultan dan jasa lain selain jasa yang telah dipotong
PPhPasal21.

PengecualianobjekpemotonganPPhPasal23antaralain:

2)

penghasilanyangdibayaratauterutangkepadabank

sisahasilusahakoperasiyangdibagikankepadaanggotanya.

SaatPemungutan,TarifdanCaraMenghitungPPhPasal23
Gambar5.8TarifdanDasarPemotonganPPhPasal23

Manajemen Pemerintahan Pusat

181


PPhPasal23dipungut padasaatpembayaranataspengadaanjasadansewa
kepada penjual/rekanan serta hadiah, penghargaan, bonus dan sejenisnya
yangdibiayaidariAPBN/APBD.
TarifPPhPasal23sebagaiberikut.
a)

15% x penghasilan bruto atas dividen, bunga, royalti, hadiah/


penghargaan/bonusdansejenisnyaselainyangtelahdipotongPPhPasal
21.

b)

2%xpenghasilanbrutotidaktermasukPPNatassewadanpenghasilan
lain sehubungan dengan penggunaan harta (kecuali sewa tanah
dan/ataubangunan)sertajasateknik,jasamanajemen,jasakonstruksi,
jasakonsultandanjasalainselainyangtelahdipotongPPhPasal21.

Dalam hal WP yang menerima penghasilan tidak memiliki NPWP tarif


pemotonganPPhPasal23dinaikkanlebihtinggi100%.
3)

PengertianPPhPasal26
PPh Pasal 26 dikenakan atas penghasilan yang bersumber di Indonesia dan
diterima oleh WP luar negeri (badan dan orang pribadi) selain bentuk usaha
tetap(BUT).

4)

SaatPemungutan,TarifdanCaraMenghitungPPhPasal26
PPh Pasal 26 dipungut pada saat pembayaran atas pembelian jasa baik oleh
KPPNmaupunbendaharadandidukungbuktipemotongan.
Tarif PPh Pasal 26 yang dipungut oleh bendahara pemerintah: 20% x
penghasilan bruto dan bersifat final, kecuali bila ada Persetujuan
Penghindaran Pajak Berganda (P3B), maka tarif PPh Pasal 26 disesuaikan
denganketentuanyangberlakudalamP3Btersebut.

5)

TataCaraPemotongan,PenyetorandanPelaporanPPhPasal23/26berikutini.
a)

PPhPasal23/26yangdipungutolehbendaharapemerintahdijumlahkan
dalamsatubulantakwimdanharusdisetorkankebankpersepsi/kantor

182

2014 |Pusdiklatwas BPKP


pos dengan menggunakan SSP yang telah diisi oleh dan atas nama
rekanan serta ditandatangani paling lambat tanggal 10 bulan takwim
berikutnya.Dalam hal rekanan belum memilikiNPWP dikenakan denda
kenaikan100%darijumlahPPhPasal23/26yangdipungut.
b)

Bendahara melaporkan PPh Pasal 22 yang dipungut dengan


menggunakan SPT Masa dilampiri lembar ke 3 SSP beserta daftar bukti
pemotonganpajakdanbuktinyapalinglambattanggal20bulantakwim
berikutnya.

d.

BendaharaPemotongPPNdanPPnBM
1)

PengertianPPNdanPPnBM
Gambar5.9PengertianPPNdanPPnBM

DI
DALAM
a)

PajakPertambahanNilai(PPN)
PPNadalahpajakyangdikenakanataskonsumsibarangkenapajak(BKP)
danjasakenapajak(JKP)didalamdaerahpabean.
BKPadalahbarangberwujudyangmenurutsifatatauhukumnyaberupa
barangbergerakataubarangtidakbergerak,danbarangtidakberwujud
yangdikenakanpajakberdasarkanUUPPN.

Manajemen Pemerintahan Pusat

183


JKPadalahsetiapkegiatanpelayananberdasarkansuatuperikatanatau
perbuatan hukum yang menyebabkan suatu barang/fasilitas/
kemudahan/hak tersedia untuk dipakai, termasuk jasa untuk
menghasilkan barang karena pesanan atau permintaan dengan bahan
danataspetunjukpemesanyangdikenakanpajakberdasarkanUUPPN.
Kelompok barang yang tidak dapat dikenakan PPN terdiri sebagai
berikut.
(1)

Barang hasil pertambangan atau hasil pengeboran yang diambil


langsung dari sumbernya, yaitu: minyak mentah (crude oil), gas
bumi, panas bumi, pasir dan kerikil, batubara sebelum diproses
menjadibriketbatubaradanbijihbesi,bijihtimah,bijihemas,bijih
tembaga,bijihnikel,danbijihperaksertabijihbauksit.

(2)

Barangbarang kebutuhan pokok yang sangat dibutuhkan oleh


rakyatbanyak,yaituberas,gabah,jagung,sagu,kedelai,dangaram
baikyangberyodiummaupunyangtidakberyodium,daging,telur,
susu,danbuah.

(3)

Makanan dan minuman yang disajikan di hotel, restoran, rumah


makan, warung, dan sejenisnya, tidak termasuk makanan dan
minumanyangdiserahkanolehjasabogaataucatering.

(4)
b)

Uang,emasbatangan,dansuratsuratberharga.

Pajak penjualan atas barang mewah (PPnBM) adalah pajak yang


dikenakan atas konsumsi barang di dalam daerah pabean yang
berdasarkankeputusanMenteriKeuangantergolongbarangmewah.

2)

SaatPemungutan,TarifdanCaraPemungutanPPNdanPPnBM
a)

SaatPemungutan
PemungutanPPNdanatauPPnBMolehbendaharadilakukanpadasaat
pembayaran kepada rekanan pemerintah, dengan cara pemotongan

184

2014 |Pusdiklatwas BPKP


secara langsung dari tagihan pengusaha kena pajak (PKP) rekanan
pemerintahtersebut.
b)

TarifPPNdanPPnBM
TarifPPNmerupakantariftunggalsebesar10%(berdasarkanperaturan
pemerintahdapatdiubahserendahrendahnya5%dansetinggitingginya
15%). Sementara tarif PPnBM yang berlaku sekarang ini paling rendah
10%danpalingtinggisebesar200%.

c)

DasarPemungutan
Dasar pemungutan PPN dan PPnBM adalah jumlah pembayaran baik
dalam bentuk uang muka, pembayaran sebagian, atau pembayaran
seluruhnyayangdilakukanolehpemungutPPNkepadaPKPrekanan.
Dalamjumlahpembayaranolehpemungutpajaktersebut,termasukPPN
danPPnBMyangterutangtanpamemerhatikanapakahdalamkontrak
menyebutkan ketentuan pemungutan PPN dan atau PPnBM maupun
tidak.

3)

TataCaraPemotongan,PenyetorandanPelaporanPPNdanPPnBM
a)

PKP rekanan wajib menerbitkan faktur PPN dan SSP (khusus SSP
ditandatangani bendahara) pada saat menagih kepada bendahara baik
untuk sebagian maupun seluruh nilai kontrak/SPK pada saat
pembayaran. Apabila atas penyerahan BKP terutang PPnBM, PKP
rekananmencantumkanjumlahnyapadafakturPPN.

b)

PPN/PPnBMyangdipungutolehbendaharapemerintahharusdisetorke
bankpersepsiataukantorposdenganmenggunakanSSPyangtelahdiisi
oleh dan atas nama rekanan serta ditandatangani bendahara paling
lambattujuhharisetelahberakhirnyabulanpembayaran.

c)

Bendahara melaporkan PPN/PPnBM yang dipungut (meskipun nihil)


dengan menggunakan SPT Masa (formulir 1101 PUT) dilampiri faktur

Manajemen Pemerintahan Pusat

185


PPNdanSSPkeKPPdanKPPNtempatbendaharaterdaftarpalinglambat
tanggal20bulantakwimberikutnya.
d)

Dalam hal Bank Pembangunan Daerah (BPD) bertindak sebagai kasir,


faktur pajak PPN/PPnBM dan SSP diteruskan ke BPD melalui
bendaharawanpemerintah.

E.

PROSESPEMBIAYAAN

Menurut UndangUndang Nomor 17 tahun 2003, pembiayaan adalah setiap penerimaan yang
perlu dibayar kembali dan/atau pengeluaran yang akan diterima kembali, baik pada tahun
anggaran yang bersangkutan maupun tahuntahun anggaran berikutnya. Dalam konteks
anggaran pembiayaan dilakukan dalam rangka menutupi defisit anggaran yang terjadi.
Pembiayaan anggaran dilakukan melalui utang dan nonutang. Pembiayaan utang dilakukan
melalui penerbitan Surat Berharga Negara (SBN) serta penarikan pinjaman luar negeri dan
dalam negeri. Sedangkan pembiayaan nonutang dilakukan melalui perbankan dan
nonperbankandalamnegeri.
Berdasarkan penjelasan Pasal 12 (3) UndangUndang Nomor 17 tahun 2003 defisit anggaran
(yang menjadi objek pembiayaan) dibatasi maksimal 3% dari Produk Domestik Bruto (PDB).
Sedangkanjumlahpinjaman(untukmenutupdefisitanggaran)dibatasimaksimal60%dariPDB.
Pembahasanmengenaipembiayanpadamodulinidibatasipadapinjamanyangbersumberdari
pinjamanluarnegeri.
1.

PengertiandanPrinsipPrinsipPinjaman/HibahLuarNegeri
Pinjamanluarnegeriadalahsetiappembiayaanmelaluiutangyangdiperolehpemerintah
dari pemberi pinjaman luar negeri yang diikat oleh suatu perjanjian pinjaman dan tidak
berbentuk surat berharga negara, yang harus dibayar kembali dengan persyaratan
tertentu.
Kegiatankegiatan yang mengandung pinjaman luar negeri atau hibah adalah
kegiatankegiatanyangsebagianatauseluruhkegiatandibiayaipinjaman/hibahtersebut,
dengan persyaratan sesuai ketentuan berlaku. Seluruh pinjaman ataupun hibah luar

186

2014 |Pusdiklatwas BPKP


negeri tersebut harus diadministrasikan dan dicantumkan dalam dokumen anggaran
kegiatanyangbersangkutan.
Tata cara pengadaan serta cara penerusan pinjaman luar negeri diatur dalam Peraturan
Pemerintah Nomor 10 Tahun 2011 tentang Tata Cara Pengadaan Pinjaman Luar Negeri
danPenerimaanHibah.KesepakatantertulismengenaipinjamanantaraPemerintahdan
PemberiPinjamanLuarNegeridituangkandalamPerjanjianPinjamanLuarNegeri.
Pinjamanluarnegeriharusmemenuhiprinsip:

2.

a.

transparan;

b.

akuntabel;

c.

efisiendanefektif;

d.

kehatihatian;

e.

tidakdisertaiikatanpolitik;dan

f.

tidakmemilikimuatanyangdapatmengganggustabilitaskeamanannegara.

SumberdanPenggunaanPinjamanLuarNegeri
Pinjamanluarnegeridapatbersumberdari:
a.

Kreditormultilateral
Kreditor multilateral adalah lembaga keuangan internasional yang beranggotakan
beberapa negara, yang memberi pinjaman kepada pemerintah, misalnya Bank
Dunia, Bank Pembangunan Asia (Asian Development Bank/ADB), Bank
PembangunanIslam(IslamicDevelopmentBank/IDB).

b.

Kreditorbilateral
Kreditorbilateraladalahpemerintahnegaraasingataulembagayangditunjukoleh
pemerintah negara asing atau lembaga yang bertindak untuk pemerintah negara
asingyangmemberipinjamankepadapemerintah.

Manajemen Pemerintahan Pusat

187


c.

Kreditorswastaasing
Kreditorswastaasingadalahlembagakeuanganasing,lembagakeuangannasional,
danlembaganonkeuanganasingyangberdomisilidanmelakukankegiatanusahadi
luar wilayah Negara Republik Indonesia yang memberikan pinjaman kepada
pemerintahberdasarkanperjanjianpinjamantanpajaminandarilembagapenjamin
kreditekspor.

d.

Lembagapenjaminkreditekspor
Lembagapenjaminkrediteksporadalahlembagayangditunjuknegaraasinguntuk
memberikan jaminan, asuransi, pinjaman langsung, subsidi bunga, dan bantuan
keuangan untuk meningkatkan ekspor negara yang bersangkutan atau bagian
terbesar dari dana tersebut dipergunakan untuk membeli barang/jasa dari negara
bersangkutan yang berdomisili dan melakukan kegiatan usaha di luar wilayah
NegaraRepublikIndonesia.

PinjamanLuarNegerimenurutjenisnyaterdiriatas:
a.

Pinjaman tunai, yaitu pinjaman tunai adalah pinjaman luar negeri dalam bentuk
devisa dan/atau rupiah yang digunakan untuk pembiayaan defisit APBN dan
pengelolaanportofolioutang,dan

b.

Pinjaman Kegiatan, yaitu pinjaman kegiatan adalah pinjaman luar negeri yang
digunakanuntukmembiayaikegiatantertentu.

Penggunaanpinjamanluarnegeriyaituuntuk:
a.

membiayaidefisitAPBN;

b.

membiayaikegiatanprioritaskementerian/lembaga;

c.

mengelolaportofolioutang.

d.

diteruspinjamkankepadapemerintahdaerah;

e.

diteruspinjamkankepadaBUMN;dan/atau

f.

dihibahkan

kepada

pemerintah

daerah.

Pemerintah

daerah

dapat

meneruspinjamkandan/ataumenerushibahkanpinjamanluarnegerikepadaBUMD
sesuaidenganketentuanperaturanperundangundangan.

188

2014 |Pusdiklatwas BPKP


3.

TataCaraPenarikanDanaPinjaman/HibahLuarNegeri
Penyaluran dana pinjaman luar negeri dilakukan oleh KPPN Khusus Jakarta VI dan KPPN
KhususBandaAceh,denganprosedursebagaiberikut.
a.

RupiahMurniPorsiGovernmentofIndonesia(GoI)
Pembayaran ini dilakukan sebagai pendamping porsi PHLN, baik dalam bentuk
rupiah maupun valuta asing, sesuai perjanjian pinjamannya. Sumber dana rupiah
porsiGoIberasaldariAPBN.
PencairandananyamenggunakanSP2DporsiGoI.Adapunmekanismepembayaran
GoIadalahsebagaiberikut.
1)

Satker mengajukan SPM kepada KPPN Khusus Jakarta VI disertai dokumen


pendukungyangdiperlukan.

2)

KPPN Khusus Jakarta VI memeriksa kelengkapan, kebenaran dan keabsahan


dokumensebelumditerbitkanSP2Drupiahmurni.

3)

KPPN Khusus Jakarta VI menerbitkan SP2D porsi GoI dan dikirim ke Bank
Indonesia(BI)/bankoperasional(BO).

4)
b.

BI/BOmelakukanpembayarankerekeningpihakketiga.

PembukaanLetterofCredit(L/C)
Penarikan PHLN melalui mekanisme pembukaan L/C diperlukan jika pengadaan
barang/jasadilakukanantarnegaradimanaeksportirselakupenyediabarang/jasadi
luar negeri memerlukan penjaminan pembayaran atas pekerjaan yang mereka
lakukan. Pembukaan L/C untuk pembayaran kegiatan pemerintah, dibatasi hanya
dapatdilaksanakandiBankIndonesia.Dalammekanismeini,BankIndonesiasebagai
penerbit L/C memberikan jaminan pembayaran (sebagai bank penjamin) kepada
bank koresponden di luar negeri (sebagai wakil eksportir dalam melakukan
penagihan) atas prestasi kerja yang telah dilaksanakan oleh eksportir penyedia
barang/jasa.

Manajemen Pemerintahan Pusat

189


Prosedur ini menggunakan Surat Kuasa Membayar atas Beban Rekening Khusus
(SKMRKL/C)danSuratKuasaPembebanan(SKP).
Mekanismepembayarannyaadalahsebagaiberikut.
1)

L/CdenganPembayaranLangsung
a)

Berdasarkan surat permintaan SKP dari satker, KPPN Khusus


menerbitkanSKPkepadaBankIndonesiasebagaidasarpembukaanL/C.

b)

Dengan membuka L/C pada bank koresponden, BI melakukan


pembayaran kepada penjual/eksportir di luar negeri sebesar yang
diminta.

c)

PemberiPHLNmelakukanpembayaranpadabankkorespondendanjuga
mengirimkandebetadvice(DA)/notadebetpadaBI.

d)

BI membuat nota disposisi L/C dan nota debet dan mengirimkan ke


DJPBN(KPPNKhusus).

e)

BerdasarkannotadisposisidannotadebetBI,KPPNKhususmenerbitkan
surat perintah pembukuan/pengesahan (SP3) dan disampaikan kepada
satker dalam rangka sistem akuntansi instansi (SAI) sebagai bahan
pembukuanrealisasiPHLNdalamAPBN.

2)

L/CmelaluiRekeningKhusus
a)

Berdasarkan surat permintaan SKM RKL/C dari satker, KPPN Khusus


menerbitkan surat kuasa membayar (SKM) RKL/C kepada BI sebagai
dasarpembukaanL/C.

b)

Dengan membuka L/C pada bank koresponden, BI melakukan


pembayaran kepada penjual/eksportir di luar negeri sebesar yang
dimintadandibebankanpadarekeningkhususpinjaman.

c)

BI mengirimkan nota disposisi L/C kepada DJPBN (KPPN Khusus Jakarta


VI).

190

2014 |Pusdiklatwas BPKP


d)

BerdasarkannotadisposisidannotadebetBI,KPPNKhususmenerbitkan
SP3 dan disampaikan kepada satker dalam rangka SAI sebagai bahan
pembukuanrealisasiPHLNdalamAPBN.

c.

PembayaranLangsung(DirectPayment)
Penarikan pinjaman dilakukan berdasarkan aplikasi penarikan dana (APD) kepada
pemberipinjaman/hibahluarnegeri(PPHLN)denganpermintaanuntukmembayar
secaralangsungkepadarekeningrekanan.
Prosedur ini menggunakan withdrawal application (WA) untuk pembayaran
langsungdenganmekanismesebagaiberikut.
1)

SatkermengajukanAPDkeKPPNKhususJakartaVIdilengkapidokumenyang
diperlukan.

2)

KPPN Khusus memeriksa kelengkapan, kebenaran dan keabsahan dokumen


APDdanatasdasarAPD,KPPNkhususmenerbitkanWA.

3)

PPHLNmelakukanpembayarankepadarekeningrekanandanmenyampaikan
debitadvice/noticeofdisbursement(NoD)kepadaKPPNKhusus.

4)

Berdasarkan NoD, KPPN Khusus menerbitkan surat perintah pembukuan/


pengesahan (SP3) dan disampaikan kepada satker dalam rangka SAI sebagai
bahanpembukuanrealisasiPHLNdalamAPBN.

d.

PembiayaanPendahuluan
Pembiayaanpendahuluandilakukanuntukaplikasipenarikandana(APD)Loanyang
digunakan untuk pembayaran kembali biayabiaya yang telah dikeluarkan oleh
BUMN.DenganAPDiniPPHLNmenggantikembalidanayangtelahdigunakanpada
rekeningBUMNyangbersangkutan.
Prosedur ini menggunakan withdrawal application (WA) untuk reimbursement,
denganmekanismeberikut.
1)

Satker mengajukan APD reimbursement ke KPPN Khusus Jakarta VI atas


pembiayaanpendahuluanyangtelahdilaksanakan.

Manajemen Pemerintahan Pusat

191


2)

KPPN Khusus menerbitkan WA reimbursement ke PPHLN disertai dokumen


pendukung yang dipersyaratkan PPHLN, selanjutnya PPHLN melakukan
pembayarankembalikerekeningBUMN.

3)

PPHLNmengirimkandebetadvice(DA)/noticeofdisbursement(NoD)keKPPN
Khusus.

4)

Berdasarkan NoD, KPPN Khusus menerbitkan SP3 dan disampaikan kepada


satker dalam rangka SAI sebagai bahan pembukuan realisasi PHLN dalam
APBN.

e.

RekeningKhusus
Rekening khusus adalah rekening yang dibuka untuk menampung sementara dana
pinjaman/hibah. Rekening ini merupakan revolving account dimana PPHLN
melakukan pembayaran di muka (initial deposit) ke rekening khusus di Bank
Indonesiaataubankpemerintahlainyangditunjukmenterikeuangan.
Prosedur pembayaran ini menggunakan SP2D rekening khusus dengan mekanisme
sebagaiberikut.
1)

SatkermengajukanSPMRKkepadaKPPNKhususJakartaVIdisertaidokumen
pendukung.

2)

KPPN Khusus memeriksa kelengkapan, kebenaran dan keabsahan dokumen


tersebutsebelummenerbitkanSP2DRK.

f.

3)

KPPNKhususmenerbitkanSP2DRKdandikirimkeBI.

4)

BImelakukanpembayarankepadarekeningpihakketiga.

KreditEkspor
Kredit ekspor adalah suatu pinjaman dari lembaga keuangan/perbankan suatu
negara yang tujuannya untuk mendorong kegiatan ekspor negara donor sekaligus
membantunegarapeminjam.

192

2014 |Pusdiklatwas BPKP


Pencairan dana dalam prosedur ini menggunakan SP2D porsi rupiah; withdrawal
application (WA); surat kuasa pembebanan (SKP); dan surat kuasa membayar
rekeningkhusus(SKMRKL/C).
Mekanismekrediteksporadalahsebagaiberikut.
1)

LetterofCredit(L/C)
Berdasarkan SPM dari satker, KPPN Khusus Jakarta VI menerbitkan SP2D
(biasanya uang muka 15%). Untuk porsi PHLN (sisanya) mekanisme
pembayaransamadenganprosedurL/C.

2)

PembayaranLangsung
Berdasarkan SPM dari satker, KPPN Khusus Jakarta VI menerbitkan SP2D
(biasanya uang muka 15%). Untuk porsi PHLN (sisanya) mekanisme
pembayaransamadenganprosedurpembayaranlangsung.

g.

PenerusanPinjaman/HibahLuarNegeri(PHLN)
Penerusan pinjaman luar negeri kepada daerah dituangkan dalam Perjanjian
Penerusan Pinjaman Luar Negeri. Perjanjian ini ditandatangani oleh menteri atau
pejabatyangdiberikuasadangubernur,bupati/walikotaataudireksiBUMN.
PinjamanluarnegeriyangdihibahkandituangkandalamPerjanjianHibahPinjaman
Luar Negeri. Perjanjian ini ditandatangani oleh menteri atau pejabat yang diberi
kuasa dan gubernur, bupati/walikota. Perjanjian Penerusan Pinjaman Luar Negeri
danPerjanjianHibahPinjamanLuarNegerimemuatpalingsedikit:
jumlah;
peruntukan;
hakdankewajiban;dan
ketentuan dan persyaratan yang mengacu pada perjanjian pinjaman luar
negeri.

Manajemen Pemerintahan Pusat

193


Penerima Penerusan Pinjaman Luar Negeri wajib melakukan pembayaran
kewajibannya sesuai dengan ketentuan yang diatur dalam Perjanjian Penerusan
PinjamanLuarNegeri.
Hibah yang bersumber dari luar negeri yang diterushibahkan kepada pemerintah
daerah dituangkan dalam perjanjian penerusan hibah yang ditandatangani oleh
menteri atau pejabat yang diberi kuasa dan gubernur atau bupati/walikota, serta
wajibdicatatdalamAPBNdanAPBD.
HibahyangbersumberdariluarnegeriyangdipinjamkankepadaBUMNdituangkan
dalam perjanjian pinjaman hibah yang ditandatangani oleh menteri atau pejabat
yang diberi kuasa dan gubernur, bupati/walikota, atau direksi BUMN. Sedangkan
hibahdan/ataupinjamanhibahkepadabadanusahamilikdaerahdilakukanmelalui
pemerintahdaerah.
h.

PelaksanaanBelanjaDenganDanaPinjaman/HibahLuarNegeri(PHLN)
1)

PencantumanPHLNdalamDIPA
OlehkarenaketentuanpenarikanPHLNberbedaantarayangsatudenganyang
lain, maka untuk pencantuman PHLN dalam DIPA harus memerhatikan
ketentuanketentuan yang diatur dalam loan agreement. Hal itu untuk
menghindari kesalahan dalam pencantuman dana yang dapat menyebabkan
kesalahanpembayaran.

2)

SyaratPencantumanPHLNdalamDIPA
Syaratsyarat yang harus dipenuhi dalam pencantuman PHLN dalam DIPA
sebagaiberikut.
a)

StatusLoanyangJelas
DanaPHLNharusmemilikistatusyangjelas,dalamartinaskahperjanjian
pinjaman/hibahluarnegeri(NPP/HLN)berkenaansudahditandatangani
dandinyatakanefektifsertatelahdiberikoderegisterPHLN.

194

2014 |Pusdiklatwas BPKP


b)

JenisCaraPembayaran
Pada DIPA harus dicantumkan jenis cara pembayaran PHLN, seperti
rekeningkhusus(RK),pembayaranlangsung(PL),danpembukaanletter
ofcredit(LC)sertapenarikanlangsungkhusushibah.

c)

AlokasiDana
UntukmengalokasikandanaPHLNdalamDIPAperludiperhatikanhalhal
sebagaiberikut.
(1)

Jeniskegiatan/pekerjaanyangakandibiayaiharusterdapatdalam
uraiankategoridalamNPP/HLN.

(2)

Dana PHLN untuk setiap kategori pengeluaran masih cukup


tersedia.

(3)

Porsi dana PHLN sesuai kategori yang telah ditetapkan dalam


NPP/HLN.

(4)

Khusus PHLN yang penarikannya melalui tata cara L/C, perlu


diperhatikannilaikontrakpekerjaansecarakeseluruhan.

d)

BiayaAdministrasiKegiatan
Kementerian negara/lembaga wajib memrioritaskan penyediaan dana
pendamping/porsi

rupiah

lainnya

yang

dipersyaratkan

dalam

NPPLN/NPHLN di dokumen pelaksanaan anggaran tahun yang


bersangkutan.
e)

SatuanHarga
Dalam hal dijumpai besaran harga pembiayaan kegiatankegiatan pada
loan agreement atau bagian dari loan agreement (misalnya costtable)
yangmelebihiHSU,HSPKdanbillingrate,makayangdigunakanadalah
besaranyangterdapatdalamHSU,HSPK,danbillingrateatauketentuan
lainyangberlaku.

Manajemen Pemerintahan Pusat

195


3)

PenyediaanDanaLoandanRupiahPendampingdalamDIPA
Berkaitan dengan pengalokasian dana pendamping, maka penyediaan dana
dalamDIPAmengikutiketentuansebagaiberikut.
a)

PHLN

membiayai

pembangunan

fisik,

sedangkan

pemerintah

berkewajiban membiayai penyediaan tanah. Pembangunan gedung


sekolahtidakakandapatterlaksanaapabilatanahbelumtersedia.
b)

Bagi DIPA yang memiliki pinjaman dan hibah luar negeri dengan dana
pendamping,makaloandandanapendampinghanyadisediakanuntuk
keperluan satu tahun anggaran, dan apabila kegiatan/pekerjaannya
harus diselesaikan beberapa tahun (multi years contract) maka
kekurangandanadisediakanpadaDIPAtahunberikutnya.

c)

Jika dana pendamping berasal dari luar APBN, seperti pemda (APBD),
BUMN atau dari kontribusi masyarakat, dan sebagainya, maka
pencantumandanapendampingdimaksuddalamDIPAcukupdilakukan
denganmemberikodeyangtelahditentukandalamaplikasiDIPA.

d)

Khusus untuk kegiatankegiatan baru yang dananya bersumber dari


PHLN namun naskah perjanjiannya masih dalam proses negosiasi, dana
pendampingnya dapat disediakan dari APBN dan atau APBD dengan
memerhatikanhalhalberikutini:
(1)

perencanaanpembiayaanyangmatang;

(2)

rencana perolehan tanah dan penempatan kembali penduduk,


termasuk

rencana

pembiayaan

untuk

tahun

pertama

pekerjaanpekerjaankonstruksi(civilworks)tersusun;
(3)

indikatorindikator untuk menilai tingkat keberhasilan kegiatan


dalam rangka monitoring dan evaluasi, termasuk tersedianya
databasekegiatantersedia;

(4)

sistem pengadaan barang/jasa dan manajemen keuangan,


termasuksistemauditnyatersusun;

196

2014 |Pusdiklatwas BPKP


(5)

usulanusulan (proposal) jasa konsultan, dan dokumendokumen


tender (baik untuk pengadaan barang maupun pekerjaan
konstruksi)untuktahunpertamapelaksanaankegiatan;

(6)

project management unit (PMU)/project implementing unit (PIU)


sudah terbentuk waktu negosiasi dan telah dilengkapi dengan
staf/personalia,rencanakegiatandandanapersiapankegiatan.

4)

PengadaanBarang/JasadenganPHLN
Pengadaan barang dan jasa dengan sumber dana PHLN, selain harus
memerhatikan syarat yang ditentukan oleh pemberi pinjaman/hibah, juga
harusmengikutiketentuansebagaiberikut.
a)

Perjanjian/kontrak pelaksanaan pekerjaan untuk masa lebih dari satu


tahun anggaran atas beban anggaran dilakukan setelah mendapat
persetujuanmenterikeuangan.

b)

Perjanjian/kontrakyangdibiayaisebagianatauseluruhnyadenganPHLN
untuk masa lebih dari satu tahun anggaran tidak memerlukan
persetujuanmenterikeuangan.

c)

Perjanjian/kontrak yang dibiayai sebagian maupun seluruhnya dengan


PHLNuntukmasapelaksanaanpekerjaanmelebihisatutahunanggaran,
makadidalamperjanjian/kontraktersebutharusmencantumkantahun
anggaranpembebanandana.

d)

Perjanjian/kontrakdalambentukvalutaasingtidakdapatdiubahdalam
bentuk rupiah dan sebaliknya kontrak dalam bentuk rupiah tidak dapat
diubahdalambentukvalutaasing.

e)

Perjanjian/kontrak dalam bentuk valuta asing tidak dapat membebani


danarupiahmurni.

f)

Perjanjian/kontrak untuk pengadaan barang dan jasa di dalam negeri


tidakdapatdilakukandalambentukvalutaasing.

Manajemen Pemerintahan Pusat

197


g)

Perjanjian/kontrak

dengan

dana

kredit

ekspor

yang

sudah

ditandatangani tidak dapat dilaksanakan apabila naskah perjanjian


pinjamanluarnegeri(NPPLN)belumditandatangani.
h)

Pengecualian terhadap ketentuan mata uang yang digunakan (d, e, f)


harus mendapat persetujuan dari Menteri Keuangan RI c.q. Direktur
JenderalAnggaran.

Untukmenghindariterjadinyakegiatankegiatanyangtidakmemenuhisyarat
(ineligible),makaisidariloanagreement(NPPHLN)danstaffappraisalreport
(SAR)harusdipahami,terutamamengenai:

i.

a)

porsibebanloanuntukmasingmasingkegiatan/kategori;

b)

kegiatankegiatanyangdapatdibiayailoan;

c)

tanggalclosingdate;

d)

lokasisasaran/cakupankegiatan;

e)

ketentuanloanlainnyajikaada(carapembayaran,dansebagainya).

PencairanAnggaranBelanjaDariPinjaman/HibahLuarNegeri(PHLN)
Uraian berikut ini sangat bersifat umum dan lebih menekankan pada mekanisme
pembayaran uang persediaan untuk SP2DPHLN, sedangkan mengenai persyaratan
pembayaran atas suatu pinjaman pengaturannya ditetapkan oleh donor serta
aturanaturankhususlainnya,KPPN,danpihaklainyangterkait.
Penyediaan dana uang persediaan untuk dana yang berasal dari pinjaman luar
negeridiatursebagaiberikut.
1)

PembayaranolehKPPNKCBI
PembayaranolehKPPNyangberkedudukandikotayangsamadenganKantor
Cabang Bank Indonesia (KCBI) dan pemegang rekening kas negara pada KCBI
yangbersangkutan.

198

2014 |Pusdiklatwas BPKP


2)

PembayaranolehKPPNnonKCBI
Pembayaran oleh KPPN yang di tempat kedudukannya tidak terdapat KCBI.
Pada prinsipnya ketentuan pembebanan oleh KPPN KCBI maupun KPPN
nonKCBIadalahsama.
Perbedaan terdapat pada prosedur pembebanan SP2DPHLN ke rekening
khusus,yaituSP2DPHLNyangditerbitkanolehKPPNnonKCBItidaklangsung
diperhitungkandenganrekeningkhususberkenaanmelainkanKPPNnonKCBI
harusmembuatSuratPerintahPembebanan(SPBSP2D).

F.

PENGELOLAANASETDANUTANG

Aset merupakan sumber daya yang mutlak diperlukan dalam penyelenggaraan pemerintahan.
Asetmerupakansumberdayaekonomiyangdimilikidan/ataudikuasaiolehpemerintahsebagai
akibatdariperistiwamasalaludandarimanamanfaatekonomidan/atausosialdimasadepan
diharapkan dapat diperoleh, baik oleh pemerintah maupun masyarakat, serta dapat diukur
dalam satuan uang, termasuk sumber daya nonkeuangan yang diperlukan untuk penyediaan
jasabagimasyarakatumumdansumbersumberdayayangdipeliharakarenaalasansejarahdan
budaya.
Pengertian aset seperti tersebut di atas mencerminkan bahwa ruang lingkup aset pemerintah
sangatlah luas. Aset pemerintah dapat diklasifikasikan sebagai aset keuangan dan aset
nonkeuangan. Aset keuangan mencakup kas, piutang, dan investasi. Aset nonkeuangan ada
yangdapatdiidentifikasidanadayangtidakdapatdiidentifikasi.Asetnonkeuanganyangdapat
diidentifikasiberupaasetberwujuddanasettidakberwujud.Asetberwujudberupapersediaan
danasettetap,yangdalamperaturanperundangundanganlebihdikenaldengannamaBarang
MilikNegara(BMN).Asetyangtidakteridentifikasidapatberupasumberdayaalamdansumber
dayamanusia.Baganasetpemerintahdapatdilihatpadagambarberikut.

Manajemen Pemerintahan Pusat

199


Gambar5.10BaganAsetPemerintah

Kas&Setara
Kas
AsetKeuangan
&Utang

Piutang &
Utang
Investasi
Persediaan

Aset
Pemerintah

Berwujud
Dapat
Diidentifikasi
Aset
NonKeuangan

AsetTetap
Tidak
Berwujud
SDA

TidakDapat
Diidentifikasi

SDM
Dll.

Bagian berikut ini menguraikan tentang pengelolaan unsurunsur aset pemerintah, baik aset
keuanganmaupunnonkeuangan.
1.

PengelolaanKas
Pengelolaan kas terutama bertujuan untuk dapat melaksanakan anggaran secara efisien
sertamelakukanmanajemensumberdayakeuanganyangbaik.Pengelolaankasyangbaik
dapat menghasilkan pengendalian pengeluaran secara efisien, meminimumkan biaya
pinjaman, dan memaksimumkan hasil yang diperoleh dari penempatan kas. Hal ini
dilakukanmelalui:
a.

perencanaankas(cashplanning)danperencanaankebutuhankas(cashforecasting);

b.

memperpendekwaktuyangdiperlukanuntukpenagihandanpembayarandilakukan
secaratepatwaktu(floatmanagement);

c.

manajemenrekeningbankdenganmelakukanpemusatansaldokas(TreasurySingle
Account/TSA);

200

2014 |Pusdiklatwas BPKP


d.

pembentukan dana kas kecil dengan sistem dana tetap (imprest fund) untuk
membiayaikeperluanseharihariperkantoran;dan

e.

penempatan saldo kas yang belum digunakan dalam bentuk setara kas atau
penanamansementara(temporaryinvestment).

Pengelolaankasdilakukanuntukmemeliharaketersediankaspadalevelyangideal.Dalam
halterjadikekurangankas,BendaharaUmumNegaradapatmelakukanpinjamanbaikdari
dalam maupun luar negeri dan/atau menjual atau menerbitkan Surat Utang Negara,
dan/ataumenjualsuratberhargalainnyasesuaidenganketentuanPeraturanPerundang
undangan.
Sebaliknya, dalam hal terjadi kelebihan kas, Bendahara Umum Negara setelah
berkoordinasi dengan Gubernur Bank Sentral dapat menempatkan Uang Negara pada
rekeningdiBankSentral/BankUmumyangmenghasilkanbunga/jasagirodengantingkat
bunga yang berlaku. Penempatan Uang Negara pada Bank Umum dilakukan dengan
memastikanbahwaBendaharaUmumNegaradapatmenarikuangtersebutsebagianatau
seluruhnyakeRekeningKasUmumNegarapadasaatdiperlukan.Kelebihankasjugadapat
digunakanuntukpembeliankembaliSuratUtangNegara(SUN).
Pada dasarnya, pemerintah harus dapat menjamin ketersediaan dana yang diperlukan
secaratepatwaktudanamandalamrangkapelaksanaananggaran.Agarkastersediapada
saatdiperlukanmakaperluadanyarencanapenarikandanadanrencanapenerimaandari
penggunaanggaran.Darirencanainidapatdisusunanggarankassehinggadapatdiketahui
jumlaharusmasukdanaruskeluarkasuntuksuatuperiodesertasurplus/defisitkasyang
terjadi.BerdasarkaninformasidemikianmakaBendaharaUmumNegaradapatmengatur
penempatan saldo kas yang menganggur serta menerapkan strategi pinjaman untuk
menutupdefisitkas.
Dalam kaitan manjemen kas, berdasarkan ketentuan UU Nomor 1 Tahun 2004 Satker
diharuskan mencantumkan rencana penarikan dana dan perkiraan penerimaan pada
dokumen pelaksanaan anggaran (DIPA halaman 3) dalam format bulanan. Rencana
tersebutmenjadibagiandarirevisiDIPApadasaatterjadiperubahan(updating)rencana
penarikan dana dan perkiraan penerimaan. Hal ini untuk mengantisipasi kebutuhan
penyediaandanasecaratepatwaktudanamandalampelaksanaananggaran.

Manajemen Pemerintahan Pusat

201


2.

PengelolaanPiutang
Piutang merupakan hak pemerintah untuk menagih pada pihak lain. Piutang ini dapat
terjadikarenahubunganperdata,sepertiadanyajualbeliataupinjammeminjam,namun
bisa juga terjadi karena ketentuan perundangundangan, seperti piutang pajak. Dalam
undangundang diatur bahwa kementerian/lembaga yang mempunyai piutang wajib
mengupayakan penerimaannya kembali secara tepat waktu. Dalam hal terdapat piutang
taktertagihpenyelesaiannyadilakukansesuaidenganperaturanperundangundangan.
Dalam rangka menjaga agar piutang dapat diterima kembali secara tepat waktu,
kementerian/lembagadituntutuntukmengaturberbagaihalyangterkaitdenganpiutang
secaraseksama.Halhalsepertiperencanaan,pemberianpinjamanataupenjualansecara
kreditataupenerbitansuratketetapan,pencatatan,pelaporan,penilaian,penagihan,dan
penghapusanpiutangharusdiatursecarategas.Pengendalianinternharustercermindan
melekat sejak proses terjadinya piutang sampai dengan berakhirnya piutang karena
pembayaranataupenghapusan.
Piutang pemerintah jenis tertentu, seperti piutang pajak, mempunyai hak mendahului.
Penyelesaianpiutangyangterjadikarenahubungankeperdataandapatdilakukanmelalui
perdamaian kecuali untuk piutang yang penyelesaiannya diatur sendiri dalam undang
undang. Dalam hal terdapat piutang tak tertagih dapat dihapuskan secara mutlak atau
bersyarat dari pembukuan. Kewenangan penyelesaian piutang bermasalah/penghapusan
piutangadalahsebagaiberikut:
Tabel5.1KewenanganPenyelesaianPiutangBermasalah/PenghapusanPiutang

No

3.

PenyelesaianPiutangBermasalah/
PenghapusanPiutang

NilaiPiutang

1.

10miliar

MenteriKeuangan

2.

>10miliar100miliar

Presiden

3.

>100miliar

PresidendenganpersetujuanDPR

PengelolaanUtang
Sehubungan dengan diberlakukannya anggaran defisit (I Account) berarti anggaran
pendapatantidakharussamadengananggaranbelanja.DalamUndangUndangNomor17
Tahun 2003 ditekankan bahwa dalam memanfaatkan surplus anggaran atau membiayai

202

2014 |Pusdiklatwas BPKP


defisitanggaranharusmempertimbangkankeseimbanganantargenerasi.Defisitanggaran
antara lain dapat dibiayai dari pinjaman. Berdasarkan UndangUndang Nomor 17 Tahun
2003 defisit anggaran dalam suatu tahun anggaran maksimum sebesar 3% dari Produk
Domestik Bruto (PDB), dan akumulasi utang maksimum sebesar 60% dari PDB. Dalam
rangka pengendalian defisit anggaran dan akumulasi pinjaman secara nasional, Menteri
Keuangan mempunyai kewenangan untuk mengaturnya. Ketentuan tentang besarnya
defisitsertajumlahutangyangdapatdimilikiolehsuatupemerintahdaerahdiatursetiap
tahundenganPeraturanMenteriKeuangan.
Menteri Keuangan selaku Bendahara Umum Negara mempunyai kewenangan untuk
mengadakanpinjaman.Pinjamandapatberupapinjamanyangdilakukansecarabilateral
atau multilateral. Pinjaman ini dapat diteruspinjamkan kepada pemerintah
daerah/BUMN/BUMD.Pinjamaninidituangkandalamsuatunaskahperjanjianpinjaman.
Sejalandenganasasbrutomakabiayayangterjadikarenapenarikanpinjamandibebankan
padaanggaranbelanja.Disampingitu,pemerintahjugadapatmenerbitkanSuratUtang
Negara(SUN).
Selain ada utang yang berasal dari pinjaman, pemerintah juga bisa mempunyai utang
karenakegiatanoperasionalatauutangPerhitunganPihakKetiga(PFK).Utangoperasional
antaralaintimbulsehubungandenganadanyapengadaanbarang/jasayangtelahditerima
tetapi pada akhir tahun anggaran belum dibayar. Dengan demikian, utang yang berasal
dari kegiatan operasional ini dapat terjadi di kementerian negara/lembaga. Utang PFK
timbulkarenaadanyauangyangdipungutolehpemerintahuntukkepentinganpihaklain
dan belum disampaikan kepada pihak tersebut. Terhadap utangutang ini, pengguna
anggaranataukuasapenggunaanggaranjugawajibmenatausahakandanmelaporkannya
dalam laporan keuangan. Pengguna anggaran atau kuasanya berkewajiban mengelola
utang dalam kepengurusannya dan menguji setiap klaim sebelum memerintahkan
pembayaranatasbebananggarannegara.
Utangdibayarsecaratepatwaktusesuaidenganketentuan.Haktagihatasutangsebagai
beban negara kedaluwarsa setelah 5 (lima) tahun sejak utang tersebut jatuh tempo,
kecuali ditetapkan lain dalam undangundang. Kedaluwarsa ini akan tertunda jika pihak
yang berpiutang mengajukan tagihan kepada negara sebelum berakhirnya masa
kedaluwarsa. Ketentuan kedaluwarsa ini tidak berlaku untuk pembayaran bunga dan
pokokutangyangtimbulkarenapinjaman.

Manajemen Pemerintahan Pusat

203


4.

PengelolaanPersediaan
Persediaanadalahasetlancardalambentukbarangatauperlengkapanyangdimaksudkan
untuk mendukung kegiatan operasional pemerintah, dan barangbarang yang
dimaksudkan untuk dijual dan/atau diserahkan dalam rangka pelayanan kepada
masyarakat.
Secaraumumpersediaanmerupakanasetyangberwujudyangmeliputi:
a.

Barang atau perlengkapan (supplies) yang digunakan dalam rangka kegiatan


operasionalpemerintah;

b.

Bahanatauperlengkapan(supplies)yangdigunakandalamprosesproduksi;

c.

Barang dalam proses produksi yang dimaksudkan untuk dijual atau diserahkan
kepadamasyarakat;

d.

Barang yang disimpan untuk dijual atau diserahkan kepada masyarakat dalam
rangkakegiatanpemerintahan.

e.

Barangatauperlengkapanyangdibelidandisimpanuntukdigunakan,misalnya:
baranghabispakaisepertialattuliskantor
barangtakhabispakaisepertikomponenperalatandanpipa
barangbekaspakaisepertikomponenbekas

Dalam rangka pemberian pelayanan kepada masyarakat diperlukan pengendalian


persediaan (inventory controll) agar tercapai jumlah yang ideal. Tujuan utama dari
pengendalian persediaan adalah agar perusahaan selalu mempunyai persediaan dalam
jumlah yang tepat, pada waktu yang tepat, dan dalam spesifikasi atau mutu yang telah
ditentukansehinggakontinuitaspelayanandapatterjamin(tidakterganggu).Usahauntuk
mencapaitujuantersebuttidakterlepasdariprinsipprinsipekonomi,yaitujangansampai
biayabiayayangdikeluarkanterlalutinggi.Baikpersediaanyangterlalubanyak,maupun
terlalu sedikit akan minimbulkan membengkaknya biaya persediaan. Jika persediaan
terlalubanyak,makaakantimbulbiayabiayayangdisebutcarryingcost,yaitubiayabiaya
yang terjadi karena kepemilikan persediaan yang banyak, seperti : biaya yang tertanam
dalampersediaan,biayamodal(termasukbiayakesempatanpendapatanatasdanayang

204

2014 |Pusdiklatwas BPKP


tertanamdalampersediaan),sewagudang,biayaadministrasipergudangan,gajipetugas
pergudangan, biaya asuransi, biaya pemeliharaan persediaan, biaya kerusakan/
kehilangan,danlainlain.
Begitujugaapabilapersediaanterlalusedikitakanmenimbulkanbiayaakibatkekurangan
persediaan yang biasa disebut stock out cost seperti: mahalnya harga karena membeli
dalamjumlahkecildanmendesaksertaterganggunyapelayanankepadamasyarakat.
Selain terkait jumlah penyediaannya, pengendalian persediaan juga mencakup aspek
pengamanandanakuntabiltasnya.Dalamkaitaninipengendalianpersediaandilaksanakan
oleh Unit Akuntansi Kuasa Pengguna Barang (UAKPB) sesuai dengan PMK Nomor
171/PMK.05/2007 tentang Sistem Akuntansi dan Pelaporan Keuangan Pemerintah Pusat
dan PMK Nomor 97/PMK.06/2007 tentang Penggolongan dan Klasifikasi Barang Milik
Negara.
5.

PengelolaanInvestasi
Berdasarkan Peraturan Pemerintah Nomor 1 Tahun 2008 tentang Investasi Pemerintah,
yangdimaksuddenganinvestasipemerintahadalahpenempatansejumlahdanadan/atau
barang dalam jangka panjang untuk investasi pembelian surat berharga dan investasi
langsung untuk memperoleh manfaat ekonomi, sosial, dan/atau manfaat lainnya.
Kewenangan pengelolaan investasi pemerintah dilaksanakan oleh Menteri Keuangan
selaku Bendahara Umum Negara yang meliputi kewenangan regulasi, supervisi, dan
operasional.
Pemerintahdapatmelakukaninvestasikarenaberbagaialasan,antaralainmemanfaatkan
surplus anggaran untuk memperoleh pendapatan atau memanfaatkan dana yang belum
digunakandalambentukinvestasijangkapendekdalamrangkamanajemenkas.Investasi
jangka pendek yang dilakukan pemerintah harus memenuhi karakteristik dapat segera
dicairkan,ditujukandalamrangkamanajemenkas,danberisikorendah.
Investasi jangka panjang dapat berupa investasi permanen dan investasi nonpermanen.
Investasiinidapatdilakukanolehpemerintahmelaluipasarmodalatauinvestasilangsung
pada bidang usaha tertentu. Investasi melalui pasar modal dapat dilakukan dengan
membelisahamatausuratutang.Investasiyangdilakukanolehpemerintahtidaksemata

Manajemen Pemerintahan Pusat

205


matabertujuanuntuk memperolehmanfaatekonomi,sepertidiperolehnyakeuntungan,
tetapibisajugakarenadiperolehnyamanfaatsosial,ataumanfaatlainnya.
Investasipermanenmerupakaninvestasijangkapanjangyangdimaksudkanuntukdimiliki
secara berkelanjutan, misalnya penyertaan modal pemerintah pada BUMN. Investasi
nonpermanen adalah investasi jangka panjang yang dimaksudkan untuk dimiliki secara
tidak berkelanjutan. Dengan demikian investasi nonpermanen ini dimaksudkan akan
dicairkankembalisuatusaat,misalnyadanabergulir.
6.

PengelolaanBarangMilikNegara(BMN)
BMNmencakupsemuabarangyangdibeliataudiperolehatasbebanAPBNatauberasal
dari perolehan lainnya yang sah. Perolehan BMN antara lain dapat dilakukan melalui
pembelian, pembangunan, pertukaran, kerja sama, hibah/sumbangan, dan perolehan
berdasarkanperaturanperundangan/putusanpengadilan(rampasan).
Dalam rangka menertibkan pengelolaan BMN, maka dilakukan pembagian kewenangan
yang jelas atas BMN. Menteri Keuangan sebagai pengelola barang berwenang mengatur
pengelolaan BMN berdasarkan peraturan perundangundangan yang meliputi
penggunaan, pemanfaatan, pemindahtanganan, dan penghapusan. Sedangkan
menteri/pimpinan lembaga berkedudukan sebagai pengguna barang pada instansi yang
dipimpinnya. Para pengguna barang wajib mengelola dan menatausahakan BMN yang
berada dalam penguasaannya dengan sebaikbaiknya. Lingkup pengelolaan BMN pada
instansipenggunasebagaimanapadaGambar5.11berikut.

206

2014 |Pusdiklatwas BPKP


Gambar5.11LingkupPengelolaanBMN

Dalam rangka menjaga kesinambungan pelayanan kepada masyarakat, dilakukan


pengaturan atas penghapusan serta pemindahtanganan BMN. BMN yang diperlukan
dalam penyelenggaraan tugas pemerintahan tidak dapat dipindahtangankan.
Penghapusan maupun pemindahtanganan BMN pada prinsipnya harus mendapat
persetujuan DPR. Namun dengan pertimbangan efisiensi pengelolaan tanpa
mengesampingkan pengamanannya, dibuat variasi agar kewenagan tersebut tidak
terpusatdiDPR,denganketentuansebagaimanaTabel5.2.

Manajemen Pemerintahan Pusat

207


Tabel5.2KewenanganPenghapusan/PemindahtangananBMN

No

JenisdanNilaiBMN

PihakBerwenang

1.

Tanah/bangunan
(nilaitidakterbatas)

DPR

2.

SelainTanahdanBangunan:
Rp10miliar
>Rp10miliarRp100miliar
>Rp100miliar

MenteriKeuangan
Presiden
PresidendenganpersetujuanDPR

Apabilapemindahtangananinidilakukandenganpenjualanmakaharusdilakukandengan
lelang. Dengan pengaturan demikian diharapkan pengelolaan barang dapat dilakukan
denganlebihefisien.
Pengamananbarangmiliknegaramerupakansalahsatusasaranpengendalianintern,baik
dariaspekfisik,administrasi,maupunhukum.Olehkarenaitu,tanahdanbangunanharus
dilengkapi dengan bukti kepemilikan dan ditatausahakan dengan tertib. Tanah harus
disertifikatkanatasnamaPemerintahRI.Tanahdanbangunanyangtidaklagidigunakan
untuk menjalankan tugas dan fungsi pemerintahan wajib dikembalikan kepada Menteri
Keuangan. BMN tidak diperkenankan untuk digadaikan atau digunakan sebagai jaminan
dantidakbolehdiserahkankepadapihaklainsebagaipembayaranutang.Disampingitu,
BMNataubarangpihaklainyangdikuasainegarayangdiperlukanuntukpenyelenggaraan
tugaspemerintahantidakdapatdisita.
PengelolaanBMNmengacupadaketentuanperundanganantaralainsebagaiberikut:
a.

PPNomor6Tahun2006jo.PPNomor38Tahun2008tentangPengelolaanBarang
MilikNegara/Daerah;

b.

PMK Nomor 96/PMK.06/2007 tentang Tata Cara Pelaksanaan Penggunaan,


Pemanfaatan,Penghapusan,danPemindahtangananBMN;dan

c.

PMKNomor120/PMK.06/2007tentangPenatausahaanBMN.

208

2014 |Pusdiklatwas BPKP


G.

KETENTUANPIDANA,SANKSIADMINISTRASI,DANGANTIRUGI

1.

KetentuanPidanadanSanksiAdministrasi
Sebagaikonsekuensidaripertanggungjawabanpengelolaankeuangannegara,baikdalam
UndangUndang Nomor 17 Tahun 2003 tentang Keuangan Negara, UndangUndang
Nomor 1 Tahun 2004 tentang PerbendaharaanNegara,maupun UndangUndang Nomor
15Tahun2004tentangPemeriksaanPengelolaandanTanggungJawabKeuanganNegara,
diaturmengenaiketentuanpidana,sanksiadministratif,dangantirugiyangberlakubagi
menteri/pimpinan lembaga serta pimpinan unit organisasi kementerian negara/lembaga
yangterbuktimelakukanpenyimpangankebijakan/kegiatanyangtelahditetapkandalam
undangundang. Hal yang sama juga diberlakukan terhadap para bendahara yang dalam
pengurusan uang/barang yang menjadi tanggung jawabnya telah melakukan perbuatan
melawanhukumyangberakibatmerugikankeuangannegara.
Penyelesaian kerugian negara perlu segera dilakukan untuk mengembalikan kekayaan
negara yang hilang/berkurang serta meningkatkan disiplin dan tanggung jawab para
pegawai negeri/ pejabat negara pada umumnya, dan para pengelola keuangan pada
khususnya melalui pemberian sanksi. Sanksi tersebut dimaksudkan sebagai upaya
preventif dan represif, serta berfungsi sebagai jaminan atas ditaatinya undangundang
tentangAPBNyangbersangkutan.
Dalam UndangUndang Nomor 17 Tahun 2003 tentang Keuangan Negara, hal mengenai
ketentuan pidana, sanksi administrasi, dan ganti rugi diantaranya diatur dalam pasal 34
dan35sebagaiberikut.
a.

Menteri/pimpinanlembagayangterbuktimelakukanpenyimpangankebijakanyang
telah ditetapkan dalam undangundang tentang APBN diancam dengan pidana
penjara dan denda sesuai dengan ketentuan undangundang. Kebijakan dimaksud
tercermin pada manfaat/hasil yang harus dicapai dengan pelaksanaan fungsi dan
programkementeriannegara/lembagayangbersangkutan.

b.

Pimpinan unit organisasi kementerian negara/lembaga yang terbukti melakukan


penyimpangan kegiatan anggaran yang telah ditetapkan dalam undangundang
tentangAPBNdiancamdenganpidanapenjaradandendasesuaidenganketentuan
undangundang.

Manajemen Pemerintahan Pusat

209


c.

Presiden memberi sanksi administratif sesuai dengan ketentuan undangundang


kepada pegawai negeri serta pihakpihak lain yang tidak memenuhi kewajibannya
sebagaimanaditentukandalamundangundangini.

d.

Setiappejabatnegaradanpegawainegeribukanbendaharayangmelanggarhukum
atau melalaikan kewajibannya baik langsung atau tidak langsung yang merugikan
keuangannegaradiwajibkanmenggantikerugiandimaksud.

e.

Setiapbendaharabertanggungjawabsecarapribadiataskerugiankeuangannegara
yangberadadalampengurusannya.

2.

PejabatyangBerhakMengenakanSanksi
Dalam hal pejabat yang melakukan kerugian negara adalah menteri/pimpinan lembaga,
suratkeputusanpembebananpenggantiankerugiansementaradimaksudditerbitkanoleh
Menteri Keuangan selaku Bendahara Umum Negara. Dalam hal pejabat yang melakukan
kerugian negara adalah Menteri Keuangan, surat keputusan pembebanan penggantian
kerugiansementaradimaksudditerbitkanolehPresiden.
PengenaangantikerugiannegaraterhadapbendaharaditetapkanolehBadanPemeriksa
Keuangan. Apabila dalam pemeriksaan kerugian negara ditemukan unsur pidana, Badan
PemeriksaKeuanganmenindaklanjutinyasesuaidenganperaturanperundangundangan
yang berlaku yaitu menyampaikan hasil pemeriksaan tersebut beserta buktibuktinya
kepada instasi yang berwenang. Pengenaan ganti kerugian negara terhadap pegawai
negeribukanbendaharaditetapkanolehmenteri/pimpinanlembaga.Tatacaratuntutan
gantikerugiannegaradiaturdenganperaturanpemerintah.

3.

PenyelesaianKerugianNegara
Penyelesaian kerugian negara/daerah dalam UndangUndang Nomor 1 Tahun 2004
tentang Perbendaharaan Negara diatur dalam pasal 59 sampai dengan pasal 67. Materi
pokokyangdiaturdalamketentuantersebutadalahsebagaiberikut.
a.

Setiap kerugian negara yang disebabkan oleh tindakan melanggar hukum atau
kelalaian seseorang harus segera diselesaikan sesuai dengan ketentuan
perundanganundangan yang berlaku. Kerugian negara dapat terjadi karena
pelanggaran hukum atau kelalaian pejabat negara atau pegawai negeri bukan

210

2014 |Pusdiklatwas BPKP


bendahara dalam rangka pelaksanaan kewenangan administratif atau oleh
bendaharadalamrangkapelaksanaankewenangankebendaharaan.
b.

Bendahara, pegawai negeri bukan bendahara, atau pejabat lain yang karena
perbuatannya melanggar hukum atau melalaikan kewajiban yang dibebankan
kepadanya secara langsung merugikan keuangan negara wajib mengganti kerugian
tersebut.
Pejabat lain dimaksud meliputi pejabat negara dan pejabat penyelenggara
pemerintahan yang tidak berstatus pejabat negara, tidak termasuk bendahara dan
pegawainegeribukanbendahara.

c.

Setiap pimpinan kementerian negara/lembaga/kepala satuan kerja dapat segera


melakukan tuntutan ganti rugi, setelah mengetahui bahwa dalam kementerian
negara/lembaga/satuankerjayangbersangkutanterjadikerugianakibatperbuatan
daripihakmanapun.

Tatacarapengenaangantirugiberbedaantarapegawainegeribukanbendaharadengan
bendahara,sebagaimanadiuraikansebagaiberikut.
a.

PengenaanGantiRugiTerhadapPegawaiNegeriBukanBendahara
Pengenaan ganti rugi terhadap pegawai negeri bukan bendahara ditetapkan oleh
menteri/pimpinan lembaga/gubernur/bupati/walikota. Tata cara tuntutan ganti
kerugian negara/daerah diatur dengan peraturan pemerintah, yang sampai saat
modul ini selesai disusun peraturan pemerintah tersebut belum ada. Pokokpokok
yang telah diatur dalam UndangUndang Nomor 1 Tahun 2004 adalah sebagai
berikut.
1)

Setiap kerugian negara wajib dilaporkan oleh atasan langsung atau kepala
kantor kepada menteri/pimpinan lembaga dan diberitahukan kepada BPK
selambatlambatnyatujuhharikerjasetelahkerugiannegaraitudiketahui.

2)

Segera setelah kerugian negara tersebut diketahui, kepada bendahara,


pegawai negeri bukan bendahara, atau pejabat lain yang nyatanyata
melanggar hukum atau melalaikan kewajibannya, segera dimintakan surat
pernyataan kesanggupan dan atau pengakuan bahwa kerugian tersebut

Manajemen Pemerintahan Pusat

211


menjadi tanggung jawabnya dan bersedia mengganti kerugian negara
dimaksud. Surat pernyataan tersebut biasa disebut Surat Pernyataan
TanggungJawabMutlak(SKTM).
3)

Jika Surat Keterangan Tanggung Jawab Mutlak tidak mungkin diperoleh atau
tidak dapat menjamin pengembalian kerugian negara, menteri/pimpinan
lembaga yang bersangkutan segera menetapkan Surat Keputusan
Pembebanan Penggantian Kerugian Sementara yang ditujukan kepada yang
bersangkutan.Suratkeputusandimaksudmempunyaikekuatanhukumuntuk
pelaksanaansitajaminan(conservatoirbeslaag).

b.

PengenaanGantiRugiTerhadapBendahara
DalamUndangUndangNomor1Tahun2004TentangPerbendaharaanNegarapasal
62dinyatakanbahwapengenaangantikerugiannegara/daerahterhadapbendahara
ditetapkan oleh BPK dan apabila dalam pemeriksaan tersebut ditemukan unsur
pidana, BPK menindaklanjutinya sesuai dengan peraturan perundangundangan
yang berlaku, yaitu menyampaikan hasil pemeriksaan tersebut beserta bukti
buktinyakepadainstansiyangberwenang.
Ketentuan lebih lanjut mengenai pengenaan ganti kerugian negara terhadap
bendahara diatur dalam UndangUndang Nomor 15 Tahun 2004 tentang
PemeriksaanPengelolaandanTanggungJawabKeuanganNegaramulaipasal22dan
pasal23,denganuraiansebagaiberikut.
1)

BPK

menerbitkan

surat

keputusan

penetapan

batas

waktu

pertanggungjawaban bendahara atas kekurangan kas/barang yang terjadi,


setelah mengetahui ada kekurangan kas/barang dalam persediaan yang
merugikan keuangan negara/ daerah. Surat keputusan dimaksud diterbitkan
apabila belum ada penyelesaian yang dilakukan sesuai dengan tata cara
penyelesaiangantikerugiannegarayangditetapkanolehBPK.
2)

Bendahara dapat mengajukan keberatan atau pembelaan diri kepada BPK


dalam waktu 14 hari kerja setelah menerima surat keputusan sebagaimana
dimaksudpadahurufa)diatas.

212

2014 |Pusdiklatwas BPKP


3)

Apabila bendahara tidak mengajukan keberatan atau pembelaan dirinya


ditolak,BPKmenetapkansuratkeputusanpembebananpenggantiankerugian
negara/daerahkepadabendaharabersangkutan.Pembelaandiriditolakoleh
BPK apabila bendahara tidak dapat membuktikan bahwa dirinya bebas dari
kesalahan,kelalaian,ataukealpaan.

4)

Tata cara penyelesaian ganti kerugian negara/daerah terhadap bendahara


ditetapkanolehBPKsetelahberkonsultasidenganpemerintah.

5)

Tatacarapenyelesaiangantikerugiansebagaimanadimaksudpadahurufd)di
atasberlakupulabagipengelolaperusahaanumumdanperusahaanperseroan
yangseluruhataupalingsedikit51%sahamnyadimilikiolehNegaraRepublik
Indonesia,sepanjangtidakdiaturdalamundangundangtersendiri.

6)

Menteri/pimpinan lembaga/gubernur/bupati/walikota/direksi perusahaan


negara dan badanbadan lain yang mengelola keuangan negara melaporkan
penyelesaian kerugian negara/daerah kepada BPK selambatlambatnya 60
(enam puluh) hari setelah diketahui terjadinya kerugian negara/daerah
dimaksud.

7)

BPK memantau penyelesaian pengenaan ganti kerugian negara/daerah


terhadap pegawai negeri bukan bendahara dan/atau pejabat lain pada
kementeriannegara/lembaga/pemerintahdaerah.

4.

KetentuanLainyangBerkaitanPengenaanGantiKerugianNegara
Di samping ketentuanketentuan pokok tersebut di atas, ada beberapa ketentuan lain
yangberlakuumumbaikuntukpengenaangantikerugiannegarabagipejabatnegaradan
pegawai negeri bukan bendahara, maupun untuk bendahara/pengelola perbendaharaan
negara,yaitusebagaiberikut.
a.

Bendahara, pegawai negeri bukan bendahara, dan pejabat lain yang telah
ditetapkanuntukmenggantikerugiannegaradapatdikenaisanksiadministratifdan
atausanksipidana.Putusanpidanatidakmembebaskandarituntutangantirugi.

b.

Kewajiban bendahara, pegawai negeri bukan bendahara, atau pejabat lain untuk
membayar ganti rugi, menjadi kadaluwarsa jika dalam waktu lima tahun sejak

Manajemen Pemerintahan Pusat

213


diketahuinya kerugian tersebut atau dalam waktu delapan tahun sejak terjadinya
kerugiantidakdilakukanpenuntutangantirugiterhadapyangbersangkutan.
c.

Dalam hal bendahara, pegawai negeri bukan bendahara, atau pejabat lain yang
dikenai tuntutan ganti kerugian negara beradadalam pengampuan, melarikan diri,
atau meninggal dunia, penuntutan dan penagihan terhadapnya beralih kepada
pengampuyangmemperolehhak/ahliwaris,terbataspadakekayaanyangdikelola
atau diperolehnya, yang berasal dari bendahara, pegawai negeri bukan bendahara
ataupejabatlainyangbersangkutan.

d.

Tanggungjawabpengampuyangmemperolehhak/ahliwarisuntukmembayarganti
kerugiannegaradimaksudmenjadihapusapabiladalamwaktu3(tiga)tahunsejak
keputusanpengadilanyangmenetapkanpengampuankepadabendahara,pegawai
negeri bukan bendahara, atau pejabat lain yang bersangkutan, atau sejak
bendahara,pegawainegeribukanbendahara,ataupejabatlainyangbersangkutan
diketahui melarikan diri atau meninggal dunia, pengampu/yang memperoleh
hak/ahli waris tidak diberi tahu oleh pejabat yang berwenang mengenai adanya
kerugiannegara.

e.

Ketentuan penyelesaian kerugian negara sebagaimana diatur dalam ketiga paket


undangundang ini berlaku pula untuk uang dan/atau barang bukan milik negara,
yangberadadalampenguasaanbendahara,pegawainegeribukanbendahara,atau
pejabatlainyangdigunakandalampenyelenggaraantugaspemerintahan.

f.

Ketentuan penyelesaian kerugian negara dalam undangundang ini berlaku pula


untukpengelolaperusahaannegaradanbadanbadanlainyangmenyelenggarakan
pengelolaan keuangan negara, sepanjang tidak diatur dalam undangundang
tersendiri.

g.

Pengenaan ganti kerugian negara terhadap pengelolaan perusahaan umum dan


perusahaanperseroanyangseluruhataupalingsedikit51%sahamnyadimilikioleh
negara Republik Indonesia ditetapkan oleh BPK, sepanjang tidak diatur dalam
undangundangtersendiri.

214

2014 |Pusdiklatwas BPKP


5.

PerlakuanTerhadapPejabatyangTerlibatKorupsi,Kolusi,danNepotisme(KKN)
Dalam rangka percepatan pemberantasan korupsi, Menteri Negara Pendayagunaan
AparaturNegaratelahmengeluarkanSuratEdaranNomor:SE/03/M.PAN/4/2007tanggal
18 April 2007 tentang Perlakuan Terhadap Pejabat yang Terlibat Korupsi, Kolusi, dan
Nepotisme(KKN).SuratedarantersebutditujukankepadaparaMenteriKabinetIndonesia
Bersatu, Panglima TNI, Jaksa Agung, Kepala Polri, para kepala lembaga pemerintah
nondepartemen, para pimpinan sekretariat lembaga tinggi negara, para pimpinan
sekretariatdewan/komisi/badan,paragubernur,danparabupati/walikota.
Melaluisuratedarantersebut,MenPANmengharapkanperhatiandanbantuandaripihak
pihakyangdisebutkandiatasagarmeningkatkankerjasamadandukunganupayaupaya
penangananperkarakorupsiyangdilakukanolehaparatpenegakhukum.Kerjasamadan
dukungantersebutdilakukanmelaluimekanismesebagaiberikut.
a.

Segera memberikan izin pemeriksaan terhadap pejabat atau pegawai baik sebagai
saksiatausebagaitersangka,jikamemangizintersebutdiperlukansesuaiperaturan
perundangundangan.

b.

Memberhentikansementaradarijabatannya,terhadappejabatyangterlibatperkara
korupsi, berstatus sebagai tersangka/terdakwa, dan dilakukan penahanan oleh
aparat penegak hukum, sampai dengan adanya keputusan yang mempunyai
kekuatanhukumtetap(inkracht)daripengadilanatauresmidinyatakandihentikan
proseshukumnyaolehaparatpenegakhukum.

c.

Menjatuhkan sanksi administratif sesuai dengan Peraturan Pemerintah Nomor 53


Tahun 2010 tentang Peraturan Disiplin Pegawai Negeri Sipil terhadap
pejabat/pegawai yang telah mendapatkan vonis bersalah dari pengadilan atau jika
terbukti

adanya

pelanggaran disiplin

pegawai

negeri

sipil,

meskipun

pejabat/pegawaitersebutmendapatkanvonisbebasdaripengadilan.
d.

Memulihkan nama baik dan dapat menempatkan kembali pada jabatan yang
semestinyaterhadappejabat/pegawaiyangtidakterbuktimelakukantindakpidana
korupsidantidakterdapatpelanggaranterhadapdisiplinpegawainegerisipil.

e.

Menyampaikan laporan setiap semester kepada MenPAN tentang namanama


pejabat/pegawaiyangterlibatkasuskorupsidenganstatushukumnya.

Manajemen Pemerintahan Pusat

215

216

2014 |Pusdiklatwas BPKP

BabVI
PELAPORANPENGELOLAANDAN
PERTANGGUNGJAWABANKEUANGANNEGARA

IndikatorKeberhasilan:
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenai
prinsipprinsippengukurankinerja,sistemakuntansikeuanganpemerintahpusat,
prosesreviukeuangan,sertapengelolaankeuanganorganisasidanpelaporannya.

Pelaporan merupakan salah satu kegiatan yang sangat penting di dalam tata kelola
pemerintahan. Kegiatan ini dilakukan untuk memberikan informasi yang cepat, tepat, dan
akurat kepada pemangku kepentingan sebagai bahan pengambilan keputusan sesuai dengan
kondisiyangterjadisertapenentuankebijakanyangrelevan.
Pelaporanjugamerupakansaranaakuntabilitaspenyelenggaranegarakepadamasyarakat,baik
akuntabilitas keuangan (financial accountability) maupun akuntabilitas kinerja (performance
accountability).HalinisejalandenganketentuandalamPasal2PeraturanPemerintahNomor8
tahun 2006 yang menyebutkan bahwa dalam rangka pertanggungjawaban pelaksanaan
APBN/APBD, setiap entitas pelaporan wajib menyusun dan menyajikan laporan keuangan dan
laporankinerja.KetentuantersebutmenegaskanbahwaPemerintahtidakhanyadituntutuntuk
mempertanggungjawabkan pengelolaan uang yang dipungut dari rakyat tetapi juga dituntut
untuk mempertanggungjawabkan hasilhasil yang dicapai atas kegiatan pembangunan yang
didanaidariuangtersebut.

A.

PELAPORANKINERJA

Laporan kinerja adalah ikhtisar yang menjelaskan secara ringkas dan lengkap tentang capaian
kinerja yang disusun berdasarkan rencana kerja yang ditetapkan dalam rangka pelaksanaan
APBN.SesuaidenganPeraturanPemerintahNomor8Tahun2006tentangPelaporanKeuangan
danKinerjaInstansiPemerintah,iInformasitentangrealisasikinerjadisajikansecarabersanding
dengan kinerja yang direncanakan dan dianggarkan sebagaimana tercantum dalam Rencana
KerjadanAnggaranKementerian/Lembagauntuktahunanggaranyangbersangkutan.

Manajemen Pemerintahan Pusat

217


MenurutUndangUndangNomor17Tahun2003,menteri/pimpinanlembagasebagaipengguna
anggaran/pengguna barang kementerian negara/lembagayang dipimpinnya mempunyai tugas
antara lain menyusun dan menyampaikan laporan keuangan kementerian negara /lembaga
yangdipimpinnya.Penyusunandanpenyajianlaporankeuangandimaksudadalahdalamrangka
akuntabilitas dan keterbukaan dalam pengelolaan keuangan negara, termasuk prestasi kerja
yangdicapaiataspenggunaananggaran.Penyampaianinformasitentangprestasikerja(kinerja)
sangat relevan dengan perubahan paradigma penganggaran pemerintah yang ditetapkan
dengan mengidentifikasikan secara jelas keluaran (outputs) dari setiap kegiatan dan hasil
(outcomes) dari setiap program. Untuk keperluan tersebut, perlu disusun suatu sistem
akuntabilitas kinerja instansi pemerintah yang terintegrasi dengan sistem perencanaan
strategis, sistem penganggaran, dan Sistem Akuntansi Pemerintahan. Ketentuan yang dicakup
dalam sistem akuntabilitas kinerja instansi pemerintah tersebut sekaligus dimaksudkan untuk
menggantikanketentuanyangtermuatdalamInstruksiPresidenNomor7Tahun1999tentang
Akuntabilitas Kinerja Instansi Pemerintah, sehingga dapat dihasilkan suatu Laporan Keuangan
danKinerjayangterpadu.
1.

PengukuranKinerja
PengukuranKinerjaadalahproseskegiatanyangsistematisdanberkesinambunganuntuk
menilai keberhasilan dan kegagalan pelaksanaan kegiatan sesuai dengan program,
kebijakan, sasaran dan tujuan yang telah ditetapkan dalam mewujudkan visi, misi, dan
strategi instansi pemerintah. Pengukuran kinerja merupakan hasil dari suatu penilaian
(assessment) yang sistematik dan didasarkan pada kelompok indikator kinerja kegiatan
yang berupa indikatorindikator masukan, keluaran, hasil, manfaat, dan dampak. Dalam
pengukuran kinerja dilakukan pula analisis akuntabilitas kinerja yang menggambarkan
keterkaitan pencapaian kinerja kegiatan dengan program dan kebijakan dalam rangka
mewujudkan sasaran, tujuan, visi, dan misi sebagaimana ditetapkan dalam rencana
strategis.
Pengukuran kinerja merupakan suatu alat manajemen yang digunakan untuk
meningkatkankualitaspengambilankeputusandanakuntabilitas.Pengukurankinerjajuga
digunakan untuk menilai pencapaian tujuan dan sasaran (goals and objectives) dengan
elemenkuncisebagaiberikut.

218

2014 |Pusdiklatwas BPKP


a.

Perencanaandanpenetapantujuan.

b.

Pengembanganukuranyangrelevan.

c.

Pelaporanformalatashasil.

d.

Penggunaaninformasi.

Pengukuran adalah aktivitas pembandingan antara sesuatu dengan alat ukurnya. Oleh
karena itu, instrumen penting dalam pengukuran adalah alat ukurnya sendiri. Alat ukur
kinerja adalah ukuran kinerja (performance measures) atau jika tidak ada alat ukur yang
lebih akurat cukup menggunakan indikator kinerja (performance indicators). Oleh
karenanya, kadangkadang istilah ukuran kinerja dan indikator kinerja menjadi sinomim
yangsangatdekat.
Pengukuran kinerja di lingkungan instansi pemerintah dilakukan sesuai dengan peran,
tugasdanfungsimasingmasinginstansipemerintah,sehinggalebihmengandalkanpada
pengukuran keberhasilan instansi pemerintah yang dilakukan secara berjenjang dari
tingkatanunitkerjasampaipadatingkatantertinggiorganisasisuatuinstansi.Olehkarena
itu,diperlukanberbagaiindikatorkinerjadiberbagaitingkatan.Misalnyaindikatorkinerja
yang digunakan untuk mengukur kinerja pelaksanaan kegiatan. Dengan indikator itu
diharapkan pengelola kegiatan, atasan dan pihak luar dapat mengukur keberhasilan
pelaksanaankegiatantersebut.
Untuk mengatasi berbagai kerumitan pengukuran di berbagai tingkatan dan agregasinya
untuk mengambil simpulan, seringkali digunakan beberapa indikator kinerja utama.
Indikator kinerja utama (IKU) ini dipilih di antara berbagai indikator yang paling dapat
mewakilidanmenggambarkanapayangdiukur.
Pengukuran kinerja di berbagai tingkatan dilakukan dengan mengacu pada dokumen
perencanaan kinerja, penganggaran dan perjanjian kinerja. Berbagai tingkatan itu
mempunyai tugas pokok dan fungsi dan tanggung jawab masingmasing yang berbeda
antarasatutingkatandengantingkatanyanglain.

Manajemen Pemerintahan Pusat

219


Tingkatanentitasakuntabilitasitudapatdikategorikansebagaiberikut:
a.

entitas akuntabilitas kinerja satuan kerja atau Eselon II pada Instansi Pemerintah
Pusat;

b.

entitasakuntabilitaskinerjaunitorganisasiEselonI;

c.

entitasakuntabilitaskinerjakementeriannegara/lembaga;

d.

entitasakuntabilitaskinerjaSKPD;

e.

entitasakuntabilitaskinerjaPemerintahProvinsi/Kabupaten/Kota.

Seluruh

entitas

tersebut

wajib

menyusun

rencana

kinerja,

melaksanakan

kegiatan/program dan memantau realisasi capaian berbagai indikator kinerja yang


digunakan untuk mengukur terwujudnya output atau outcome sampai sasaran strategis
Kementerian/Lembaga. Oleh karena itu, pengukuran kinerja juga dilakukan pada setiap
tingkatantersebut.
Instrumen pengukuran kinerja dengan menggunakan berbagai formulir pengukuran
kinerjadapatdibedakanpadasetiaptingkatantersebutdiatas.
2.

EvaluasiKinerja
Evaluasi atau analisis adalah proses untuk mengurai suatu kondisi sehingga diperoleh
pemahaman yang lebih mendalam. Analisis merupakan kebalikan dari sintesis, yaitu
proses untuk menyatukan kondisi, ide, atau objek menjadi sesuatu yang baru secara
keseluruhan. Oleh karena itu, analisis kinerja paling tidak dilakukan dengan cara
melakukan analisis adanya beda kinerja (performance gap analysis), yaitu melihat beda
(gap) antara yang sudah direncanakan dengan realisasinya atau kenyataannya. Jika
terdapat gap yang besar, maka perlu diteliti sebabsebabnya berikut berbagai informasi
kendala dan hambatan termasuk usulan tindakantindakan apa yang diperlukan untuk
memperbaiki kondisi tersebut. Keseluruhan hasil analisis kinerja selanjutnya dituangkan
dalampelaporanakuntabilitaskinerja.
Dalam sistem akuntabilitas kinerja instansi pemerintah (SAKIP) analisis kinerja dilakukan
terhadap kinerja instansi pemerintah sesuai dengan entitas akuntabilitas kinerja dengan
memanfatkanhasildariaktivitaspengukurankinerjayangtelahdilakukan.

220

2014 |Pusdiklatwas BPKP


Oleh karena itu, adalah penting untuk mengidentifikasi entitas yang melaporkan
akuntabilitas kinerja. Akuntabilitas kinerja di tingkat Kementerian/Lembaga sudah tentu
menyangkut halhal yang lebih besar, lebih penting, dan terkait dengan hasilhasil
pembangunan nasional yang bersifat strategis. Jika dibandingkan dengan laporan
akuntabilitas kinerja Unit Kerja Organisasi tingkat Eselon I, maka akuntabilitas kinerja di
tingkatunitkerjaeselonIlebihrincidanlebihoperasional,demikianseterusnyasampaike
tingkatandibawahnya.
Pengukuran dan analisis kinerja yang dilakukan pada tingkat Kementerian/Lembaga
disarankan terbatas pada pencapaian sasaransasaran strategis kementerian/lembaga.
Dengan demikian, K/L hanya melaporkan halhal yang penting atau strategis saja, dan
kemudianhalhalyanglebihrincidanlebihoperasionaldilaporkanunitkerjaeselonIatau
eselonIIdibawahnya.
PengukurankinerjaditingkatunitkerjaorganisasieselonI,sebaiknyameliputipelaporan
sasaran strategis unit kerja tersebut dan juga kinerja pelaksanaan kegiatan atau output
unit di bawahnya. Sedangkan unit kerja eselon II, mengukur dan melaporkan berbagai
outputpadaunitnyabesertasubsuboutputnya.
Berikutdisajikanilustrasipengukurankinerjadiberbagaitingkatanbaikuntukpemerintah
pusatmaupunpemerintahprovinsi/kabupaten/kota:

Manajemen Pemerintahan Pusat

221


Tabel6.1FormulirPengukuranKinerjaTingkatKementerian/Lembaga

Kementerian/Lembaga

:(a)

TahunAnggaran

:(b)

Sasaran
Strategis

Indikator
Kinerja

Target

Realisasi

Program

(1)

(2)

(3)

(4)

(5)

(6)

Anggaran
Pagu

Realisasi

(7)

(8)

(9)

JumlahAnggaranTahun

...........:Rp.......................(c)

RealisasiPaguAnggaranTahun...........:Rp.......................(d)

PetunjukPengisian:
a.

Header(a)diisidengankodedannamaK/L;

b.

Header(b)diisidengantahunanggaran;

c.

Kolom (1) diisi dengan sasaran strategis K/L sesuai dengan dokumen Penetapan
Kinerja;

d.

Kolom (2) diisi dengan indikator kinerja sasaran strategis dari K/L sesuai dengan
dokumenPenetapanKinerja;

e.

Kolom(3)diisidenganangkatargetyangakandicapaiuntuksetiapindikatorkinerja
sesuaidengandokumenPenetapanKinerja;

f.

Kolom(4)diisidenganRealisasidarimasingmasingindikatorkinerja;

g.

Kolom (5) diisi dengan persentase pencapaian target dari masingmasing indikator
kinerja;

h.

Kolom (6) diisi dengan nama program yang digunakan untuk pencapaian sasaran
strategisorganisasisesuaidengandokumenPenetapanKinerja;

i.

Kolom(7)diisidenganpaguanggaranprogram;

j.

Kolom(8)diisidenganrealisasianggaran;

k.

Kolom(9)diisidenganpersentaserealisasianggaran(realisasi/pagux100%);

l.

Footer(c)diisitotaljumlah/nilaipaguanggaranyangdirencanakanuntukmencapai
sasaranstrategis;

m.

Footer(d)diisitotaljumlah/nilairealisasianggaranyangdigunakanuntukmencapai
sasaranstrategis.

222

2014 |Pusdiklatwas BPKP


Tabel6.2FormulirPengukuranKinerja
TingkatUnitOrganisasiEselonI/SatkerKementerian/Lembaga

UnitOrganisasiEselonI/Satker :(a)
TahunAnggaran

:(b)

SasaranStrategis

IndikatorKinerja

Target

Realisasi

(1)

(2)

(3)

(4)

(5)

JumlahAnggaranTahun

...........:Rp.......................(c)

RealisasiPaguAnggaranTahun...........:Rp.......................(d)

PetunjukPengisian:
1. Header(a)diisidengankodedannamaunitorganisasiEselonI/Satkermandiri;
2. Header(b)diisidengantahunanggaran;
3. Kolom (1) diisi dengan sasaran strategis unit organisasi Eselon I sesuai dengan
dokumenPenetapanKinerja;
4. Kolom (2) diisi dengan indikator kinerja sasaran strategis dari unit organisasi Eselon
I/SatkermandirisesuaidengandokumenPenetapanKinerja;
5. Kolom (3) diisi dengan angka target yang akan dicapai untuk setiap indikator kinerja
sesuaidengandokumenPenetapanKinerja;
6. Kolom(4)diisidenganrealisasidarimasingmasingindikatorkinerja;
7. Kolom (5) diisi dengan persentase pencapaian target dari masingmasing indikator
kinerja(realisasi/targetx100%);
8. Footer (c) diisi total jumlah/nilai pagu anggaran yang direncanakan untuk mencapai
sasaranstrategis;
9. Footer (d) diisi total jumlah/nilai realisasi anggaran yang digunakan untuk mencapai
sasaranstrategis.

Manajemen Pemerintahan Pusat

223


3.

Pelaporan
SalahsatubentuklaporankinerjayangdigunakandalamsektorpublikdiIndonesiaadalah
LAKIP (Laporan Akuntabilitas Kinerja Instansi Pemerintah). LAKIP dipakai sebagai media
akuntabilitas bagi instansi pemerintah yang dibuat tahunan berisi pertanggungjawaban
kinerjasuatuinstansidalammencapaitujuan/sasaranstrategis.
a.

PrinsipPrinsipPenyusunanLAKIP
Penyusunan LAKIP harus mengikuti prinsipprinsip yang lazim, yaitu laporan harus
disusunsecarajujur,objektif,dantransparan.Disampingitu,perlupuladiperhatikan
prinsipprinsiplain,seperti:
1)

Prinsip pertanggungjawaban (adanya responsibility center), sehingga


lingkupnya jelas. Halhal yang dikendalikan (controllable) maupun yang tidak
dapat dikendalikan (uncontrollable) oleh pihak yang melaporkan harus dapat
dimengertipembacalaporan.

2)

Prinsippengecualian,yangdilaporkanadalahhalhalyangpentingdanrelevan
bagi pengambilan keputusan dan pertanggungjawaban instansi yang
bersangkutan. Misalnya halhal yang menonjol baik keberhasilan maupun
kegagalan,

perbedaanperbedaan

antara

realisasi

dengan

sasaran/standar/rencana/budget, penyimpanganpenyimpangan dari rencana


karenaalasantertentu,dansebagainya.
3)

Prinsip perbandingan, laporan dapat memberikan gambaran keadaan masa


yang dilaporkan dibandingkan dengan periodeperiode lain atau unit/instansi
lain.

4)

Prinsip akuntabilitas, sejalan dengan prinsip pertanggungjawaban dan prinsip


pengecualian,makaprinsipinimensyaratkanbahwayangterutamadilaporkan
adalahhalhalyangdominanyangmembuatsuksesataugagalnyapelaksanaan
rencana.

5)

Prinsip manfaat, yaitu manfaat laporan harus lebih besar dari pada biaya
penyusunannya.

224

2014 |Pusdiklatwas BPKP


Di samping itu, perlu pula diperhatikan beberapa ciri laporan yang baik seperti
relevan, tepat waktu, dapat dipercaya/diandalkan, mudah dimengerti (jelas dan
cermat), dalam bentuk yang menarik (tegas dan konsisten, tidak kontradiktif antar
bagian),berdayabandingtinggi,berdayauji(verifiable),lengkap,netral,padat,dan
terstandarisasi(untukyangrutin).
b.

SistematikaLAKIP
SesuaiPermenPANdanRBNomor29 Tahun2009tentangPedomanPenyusunan
Penetapan Kinerja dan Pelaporan Akuntabilitas Kinerja Instansi Pemerintah,
sistematikaLAKIPadalahsebagaiberikut:
IkhtisarEksekutif
BabIPendahuluan
Dalam bab ini diuraikan mengenai gambaran umum organisasi yang
melaporkandansekilaspengantarlainnya.
BabIIPerencanaandanPerjanjianKinerja
Dalam bab ini diikhtisarkan beberapa hal penting dalam perencanaan dan
perjanjiankinerja(dokumenpenetapankinerja).
BabIIIAkuntabilitasKinerja
Dalam bab ini diuraikan pencapaian sasaransasaran organisasi pelapor,
denganpengungkapandanpenyajiandarihasilpengukurankinerja.
BabIVPenutup
Lampiranlampiran

c.

KewajibanPenyusunanLAKIP
Padadasarnya,instansiyangwajibmenyusunlaporanakuntabilitaskinerjaadalah:
1)

Kementerian/Lembaga;

2)

PemerintahProvinsi/Kabupaten/Kota;

3)

UnitOrganisasiEselonIpadaKementerian/Lembaga;

Manajemen Pemerintahan Pusat

225


4)

SatuanKerjaPerangkatDaerah;

5)

Unit kerja mandiri, yaitu unit kerja yang mengelola anggaran tersendiri
dan/atauunityangditentukanolehpimpinaninstansimasingmasing.

Selanjutnya, jangka waktu penyampaian LAKIP untuk instansi pemerintah pusat


diatursebagaiberikut.
1)

Laporan Akuntabilitas Kinerja tingkat Kementerian/Lembaga disampaikan


kepadaPresidenmelaluiMenteriNegaraPendayagunaanAparaturNegaradan
Reformasi Birokrasi selambatlambatnya 2,5 (dua setengah) bulan setelah
tahunanggaranberakhir.

2)

Laporan Akuntabilitas Kinerja tingkat unit organisasi eselon I dan unit kerja
mandiri pada Kementerian/Lembaga disampaikan kepada Menteri/Pimpinan
Lembaga.

3)

Waktu penyampaian Laporan Akuntabilitas Kinerja tingkat unit organisasi


eselon I dan unit kerja mandiri pada Kementerian/Lembaga sebagaimana
dimaksud pada butir 2 di atas diatur tersendiri oleh Menteri/Pimpinan
Lembaga.

B.

PELAPORANKEUANGAN

1.

Konsepsi
Pola pertanggungjawaban atas pengelolaan keuangan negara dikembangkan sejalan
dengan teori keagenan (agency theory). Pada prinsipnya, Pemerintah merupakan pihak
suruhan atau agen dari rakyat yang dalam hal ini diwakili oleh DPR. Pemerintah diberi
kekuasaan untuk memungut uang dari rakyat berdasarkan UndangUndang. Setiap
tahunnya anggaran pendapatan dan belanja dituangkan dalam UndangUndang APBN.
Pemerintah yang memungut, pemerintah yang mengelola, maka pemerintah juga
berkewajiban untuk mencatat (mengakuntansikan) dan melaporkannya kepada rakyat
melalui DPR. Dalam rangka meyakini bahwa laporan dimaksud telah menyajikan kondisi
yang

sesungguhnya

serta

pemerintah

telah

menaati

ketentuan

peraturan

perundangundangan, maka laporan keuangan tersebut wajib diperiksa oleh pemeriksa

226

2014 |Pusdiklatwas BPKP


yangindependen.BerdasarkanUUD1945yangberwenanguntukmelakukanpemeriksaan
ataslaporankeuanganpemerintahadalahBPKRI.
Gambarpolapertanggungjawabantersebutdisajikansebagaiberikut.
Gambar6.1HubunganKontrakPrinsipalAgen:Solusi

LaporankeuanganpemerintahyangdisampaikanmelalauiRUUPertanggungjawabanatas
PelaksanaanAPBNadalahlaporankeuanganyangtelahdiauditBPKRI.Laporankeuangan
ini paling lambat disampaikan ke DPR pada akhir bulan Juni tahun berikutnya. Laporan
keuangan dilampiri dengan Laporan Kinerja dan Laporan Keuangan Badan Usaha Milik
Negaradanbadanlainnya.LaporankeuangandisertaidenganSuratPernyataanTanggung
jawabatauStatementofResponsibility(SOR).
2.

PeranandanTujuanLaporanKeuangan
Laporan keuangan disusun untuk menyediakan informasi yang relevan mengenai posisi
keuangandanseluruhtransaksiyangdilakukanolehsuatuentitaspelaporanselamasatu
periode pelaporan. Laporan keuangan terutama digunakan untuk mengetahui nilai
sumber daya ekonomi yang dimanfaatkan untuk melaksanakan kegiatan operasional
pemerintahan, menilai kondisi keuangan, mengevaluasi efektivitas dan efisiensi suatu
entitas pelaporan, dan membantu menentukan ketaatannya terhadap peraturan
perundangundangan.

Manajemen Pemerintahan Pusat

227


Setiap entitas pelaporan mempunyai kewajiban untuk melaporkan upayaupaya yang
telahdilakukansertahasilyangdicapaidalampelaksanaankegiatansecarasistematisdan
terstrukturpadasuatuperiodepelaporanuntukkepentingan:
a.

Akuntabilitas
Mempertanggungjawabkan pengelolaan sumber daya serta pelaksanaan kebijakan
yang dipercayakan kepada entitas pelaporan dalam mencapai tujuan yang telah
ditetapkansecaraperiodik.

b.

Manajemen
Membantuparapenggunauntukmengevaluasipelaksanaankegiatansuatuentitas
pelaporan dalam periode pelaporan sehingga memudahkan fungsi perencanaan,
pengelolaandanpengendalianatasseluruhaset,kewajiban,danekuitaspemerintah
untukkepentinganmasyarakat.

c.

Transparansi
Memberikan informasi keuangan yang terbuka dan jujur kepada masyarakat
berdasarkan pertimbangan bahwa masyarakat memiliki hak untuk mengetahui
secara terbuka dan menyeluruh atas pertanggungjawaban pemerintah dalam
pengelolaan sumber daya yang dipercayakan kepadanya dan ketaatannya pada
peraturanperundangundangan.

d.

KeseimbanganAntargenerasi(intergenerationalequity)
Membantu para pengguna dalam mengetahui kecukupan penerimaan pemerintah
pada periode pelaporan untuk membiayai seluruh pengeluaran yang dialokasikan
dan apakah generasi yang akan datang diasumsikan akan ikut menanggung beban
pengeluarantersebut.

e.

EvaluasiKinerja
Mengevaluasikinerjaentitaspelaporan,terutamadalampenggunaansumberdaya
ekonomiyangdikelolapemerintahuntukmencapaikinerjayangdirencanakan.

228

2014 |Pusdiklatwas BPKP


Tujuanumumlaporankeuanganadalahmenyajikaninformasimengenaiposisikeuangan,
realisasi anggaran, saldo anggaran lebih, arus kas, hasil operasi, dan perubahan ekuitas
suatu entitas pelaporan yang bermanfaat bagi para pengguna dalam membuat dan
mengevaluasikeputusanmengenaialokasisumberdaya.Secaraspesifik,tujuanpelaporan
keuangan pemerintah adalah untuk menyajikan informasi yang berguna untuk
pengambilan keputusan dan untuk menunjukkan akuntabilitas entitas pelaporan atas
sumberdayayangdipercayakankepadanya,dengan:
a.

menyediakan informasi mengenai posisi sumber daya ekonomi, kewajiban, dan


ekuitaspemerintah;

b.

menyediakan informasi mengenai perubahan posisi sumber daya ekonomi,


kewajiban,danekuitaspemerintah;

c.

menyediakan informasi mengenai sumber, alokasi, dan penggunaan sumber daya


ekonomi;

d.

menyediakaninformasimengenaiketaatanrealisasiterhadapanggarannya;

e.

menyediakaninformasimengenaicaraentitaspelaporanmendanaiaktivitasnyadan
memenuhikebutuhankasnya;

f.

menyediakan informasi mengenai potensi pemerintah untuk membiayai


penyelenggaraankegiatanpemerintahan;

g.

menyediakan informasi yang berguna untuk mengevaluasi kemampuan entitas


pelaporandalammendanaiaktivitasnya.

Laporankeuanganuntuktujuanumumjugamempunyaiperananprediktifdanprospektif,
menyediakan informasi yang berguna untuk memprediksi besarnya sumber daya yang
dibutuhkan untuk operasi yang berkelanjutan, sumber daya yang dihasilkan dari operasi
yangberkelanjutan,sertarisikodanketidakpastianyangterkait.Pelaporankeuanganjuga
menyajikaninformasibagipenggunamengenai:
a.

indikasi apakah sumber daya telah diperoleh dan digunakan sesuai dengan
anggaran;dan

Manajemen Pemerintahan Pusat

229


b.

indikasi apakah sumber daya diperoleh dan digunakan sesuai dengan ketentuan,
termasukbatasanggaranyangditetapkanolehDPR.

Untuk memenuhi tujuan umum ini, laporan keuangan menyediakan informasi mengenai
entitaspelaporandalamhal:aset;kewajiban;ekuitas;pendapatanLRA;belanja;transfer;
pembiayaan;saldoanggaranlebihpendapatanLO(laporanoperasional);beban;danarus
kas.
3.

PeriodePelaporan
Laporan keuangan disajikan sekurangkurangnya sekali dalam setahun terhitung mulai 1
Januari sampai dengan tanggal 31 Desember. Dalam situasi tertentu, tanggal laporan
suatu entitas berubah dan laporan keuangan tahunan disajikan dengan suatu periode
yang lebih panjang atau lebih pendek dari satu tahun, misalnya sehubungan dengan
adanya perubahan tahun anggaran. Contoh selanjutnya adalah dalam masa transisi dari
akuntansi berbasis kas ke akrual, suatu entitas pelaporan mengubah tanggal pelaporan
entitasentitas akuntansi yang berada dalam entitas pelaporan untuk memungkinkan
penyusunan laporan keuangan konsolidasian. Dalam kondisi tersebut entitas pelaporan
mengungkapkan:
a.

alasanpenggunaanmetodepelaporantidak1(satu)tahun;dan

b.

faktabahwajumlahjumlahkomparatifuntuklaporantertentusepertiaruskasdan
catatancatatanterkaittidakdapatdiperbandingkan.

Sesuai dengan UU Nomor 17 Tahun 2003 tentang Keuangan Negara, batas waktu
penyampaianlaporankeuangansebagailaporanpertanggungjawabanpelaksanaanAPBN
selambatlambatnya 6 (enam) bulan setelah berakhirnya tahun anggaran. Dengan
demikian, kegunaan laporan keuangan tersebut berkurang bilamana laporan tidak
tersediabagipenggunadalamsuatuperiodetertentusetelahtanggalpelaporan.Faktor
faktor yang dihadapi seperti kompleksitas operasi suatu entitas pelaporan bukan
merupakanalasanyangcukupataskegagalanpelaporanyangtepatwaktu.
Selain laporan keuangan tahunan, setiap entitas pelaporan juga diwajibkan menyusun
laporan keuangan interim, yaitu setidaktidaknya setiap semester sebagaimana

230

2014 |Pusdiklatwas BPKP


diamanatkan dalam Peraturan Pemerintah Nomor 8 Tahun 2006 tentang Pelaporan
KeuangandanKinerjaInstansiPemerintah.
4.

StandarAkuntansiPemerintahan(SAP)
Laporan keuangan disusun dan disajikan sesuai dengan SAP. Dengan demikian sistem
akuntansi yang digunakan untuk menghasilkan laporan keuangan juga harus dibangun
sesuaidenganSAP.
SAP merupakan pedoman umum dalam penyusunan dan penyajian laporan keuangan.
Kesesuaian dengan SAP mencerminkan tingkatan akuntabilitas dan transparansi dalam
pengelolaan keuangan negara. Oleh karena itu, penyusunan dan penyajian laporan
keuangan yang sesuai dengan SAP merupakan salah satu kriteria bagi BPK RI dalam
memberikanopiniataskewajaranpenyajianlaporankeuangan.
BerdasarkanUndangUndangNomor17Tahun2003danUndangUndangNomor1Tahun
2004, SAP disusun oleh Komite Standar Akuntansi Pemerintah (KSAP). KSAP merupakan
suatu komite yang independen dengan komite kerja beranggotakan 9 orang. KSAP telah
mengeluarkan SAP yang tertuang dalam Peraturan Pemerintah Nomor 24 Tahun 2005
yangsudahdiubahdenganPeraturanPemerintahNomor71Tahun2010.
BerdasarkanPPNomor71Tahun2010,mulaitahun2015SAPberbasisakrualsudahharus
diterapkandalampenyelenggaraanSAPP.SAPBerbasisAkrualadalahSAPyangmengakui
pendapatan, beban, aset, utang, dan ekuitas dalam pelaporan finansial berbasis akrual,
serta mengakui pendapatan, belanja, dan pembiayaan dalam pelaporan pelaksanaan
anggaranberdasarkanbasisyangditetapkandalamAPBN/APBD.

5.

SistemAkuntansiPemerintahanPusat(SAPP)
Sistem Akuntansi Pemerintahan adalah rangkaian sistematik dari prosedur,
penyelenggara, peralatan, dan elemen lain untuk mewujudkan fungsi akuntansi sejak
analisis transaksi sampai dengan pelaporan keuangan di lingkungan organisasi
pemerintah. Dengan demikian sistem akuntansi merupakan suatu wadah untuk
memprosesdatakeuangansampaidihasilkannyainformasikeuanganyangdisajikandalam
laporankeuangan.

Manajemen Pemerintahan Pusat

231


Sistem akuntansi untuk pemerintah pusat adalah Sistem Akuntansi Pemerintah Pusat
(SAPP) yang ditetapkan oleh Menteri Keuangan berdasarkan PMK Nomor
171/PMK.05/2007tentangSistemAkuntansidanPelaporanPemerintahPusatdanberlaku
untuk seluruh kementerian negara/lembaga. SAPP adalah serangkaian prosedur manual
maupunyangterkomputerisasimulaidaripengumpulandata,pencatatan,pengikhtisaran
sampaidenganpelaporanposisikeuangandanoperasikeuanganPemerintahPusat.
SAPPdiperlukanuntukmencapaitigatujuan.Pertama,untukmenetapkanproseduryang
harus diikuti oleh pihakpihak yangterkait sehingga jelas pembagian kerja dan tanggung
jawab diantara mereka. Kedua, untuk terselenggarakannya pengendalian intern untuk
menghindari terjadinya penyelewengan. Ketiga, untuk menghasilkan laporan keuangan
sebagai bentuk pertanggungjawaban pengelolaan keuangan di mana jenis dan isinya
diaturolehPeraturanPemerintahNomor71Tahun2010tentangSAP.
AkuntansiPemerintahanpadadasarnyamerupakanakuntansianggaran.Olehkarenaitu
sistem akuntansi yang baik seharusnya terintegrasi dengan sistem anggaran. Apabila hal
ini dijalankan maka akan terdapat konsistensi dalam perencanaan, penganggaran,
pelaksanaan,akuntansidanpertanggungjawabananggaran.
Berikutinidiuraikandasarhukumpenyelenggaraan,ruanglingkup,tujuan,ciriciripokok,
kerangkaumum,danklasifikasiSAPP.
a.

DasarHukumPenyelenggaraanSAPP
1)

UndangUndangNomor17Tahun2003tentangKeuanganNegara:
Pasal 8: Dalam rangka pelaksanaan kekuasaan atas pengelolaan fiskal,
Menteri Keuangan mempunyai tugas antara lain menyusun laporan
keuanganyangmerupakanpertanggungjawabanpelaksanaanAPBN.
Pasal 9 menyatakan bahwa Menteri/Pimpinan Lembaga sebagai
pengguna anggaran/ pengguna barang kementerian negara/lembaga
yang dipimpinnya mempunyai tugas antara lain menyusun dan
menyampaikan laporan keuangan kementerian negara/lembaga yang
dipimpinnya.

232

2014 |Pusdiklatwas BPKP


Pasal 30 ayat (2) menyatakan bahwa Presiden menyampaikan
rancangan undangundang tentang pertanggungjawaban pelaksanaan
APBN kepada DPR berupa laporan keuangan yang meliputi Laporan
Realisasi APBN, Neraca, Laporan Arus Kas, dan Catatan atas Laporan
Keuangan,yangdilampiridenganlaporankeuanganperusahaannegara
danbadanlainnya.
2)

UndangUndangNomor1Tahun2004tentangPerbendaharaanNegara
Pasal 7 ayat (20) menyatakan bahwa Menteri Keuangan selaku
BendaharaUmumNegaraberwenangmenetapkansistemakuntansidan
pelaporankeuangannegara.
Pasal 51 ayat (1) menyatakan bahwa Menteri Keuangan/Pejabat
Pengelola Keuangan Daerah selaku Bendahara Umum Negara/Daerah
menyelenggarakan akuntansi atas transaksi keuangan, aset, utang, dan
ekuitasdana,termasuktransaksipembiayaandanperhitungannya.
Pasal

51

ayat

(2)

menyatakan

bahwa

Menteri/pimpinan

lembaga/kepala satuan kerja perangkat daerah selaku pengguna


anggaran menyelenggarakan akuntansi atas transaksi keuangan, aset,
utang, dan ekuitas dana, termasuk transaksi pendapatan dan belanja
yangberadadalamtanggungjawabnya.
Pasal 55 ayat (1) menyatakan bahwa Menteri Keuangan selaku
pengelola fiskal menyusun Laporan Keuangan Pemerintah Pusat untuk
disampaikan

kepada

Presiden

dalam

rangka

memenuhi

pertanggungjawabanpelaksanaanAPBN.
Pasal 55 ayat (2) menyatakan bahwa Dalam menyusun Laporan
Keuangan Pemerintah Pusat sebagaimana dimaksud pada ayat (1),
menteri/pimpinanlembagaselakupenggunaanggaran/penggunabarang
menyusundanmenyampaikanlaporankeuanganyangmeliputiLaporan
Realisasi Anggaran, Neraca, dan Catatan atas Laporan Keuangan
dilampiri laporan keuangan Badan Layanan Umum pada kementerian
negara/Lembagamasingmasing.

Manajemen Pemerintahan Pusat

233


BagianpenjelasanmenyatakanbahwaAgarinformasiyangdisampaikan
dalam laporan keuangan pemerintah dapat memenuhi prinsip
transparansi dan akuntabilitas, perlu diselenggarakan Sistem Akuntansi
PemerintahPusat(SAPP)yangterdiridariSistemAkuntansiPusat(SiAP)
yang dilaksanakan oleh Kementerian Keuangan dan Sistem Akuntansi
Instansi(SAI)yangdilaksanakanolehkementeriannegara/lembaga.
3)

UndangUndang Nomor 36 Tahun 2004 tentang Anggaran Pendapatan dan


Belanja Tahun Anggaran 2005 Pasal 17 ayat (1) menyatakan bahwa Setelah
Tahun Anggaran 2005 berakhir, pemerintah menyusun pertanggungjawaban
atas Pelaksanaan Anggaran Pendapatan dan Belanja Negara Tahun Anggaran
2005berupaLaporanKeuangan.

4)

Keputusan Presiden Nomor 42 Tahun 2002 tentang Pedoman Pelaksanaan


AnggaranPendapatandanBelanjaNegarapadaPasal60ayat(1)menyatakan
bahwa

Menteri/Pimpinan

Lembaga

wajib

menyelenggarakan

pertanggungjawaban penggunaan dana bagian anggaran yang dikuasainya


berupa laporan realisasi anggaran dan neraca kementerian negara/lembaga
bersangkutan kepada Presiden melalui Menteri Keuangan. Keputusan
Presiden tersebut telah diubah terakhir dengan dengan Peraturan Presiden
Nomor53Tahun2010tentangPedomanPelaksanaanAPBN.
b.

RuangLingkupSAPP
SAPP berlaku untuk seluruh unit organisasi Pemerintah Pusat dan unit akuntansi
padaPemerintahDaerahdalamrangkapelaksanaanDekonsentrasidan/atauTugas
Pembantuansertapelaksanaananggaranpembiayaandanperhitungan.

c.

TujuanSAPP
SistemSAPPbertujuanuntuk:
1)

menjaga aset pemerintah pusat dan instansiinstansinya melalui pencatatan,


pemprosesandanpelaporantransaksikeuanganyangkonsistensesuaidengan
standardanpraktekakuntansiyangditerimasecaraumum;

234

2014 |Pusdiklatwas BPKP


2)

menyediakan informasi yang akurat dan tepat waktu tentang anggaran dan
kegiatan keuangan pemerintah pusat, baik secara nasional maupun instansi
yang berguna sebagai dasar penilaian kinerja, untuk menentukan ketaatan
terhadapotorisasianggarandanuntuktujuanakuntabilitas;

3)

menyediakan informasi yang dapat dipercaya tentang posisi keuangan suatu


instansidanpemerintahpusatsecarakeseluruhan;dan

4)

menyediakan informasi keuangan yang berguna untuk perencanaan,


pengelolaan dan pengendalian kegiatan dan keuangan pemerintah secara
efisien.

d.

CiriciriPokokSAPP
1)

BasisAkuntansi
SesuaidenganamanahUndangUndangNomor1Tahun2004danyangtelah
ditetapkan standarnya dalam Peraturan Pemerintah Nomor 71 Tahun 2010
tentang SAP, maka basis akuntansi yang diselenggarakan pemerintah pusat
adalah akrual. Basis akrual mengakui pendapatan, beban, aset, utang, dan
ekuitasdalampelaporanfinansialberbasisakrual,sertamengakuipendapatan,
belanja,danpembiayaandalampelaporanpelaksanaananggaranberdasarkan
basisyangditetapkandalamAPBN/APBD.

2)

SistemPembukuanBerpasangan
Sistem pembukuan berpasangan didasarkan atas persamaan dasar akuntasi
yaitu: Aset = Kewajiban + Ekuitas Dana. Setiap transaksi dibukukan dengan
mendebet sebuah perkiraan/akun dan mengkredit perkiraan/akun yang
terkait.

3)

DanaTunggal
Kegiatan akuntansi yang mengacu kepada Undangundang APBN sebagai
landasan operasional. Dana tunggal ini merupakan tempat di mana
pendapatandanbelanjapemerintahdipertanggungjawabkansebagaikesatuan
tunggal.

Manajemen Pemerintahan Pusat

235


4)

DesentralisasiPelaksanaanAkuntansi
Kegiatan akuntansi dan pelaporan keuangan di instansi dilaksanakan secara
berjenjang oleh unitunit akuntansi baik di kantor pusat instansi maupun di
daerah.

5)

BaganPerkiraanStandar
SAPPmenggunakanperkiraanstandaryangditetapkanolehMenteriKeuangan
yangberlakuuntuktujuanpenganggaranmaupunakuntansi.

6)

StandarAkuntansi
SAPP mengacu pada Standar Akuntansi Pemerintah (SAP) dalam melakukan
pengakuan, penilaian, pencatatan, penyajian, dan pengungkapan terhadap
transaksikeuangandalamrangkapenyusunanlaporankeuangan.

e.

KerangkaUmumSAPP
SAPP menghasilkan Laporan Keuangan Pemerintah Pusat (LKPP) yang merupakan
konsolidasi dari seluruh laporan keuangan entitas pelaporan (K/L selaku pengguna
anggaran dan BUN). LKPP disampaikan kepada DPR sebagai pertanggungjawaban
atas pelaksanaan APBN. Sebelum disampaikan kepada DPR, LKPP tersebut diaudit
terlebihdahuluolehBPK.
Komponen laporan keuangan yang dihasilkan dari SAPP terdiri dari laporan
pelaksanaananggarandanlaporanfinansial,sebagaimanapadaGambar6.2berikut.

236

2014 |Pusdiklatwas BPKP


Gambar6.2KomponenLaporanKeuanganPemerintah

1)

LaporanRealisasiAnggaran(LRA)
LRA menyajikan informasi realisasi pendapatan, belanja, transfer,
surplus/defisitLRA dan pembiayaan, masingmasing diperbandingkan dengan
anggarannyadalamsatuperiode.LRAmenunjukkanketercapaiantargetyang
telah disepakati antara legislatif dan eksekutif sesuai dengan peraturan
perundangundangan.

2)

LaporanPerubahanSaldoAnggaranLebih(SAL)
Laporan Perubahan SAL pemerintah mencakup SAL tahun sebelumnya,
penggunaanSAL,SisaLebih/KurangPembiayaanAnggaran(SiLPA/SiKPA)tahun
berjalan,danpenyesuaianlainyangdiperkenankan,sertaSALakhir.

3)

Neraca
Neracaadalahlaporankeuanganyangmencerminkanposisikeuanganentitas,
yaitu menginformasikan nilai dan jenis aset, kewajiban dan ekuitas.
memberikan informasi tentang sumber daya ekonomi dan kewajiban entitas

Manajemen Pemerintahan Pusat

237


pelaporan pada tanggal pelaporan dan arus sumber daya ekonomi selama
periode berjalan. Informasi ini diperlukan pengguna untuk melakukan
penilaian terhadap kemampuan entitas pelaporan dalam menyelenggarakan
kegiatanpemerintahandimasamendatang.
Aset merupakan sumber daya yang dikuasai oleh perusahaan sebagai akibat
dari peristiwa masa lalu dan dari mana manfaat ekonomi di masa depan
diharapkan akan diperoleh entitas. Kewajiban merupakan utang perusahaan
masa kini yg timbul dari peristiwa masa lalu, penyelesaiannya diharapkan
mengakibatkan arus keluar dari sumber daya yang mengandung manfaat
ekonomi.Sedangkanekuitasadalahhakresidualatasasetperusahaansetelah
dikurangikewajiban.
4)

LaporanOperasional(LO)
Laporan Operasional adalah laporan yang menyediakan informasi mengenai
seluruh kegiatan operasional keuangan entitas pelaporan yang tercerminkan
dalam pendapatan LO, beban dan surplus/defisit operasional yang
penyajiannya disandingkan dengan periode sebelumnya. Entitas pelaporan
menyajikaninformasiuntukmembantuparapenggunadalammemperkirakan
hasil operasi entitas dan pengelolaan aset, seperti halnya dalam pembuatan
danevaluasikeputusanmengenaialokasisumberdayaekonomi.

5)

LaporanArusKas
LaporanArusKasadalahlaporanyangmenyajikaninformasipenerimaandan
pengeluarankas.Laporanaruskasmemberikaninformasiuntuk:
a)

Menilaipengaruhsuatuaktivitasterhadapposisikasdansetarakas.

b)

Mengevaluasi hubungan antara aktivitas operasi, investasi, pendanaan,


dantransitorisselamasuatuperiodeakuntansi.

Laporan Arus Kas hanya dibuat oleh entitas yang mempunyai fungsi
perbendaharaanumum.

238

2014 |Pusdiklatwas BPKP


6)

LaporanPerubahanEkuitas
Laporan Perubahan Ekuitas merupakan bentuk penyajian kekayaan bersih
pemerintah (entitas pelaporan) yang mencakup ekuitas awal, surplus/defisit
periodebersangkutan,dandampakkumulatifakibatperubahankebijakandan
kesalahanmendasar.
LaporanPerubahanEkuitasmenyajikansekurangkurangnyaposposberikut:
a)

Ekuitasawal

b)

Surplus/defisitLOpadaperiodebersangkutan

c)

Koreksikoreksi yang langsung menambah/mengurangi ekuitas, antara


lain dampak kumulatif yang disebabkan oleh perubahan kebijakan
akuntansi dan koreksi kesalahan mendasar, misalnya koreksi kesalahan
mendasar dari persediaan yang terjadi pada periodeperiode
sebelumnyadanperubahannilaiasettetapkarenarevaluasiasettetap.

d)

Ekuitasakhir;

Di samping itu, suatu entitas pelaporan menyajikan rincian lebih lanjut dari
unsurunsur yang terdapat dalam Laporan Perubahan Ekuitas dalam Catatan
atasLaporanKeuangan.
7)

CatatanatasLaporanKeuangan
Untuk memudahkan pemahaman dan menghindari kesalahan penafsiran
dalam membaca laporan keuangan, entitas pelaporan harus mengungkapkan
semua informasi penting baik yang telah tersaji maupun yang tidak tersaji
dalamlembarmukalaporankeuangan.

Semua komponen laporan keuangan tersebut disajikan oleh setiap entitas


pelaporan, kecuali Laporan Arus Kas dan Laporan Perubahan SAL yang hanya
disajikan oleh BUN dan entitas pelaporan yang menyusun laporan keuangan
konsolidasiannya.

Manajemen Pemerintahan Pusat

239


f.

KlasifikasiSAPP
SAPPterdiridari:
1)

SistemAkuntansiPusat(SiAP)
Sistem Akuntansi Pusat (SiAP) dilaksanakan oleh Direktorat Jenderal
Perbendaharaan(DitjenPBN)danterdiridari:
a)

SAKUN (Sistem Akuntansi Kas Umum Negara) yang menghasilkan


LaporanArusKasdanNeracaKasUmumNegara(KUN);dan

b)

SAU (Sistem Akuntansi Umum) yang menghasilkan Laporan Realisasi


AnggarandanNeracaSAU.

Pengolahan data dalam rangka penyusunan laporan keuangan SAU dan


SAKUN,dilaksanakanolehunitunitDitjenPBNyangterdiridari:

2)

a)

KantorPelayananPerbendaharaanNegara(KPPN);

b)

KantorWilayahDitjenPerbendaharaan(KanwilDitjenPBN);dan

c)

KantorPusatDitjenPerbendaharaan.

SistemAkuntansiInstansi(SAI)
Sistem Akuntansi Instansi (SAI) dilaksanakan oleh kementerian negara/
lembaga. Kementerian negara/lembaga melakukan pemprosesan data untuk
menghasilkan laporan keuangan. Dalam pelaksanaan SAI, kementerian
negara/lembaga membentuk Unit Akuntansi Keuangan (UAK) dan Unit
AkuntansiBarang(UAB).
UnitAkuntansiKeuanganterdiridari:
a)

UnitAkuntansiPenggunaAnggaran(UAPA);

b)

UnitAkuntansiPembantuPenggunaAnggaranEselon1(UAPPAE1);

c)

UnitAkuntansiPembantuPenggunaAnggaranWilayah(UAPPAW);

d)

UnitAkuntansiKuasaPenggunaAnggaran(UAKPA).

240

2014 |Pusdiklatwas BPKP


UnitAkuntansiBarangterdiridari:
a)

UnitAkuntansiPenggunaBarang(UAPB);

b)

UnitAkuntansiPembantuPenggunaBarangEselon1(UAPPBE1);

c)

UnitAkuntansiPembantuPenggunaBarangWilayah(UAPPBW);dan

d)

UnitAkuntansiKuasaPenggunaBarang(UAKPB).

3)

OuputLaporanKeuanganSAPP
LaporanlaporankeuanganyangdihasilkandariSAPPadalahsebagaiberikut.
Tabel6.3OutputLaporanKeuanganSAPP

SistemAkuntansi

JenisLaporan

PenggunaLaporan
KepalaKPPN

LaporanArusKas

KepalaKanwilDitjenPBN
DirjenPBN
MenteriKeuangan

SAKUN

KepalaKPPN
NeracaKUN

KepalaKanwilDitjenPBN
DirjenPBN

SiAP
LaporanRealisasi
Anggaran
SAU

KepalaKPPN
KepalaKanwilDitjenPBN
DirjenPBN
KepalaKPPN

NeracaSAU

KepalaKanwilDitjenPBN
DirjenPBN

PelaporanPelaksanaan
Anggaran

KepalaKantor
KepalaKanwil
KepalaDaerah(Dekon/TP)

SAI
PelaporanFinansial

PimpinanEselonI
Menteri/PimpinanLembaga

Manajemen Pemerintahan Pusat

241


6.

ReviuAtasLaporanKeuangan
a.

PengertianReviu
Reviu adalah penelaahan atas penyelenggaraan akuntansi dan penyajian laporan
keuangan kementerian/lembaga (LK K/L) untuk memberikan keyakinan terbatas
bahwa akuntansi telah diselenggarakan berdasarkan Sistem Akuntansi Instansi dan
laporan keuangan kementerian/lembaga telah disajikan sesuai dengan Standar
AkuntansiPemerintahan,dalamupayamembantumenteri/pimpinanlembagauntuk
menghasilkanlaporankeuangankementerian/lembagayangberkualitas.
Reviu laporan keuangan sebagaimana disebutkan di atas bertujuan untuk
memberikankeyakinanakurasi,keandalan,dankeabsahaninformasiyangdisajikan
dalam laporan keuangan sebelum disampaikan oleh menteri/pimpinan lembaga
kepada Presiden melalui Menteri Keuangan. Reviu tidak memberikan dasar untuk
menyatakan pendapat sebagaimana dalam audit, karena dalam reviu tidak
mencakup pengujian atas pengendalian intern, penetapan risiko pengendalian,
pengujian catatan akuntansi dan pengujian atas respon terhadap permintaan
keterangan, dengan cara memperoleh bahan bukti yang menguatkan melalui
inspeksi, pengamatan, atau konfirmasi dan prosedur tertentu lainnya yang biasa
dilaksanakandalamaudit.
Ruang lingkup reviu adalah sebatas penelaahan laporan keuangan dan catatan
akuntansi.Sementaraitusasaranreviuadalahuntukmemperolehkeyakinanbahwa
laporan keuangan entitas pelaporan telah disusun dan disajikan sesuai dengan
Standar Akuntansi Pemerintahan. Peraturan Direktur Jenderal Perbendaharaan
nomor44/PMK.07/2006,Pasal1ayat(1)mengatakanbahwareviuadalahprosedur
penelusuran angkaangka dalam laporan keuangan, permintaan keterangan,dan
analitik yang harus menjadi dasar memadai bagi Aparat Pengawas Intern untuk
memberi keyakinan terbatas bahwa tidak ada modifikasi material yang harus
dilakukan atas laporan keuangan agar laporan keuangan tersebut sesuai dengan
StandarAkuntansiPemerintahan.

242

2014 |Pusdiklatwas BPKP


b.

SasaranReviuLaporanKeuanganKementerian/Lembaga
Sasaran reviu adalah penyelenggaraan akuntansi dan penyajian laporan keuangan
kementerian/lembaga termasuk penelaahan atas catatan akuntansi dan dokumen
sumberyangdiperlukan.Dalammelakukanreviutidaktermasukkegiatanpengujian
atassistempengendalianintern,catatanakuntansidandokumensumberdantidak
termasuk pengujian atas respon permintaan keterangan. Dengan demikian reviu
dititikberatkan pada unit akuntansi dan atau akun laporan keuangan
kementerian/lembaga yang berpotensi tinggi terhadap permasalahan dalam
penyelenggaraan akuntansi dan atau penyajian laporan keuangan kementerian
negaraataulembaga.

c.

UnityangMereviuLaporanKeuanganKementerian/Lembaga
SesuaidenganPasal33ayat(3)PeraturanPemerintahNomor8Tahun2006tentang
Pelaporan Keuangan dan Kinerja Instansi Pemerintah dan Peraturan Pemerintah
Nomor 60 Tahun 2008 Pasal 57 ayat 1 serta Pasal 32 ayat (4) sampai dengan (6),
Aparat Pengawasan Intern kementerian negara/lembaga melakukan reviu atas
laporan keuangan kementerian negara/lembaga yang bersangkutan. PMK
171/PMK.05/2007 juga menyebutkan bahwa laporan keuangan kementerian/
lembagayangtelahdirekonsiliasidenganDitjenPBNcq.DirektoratAPKakandireviu
oleh Aparat Pengawasan Intern kementerian negara/lembaga. Selanjutnya dalam
Perdirjen Perbendaharaan Nomor 44/PB/2006 pasal 2 ayat 1 disebutkan bahwa
AparatPengawasanInternkementeriannegara/lembagawajibmelakukanreviuatas
laporankeuangan.Berdasarkanberbagaiperaturandiatasdapatdisimpulkanbahwa
pihakyangwajibmelakukanreviulaporankeuanganadalahAparatPengawasIntern
kementeriannegara/lembaga.Apabilakementeriannegara/lembagabelummemiliki
Aparat Pengawasan Intern, Sekretaris Jenderal/pejabat yang setingkat pada
kementeriannegara/lembagamenunjukbeberapaorangpejabatdiluarbiro/bidang
keuanganuntukmelakukanreviuataslaporankeuangan(PerdirjenPerbendaharaan
Nomor44/PB/2006,Pasal2ayat2).
Pengertian laporan keuangan yang direviu termasuk laporan keuangan dari Dana
Dekonsentrasi dan Tugas Pembantuan sebagaimana disebutkan dalam PMK
248/PMK.07/2010.

Manajemen Pemerintahan Pusat

243


d.

StandarReviuatasLaporanKeuangan
Sesuai dengan amanah Peraturan Pemerintah Nomor 60 Tahun 2008 pasal 57
MenteriKeuangantelahmenetapkanPMKNomor41/PMK.09/2010tentangStandar
Reviu atas Laporan Keuangan Kementerian Negara/Lembaga. Standar Reviu atas
laporan keuangan kementerian negara/lembaga, yang selanjutnya disebut Standar
Reviu, adalah prasyarat yang diperlukan oleh aparat pengawasan intern
kementerian negara/lembaga untuk menjalankan dan mengevaluasi pelaksanaan
reviuataslaporankeuangankementeriannegara/lembaga.
Standartersebutdiatasbertujuanuntuk:
1)

memberikanprinsipprinsipdasaryangdiperlukandalampraktekreviu;

2)

menyediakan kerangka untuk menjalankan dan meningkatkan nilai tambah


reviu;

3)

menetapkandasardasaruntukmengevaluasipelaksanaanreviu;dan

4)

mendorong

peningkatan

kualitas

laporan

keuangan

kementerian

negara/lembaga.
e.

LangkahLangkahMereviuLaporanKeuanganKementerian/Lembaga
Dilihatdariwaktupelaksanaan,reviuataslaporankeuangandilakukansecaraparalel
dengan pelaksanaan anggaran dan penyusunan laporan keuangan kementerian
negara/lembaga. Yang dimaksud paralel adalah reviu dilakukan sepanjang
pelaksanaananggarandantidakmenunggulaporankeuangankementerian/lembaga
selesai disusun. Kebijakan ini diambil karena terbatasnya waktu yang tersedia bagi
kementerian/lembaga untuk menyusun dan menyampaikan laporan keuangan ke
MenteriKeuangan.
Untuk mencapai tujuan reviu sebagaimana telah dibahas pada bagian di atas,
apabilapereviumenemukankelemahandalampenyelenggaraanakuntansidan/atau
kesalahandalampenyajianlaporankeuangan,makapereviubersamasamadengan
unitakuntansiharussegeramelakukanperbaikandan/ataukoreksiataskelemahan
danataukesalahantersebutsecaraberjenjang.

244

2014 |Pusdiklatwas BPKP


Reviudilakukandenganaktivitaspertama,menelusurilaporankeuangankecatatan
akuntansi dan dokumen sumber. Kedua, meminta keterangan mengenai proses
pengumpulan, pengikhtisaran, pencatatan dan pelaporan transaksi keuangan.
Ketiga,memintaketeranganmengenaikompilasidanrekonsiliasilaporankeuangan
kementerian/lembaga dengan Bendahara Umum Negara secara berjenjang. Dan
keempat, kegiatan analitik untuk mengetahui hubungan dan halhal yang
kelihatannyatidakbiasa.
Terdapatbeberapalangkahreviuyaitu:
1)

pastikan bahwa rekonsiliasi belanja telah dilakukan antara unit akuntansi


denganKPPNmelaluipermintaanketerangandanpenelusurankeBeritaAcara
Rekonsiliasi;

2)

lakukan uji petik atas transaksi belanja dan pastikan bahwa setiap transaksi
tersebuttelahdidukungdokumenpengeluaranyangsah,melaluipenelusuran
ke dokumen Surat Perintah Membayar (SPM) dan Surat Perintah Pencairan
Dana(SP2D);

3)

pastikan bahwa pengembalian belanja hanya merupakan transaksi


pengembalianbelanjauntukperiodeberjalan,melaluipermintaanketerangan
dan penelusuran jurnal transaksi ke dokumen Surat Setoran Bukan Pajak
(SSPB);

4)

pastikan bahwa pengembalian belanja periode sebelumnya telah diakui dan


dicatat sebagai Penerimaan Negara Bukan Pajak, dengan melakukan
permintaan keterangan dan penelusuran jurnal transaksi ke dokumen SSBP;
dan

5)

pastikan bahwa setiap belanja modal telah dicatat dalam jurnal korolari dan
menambah aset tetap, dengan melakukan penelusuran dokumen SPM dan
SP2Dkejurnalnya.

Manajemen Pemerintahan Pusat

245


f.

SyaratSyaratPereviuLaporanKeuanganKementerian/Lembaga
Untuk mencapai efektivitas reviu atas laporan keuangan, pereviu harus memiliki
kompetensi tertentu. Sesuai dengan tujuan reviu, tim reviu secara kolektif
seharusnyamemilikikompetensisebagaiberikut:
1)

menguasaiStandarAkuntansiPemerintahan;

2)

menguasai Sistem Akuntansi Instansi yaitu Sistem Akuntansi Keuangan dan


SistemManajemendanAkuntansiBarangMilikNegara;

g.

3)

memahamiprosesbisnisataukegiatanpokokunitakuntansiyangdireviu;

4)

menguasaidasardasaraudit;

5)

mengusasiteknikkomunikasi;

6)

memahamianalisisbasisdata.

LaporanReviuLaporanKeuanganKementerian/Lembaga
HasilreviudituangkandalamPernyataanTelahDireviudansesuaidenganPerdirjen
Perbendaharaan nomor 44/PB/2006 pasal 3 ayat (3). Pernyataan Telah Direviu
ditandatangani oleh aparat pengawasan intern kementerian negara/lembaga.
Selanjutnya, sesuai dengan pasal 4 ayat (1) Pernyataan Telah Direviu merupakan
salah satu dokumen pendukung untuk penyusunan Statement of Responsibility
(Pernyataan Tanggung Jawab) oleh menteri/pimpinan lembaga. Pasal 4 ayat (2)
menyatakan bahwa laporan keuangan kementerian negara/lembaga yang
disampaikankepadaMenteriKeuangandisertaidenganPernyataanTanggungJawab
yangditandatanganiolehmenteri/pimpinanlembagadanPernyataanTelahDireviu
yangditandatanganiolehaparatpengawasaninternkementeriannegara/lembaga.
Pertanggungjawaban atas pelaksanaan APBN dalam bentuk laporan keuangan
sebelumdisampaikanolehPresidenkepadaDPR,diperiksaterlebihdahuluolehBPK.
Bab VIII membahas mengenai pemeriksaan pengelolaan dan tanggung jawab
keuangannegara.

246

2014 |Pusdiklatwas BPKP


C.

PELAPORANLAINNYA

1.

Laporan pemantauan pelaksanaan RenjaKL yang meliputi pelaksanaan program dan


kegiatan sesuai dengan tugas dan kewenangannya. Pemantauan dilakukan terhadap
perkembangan realisasi penyerapan dana, realisasi pencapaian target keluaran (output),
dankendalayangdihadapi.DisampaikansetiaptriwulanankepadaMenteriPPN,Menkeu,
Menpan.
Laporan hasil evaluasi pelaksanaan RenjaKL Disampaikan setiap tahun kepada Menteri
PPN.

2.

Laporan Pelaksanaan Program Prioritas Pembangunan Nasional (Inpres Nomor 1 Tahun


2010)
Instruksi Presiden kepada para Menko/Menteri/Kepala Lembaga untuk mengambil
langkahlangkah yang diperlukan sesuai tugas, fungsi dan kewenangan masingmasing,
dalam rangka Percepatan Pelaksanaan Prioritas Pembangunan Nasional tahun 2010,
dengan merujuk pada Prioritas Pembangunan Nasional dalam Rencana Pembangunan
Jangka Menengah Nasional Tahun 20102014, pelaksanaan program 100 hari Kabinet
IndonesiaBersatuII,danhasilrapatkerjaantaraPresidendanParaMenteridanGubernur
padatanggal23Februari2010.Untukitu,agarpenyusunanLaporanPelaksanaanInpres
No.1Tahun2010dapatdilaksanakansecaraefektifdanefisien,makadiperlukanstandar
pelayanan.
Tabel6.4FormulirLaporanPelaksanaanProgramPrioritasPembangunanNasional
Kementerian/Lembaga/Instansi

Periode

UnitOrganisasi :
Kegiatan
1

Penanggung Instansi
Kreteria
Ukuran
Jawab
Terkait Keberhasilan Keberhasilan
2

Ukuran
Keberhasilan B...

%
Capai

Ket

Manajemen Pemerintahan Pusat

247


3.

LaporanRealisasiRencanaAksiPencegahandanPemberantasanKorupsi
Tabel6.5FormulirLaporanRealisasiRencanaAksiPencegahandan
PemberantasanKorupsiK/L/I

Periode
Unit Organisasi

:
:

Aksi

Penanggung
Jawab

Instansi
Terkait

Kreteria
Keberhasilan

Ukuran
Keberhasilan

Ukuran
Keberhasilan B...

%
Capai

Ket

4.

LPJBendahara
LPJBendaharaadalahlaporanyangdibuatolehBendaharaPenerimaan/Pengeluaranatas
uang/surat berharga yang dikelolanya sebagai pertanggungjawaban pengelolaan uang,
memenuhi ketentuan Dirjen Perbendaharaan Nomor PER3/PB/2014 tentang Petunjuk
Teknis Penatausahaan, Pembukuan, dan Pertanggungjawaban Bendahara pada Satuan
Kerja Pengelola APBN serta Verifikasi Laporan Pertanggungjawaban Bendahara. LPJ
Bendahara disusun secara bulanan, berdasarkan BKU, bukubuku pembantu, dan Buku
Pengawasan Anggaran yang telah diperiksa dan direkonsiliasi oleh KPA/PPK atas nama
KPA.

248

2014 |Pusdiklatwas BPKP

BabVII
AUDITINTERNAL

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenai
dampakdariauditinternalterhadaptatakelolasektorpublik.

A.

KONSEPSIAUDITINTERNAL

1.

Pengertian
Definisi audit intern menurut The Institute of Internal Auditor atau IIA adalah kegiatan
pemastian(assurance)dankonsultasiyangindependendanobjektifyangdirancanguntuk
menambah nilai dan meningkatkan operasi organisasi. Audit internal membantu
organisasi mencapai tujuannya melalui pendekatan yang sistematik dan teratur untuk
mengevaluasidanmeningkatkanefektivitasprosesmanajemenrisiko,pengendalian,dan
tatakelola.
Sesuai dengan definisi audit internal di atas, maka kegiatan utama audit intern adalah
pemberianjasaassurance(pemastian)danconsultancy(konsultasi).Perbandinganantara
jasaassurancedanconsultancyadalahsebagaiberikut:
Tabel7.1PerbandinganJasaAssurancedanJasaPemastian

Aspek
Definisi

JasaPemastian
Pemeriksaanyangobjektifterhadap
buktibuktidengantujuan
memberikanpenilaianyang
independenterhadaptatakelola,
manajemenrisiko,danproses
pengendalianorganisasi.
Contoh:keuangan,kinerja,
ketaatan,keamanansistem,dan
penugasanduediligence.

Manajemen Pemerintahan Pusat

JasaKonsultasi
Kegiatanpemberianjasanasihat
(advisory)danjasayangterkait
denganklien,dimanasifatdanruang
lingkupnyadisepakatidenganklien,
dandimaksudkanuntukmenambah
nilaidanmeningkatkanmenambah
nilaidanmeningkatkantatakelola
organisasi,manajemenrisiko,dan
prosespengendalian,tanpaauditor
internmemikultanggungjawab

249


Aspek

JasaPemastian

JasaKonsultasi
manajemen.
Contoh:pemberiannasihat,saran,
fasilitasi,danpelatihan.

Maksudutama Memberikanpenilaianindependen
penugasan

Memberikanjasanasihat,diklat,
ataufasilitasi

Pihakyang
terlibat

Adatigapihak,yaitu:

Adaduapihak,yaitu:

1. Auditan/pemilikproses:

1. Klien:orang/kelompokyang

orang/kelompokyangterlibat
langsungdalamsuatuproses,
sistem,atauhallainnya

meminta/menerimajasa

2. Auditorintern:orang/kelompok
yangmenawarkan/memberikan
jasa

2. Auditorintern:orang/kelompok
yangmelakukanpenilaian

3. Pengguna:orang/kelompokyang
menggunakanhasilpenilaian
independen
Lingkup
kegiatan

Ditentukanolehauditorintern

Sifatdanlingkupnyaditentukan
olehkliendenganpersetujuan
auditor

Output

Penilaian,opini,atausimpulan

Pemberiannasihat,saran,dan
penambahannilaiterhadaptata
kelolaorganisasi,manajemen
risiko,danprosespengendalian.

Di sektor publik/pemerintah, audit intern merupakan fungsi manajemen yang penting


dalampenyelenggaraanpemerintahan.Melaluiauditinterndapatdiketahuiapakahsuatu
instansi pemerintah telah melaksanakan kegiatan sesuai dengan tugas dan fungsinya
secara efektif dan efisien, serta sesuai dengan ketentuan, rencana, dan kebijakan yang
telah ditetapkan. Selain itu, audit intern atas penyelenggaraan pemerintahan diperlukan
untukmendorongterwujudnyagoodgovernancedancleangovernmentsertamendukung
penyelenggaraan pemerintahan yang efektif, efisien, transparan, akuntabel serta bersih
danbebasdaripraktikkorupsi,kolusi,dannepotisme.
Auditorinternpemerintahharusmampumeresponssecaraaktifberbagaipermasalahan
dan perubahan yang terjadi, baik di bidang politik, ekonomi maupun sosial melalui
program dan kegiatan pengawasan. Selain itu, pelaksanaan audit intern diarahkan pada

250

2014 |Pusdiklatwas BPKP


upaya membantu presiden/menteri/gubernur/bupati/walikota dalam mencapai tujuan
organisasi.
Audit intern di lingkungan pemerintah Indonesia dilakukan oleh APIP. Pengertian APIP
menurut Permenpan Nomor PER/05/M.PAN/03/2008 tentang Standar Audit Aparat
Pengawasan Intern Pemerintah adalah Pegawai Negeri Sipil (PNS) yang mempunyai
jabatan fungsional auditor dan/atau pihak lain yang diberi tugas, wewenang, tanggung
jawab dan hak secara penuh oleh pejabat yang berwenang melaksanakan pengawasan
padainstansipemerintahuntukdanatasnamaAPIP.
Pengertian auditor intern bisa merujuk pada individu yang melakukan audit maupun
institusi yang memerintahkannya. Dalam struktur pemerintahan Indonesia, institusi atau
unit kerja yang berperan sebagai internal auditor pemerintah (APIP) terdiri atas Badan
PengawasanKeuangandanPembangunan(BPKP),InspektoratJenderalKementerian,unit
pengawasan pada Lembaga Pemerintah NonKementerian (LPNK) dan lembaga negara,
danInspektoratProvinsidanKabupaten/Kota.
Sedangkan unit kerja yang diaudit atau auditan, menurut Peraturan Menteri
Pendayagunaan Aparatur Negara Nomor PER/05/M.PAN/03/2008 adalah orang/instansi
pemerintahyangdiauditolehAPIP.Dalampengertianumum,auditanadalahpihakyang
melaksanakandanbertanggungjawabatashalyangdinilaiolehauditor.
Dengandemikianauditanadalahseluruhinstansipemerintahan.Pengertianinstansidisini
mencakup semua tingkatan satuan organisasi dalam pemerintahan. Sebagai contoh,
auditan bisa berupa pemerintah pusat (kementerian/lembaga), pemerintah daerah
(provinsi,kabupaten/kota),departemen,direktoratjenderal,unitpelaksananteknis,dinas
diprovinsi/kabupaten/kota,ataupelaksanakegiatanpadasuatudinastertentu.
TatacarapengawasanpelaksanaanrencanapembangunanyangdilakukanolehPimpinan
Kementerian/Lembaga/SKPDdilaksanakansesuaidenganperaturanperundangundangan.
2.

JenisAuditInternal
SebagaimanaditetapkandalamPPNomor60 Tahun2008tentangSPIP,APIPmelakukan
pengawasaninternmelalui:

Manajemen Pemerintahan Pusat

251


a.

Audit
Auditadalahprosesidentifikasimasalah,analisis,danevaluasibuktiyangdilakukan
secara independen, objektif dan profesional berdasarkan standar audit, untuk
menilai kebenaran, kecermatan, kredibilitas, efektifitas, efisiensi, dan keandalan
informasipelaksanaantugasdanfungsiinstansipemerintah.

b.

Reviu
Reviuadalahpenelaahanulangbuktibuktisuatukegiatanuntukmemastikanbahwa
kegiatan tersebut telah dilaksanakan sesuai dengan ketentuan, standar, rencana,
ataunormayangtelahditetapkan.

c.

Evaluasi
Evaluasi adalah rangkaian kegiatan membandingkan hasil/prestasi suatu kegiatan
dengan standar, rencana, atau norma yang telah ditetapkan, dan menentukan
faktor faktor yang mempengaruhi keberhasilan atau kegagalan suatu kegiatan
dalammencapaitujuan.

d.

Pemantauan
Pemantauan adalah proses penilaian kemajuan suatu program/kegiatan dalam
mencapaitujuanyangtelahditetapkan.

e.

KegiatanPengawasanLainnya
Kegiatanpengawasanlainnyaantaralainberupasosialisasimengenaipengawasan,
pendidikandanpelatihanpengawasan,pembimbingandankonsultansi,pengelolaan
hasilpengawasan,danpemaparanhasilpengawasan.Kegiatanpengawasanlainnya
lebihbanyakbersifatkonsultasi.

B.

DAMPAKDARIAUDITINTERNALTERHADAPTATAKELOLASEKTORPUBLIK

Sesuai Standar Internasional untuk Praktik Profesional Audit Internal, lingkup aktivitas audit
internal di antaranya adalah tata kelola (governance). Pada Standar 2110 yang mengatur
tentang tata kelola disebutkan bahwa aktivitas audit internal harus menilai dan membuat
rekomendasi yang sesuai untuk memperbaiki proses tata kelola organisasi dalam rangka
pemenuhantujuantujuansebagaiberikut:

252

2014 |Pusdiklatwas BPKP


1.

Mempromosikanetikadannilainilaiyangpantasdidalamorganisasi.

2.

Memastikanmanajemendanakuntabilitaskinerjaorganisasiyangefektif.

3.

Mengkomunikasikan informasi risiko dan pengendalian pada areaarea yang terkait di


dalamorganisasi.

4.

Mengkoordinasikan kegiatan serta mengkomunikasikan informasi di antara dewan,


auditoreksternaldaninternal,danmanajemen.

Peran audit internal sebagaimana tercantum dalam definisi Internal audit meliputi pula
tanggung jawab untuk mengevaluasi dan memperbaiki proses tata kelola sebagai bagian dari
fungsipemastian(assurance).

Manajemen Pemerintahan Pusat

253

254

2014 |Pusdiklatwas BPKP

BabVIII
PEMERIKSAANPENGELOLAANDAN
TANGGUNGJAWABKEUANGANNEGARA

IndikatorKeberhasilan
Setelahmempelajaribabini,pesertadiklatdiharapkanmemilikipengetahuanmengenaiprinsip
prinsipakuntabilitassektorpublik.

Pemeriksaan pengelolaan dan tanggung jawab keuangan negara merupakan bagian dari siklus
APBN sebelum disyahkannya pertanggungjawaban pengeloaan keuangan negara menjadi
undangundang. Melalui pemeriksaan yang dilaksanakan oleh BPK tersebut, pengelolaan dan
tanggungjawabkeuangannegarayangdiasersiolehpemerintahmelaluilaporankeuanganakan
dinilaikewajarannya.
Pemeriksaan adalah proses identifikasi masalah, analisis, dan evaluasi yang dilakukan secara
independen, objektif, dan profesional berdasarkan standar pemeriksaan, untuk menilai
kebenaran, kecermatan, kredibilitas, dan keandalan informasi mengenai pengelolaan dan
tanggung jawab keuangan negara. Pemeriksaan keuangan negara dilakukan oleh BPK yang
meliputipemeriksaanataspengelolaankeuangannegaradanpemeriksaanatastanggungjawab
keuangannegara.

A.

LINGKUPPEMERIKSAAN

Pemerintah mengemban amanat untuk menjalankan tugas pemerintahan melalui peraturan


perundangundangan.Untukpenyelenggaraanpemerintahandimaksud,pemerintahmemungut
berbagai macam jenis pendapatan dari rakyat, kemudian membelanjakannya untuk
penyelenggaraan pemerintahan dalam rangka pelayanan kepada rakyat. Dalam hal ini,
kedudukanpemerintahadalahsebagaiagendarirakyatsedangkanrakyatsebagaiprinsipalnya.
Sebagai agen, pemerintah wajib mempertanggungjawabkan pengelolaan keuangannya kepada
rakyatyangdiwakiliolehDPR.
Dalam pola hubungan antara pemerintah sebagai agen dan DPR sebagai wakil dari prinsipal,
terdapat ketidakseimbangan pemilikkan informasi. Lembaga perwakilan tidak mempunyai
Manajemen Pemerintahan Pusat

255


informasi secara penuh apakah laporan pertanggungjawaban atas pengelolaan keuangan dari
eksekutif telah mencerminkan kondisi yang sesungguhnya, apakah telah sesuai dengan
peraturanperundangundangan,menerapkansistempengendalianinternsecaramemadaidan
pengungkapan secara paripurna. Oleh karena itu, diperlukan pihak yang kompeten dan
independen untuk menguji laporan pertanggungjawaban tersebut. Lembaga yang berwenang
untuk melakukan pemeriksaan atas laporan pertanggungjawaban tersebut adalah Badan
Pemeriksa Keuangan (BPK). Ketentuan tentang pemeriksaan oleh BPK diatur dalam Undang
Undang Nomor 15 Tahun 2004 tentang Pemeriksaan Tanggung Jawab dan Pengelolaan
Keuangan Negara. Sedangkan ketentuan tentang Badan Pemeriksa Keuangan sebagai institusi
pemeriksa diatur dalam UndangUndang Nomor 15 Tahun 2006 tentang Badan Pemeriksa
Keuangan.
SebagaimanatelahditetapkandalamUUDRITahun1945,pemeriksaanyangmenjaditugasBPK
meliputi pemeriksaan atas pengelolaan keuangan dan pemeriksaan atas tanggung jawab
keuangan negara. Pemeriksaan tersebut mencakup seluruh unsur keuangan negara. Oleh
karena itu, kepada BPK diberikan kewenangan untuk melakukan 3 (tiga) jenis pemeriksaan
yaitu:pemeriksaankeuangan,pemeriksaankinerja,danpemeriksaandengantujuantertentu.
1.

PemeriksaanKeuangan
Pemeriksaan keuangan adalah pemeriksaan atas laporan keuangan pemerintah.
Pemeriksaan ini dilakukan dalam rangka pemberian opini atas kewajaran penyajian
laporan keuangan. Hasil pemeriksaan keuangan oleh BPK akan menghasilkan opini yang
merupakan pernyataan profesional pemeriksa mengenai kewajaran informasi keuangan
yangdisajikan.Kriteriauntukpemberianopiniadalahsebagaiberikut:
a.

kesesuaiandenganStandarAkuntansiPemerintahan;

b.

kecukupanpengungkapan;

c.

kepatuhanterhadapperaturanperundangundangan;dan

d.

efektivitassistempengendalianintern.

Penilaianatasempatkriteriadiatasakanmenentukanpemberianopiniterhadaplaporan
keuanganyangmeliputilimajenissebagaiberikut:

256

2014 |Pusdiklatwas BPKP


a.

wajartanpapengecualian(unqualifiedopinion),

b.

wajartanpapengecualiandenganparagrafpenjelas,

c.

wajardenganpengecualian(qualifiedopinion),

d.

tidakwajar(adversedopinion),dan

e.

pernyataanmenolakmemberikanopini(disclaimerofopinion).

Opini Wajar Tanpa Pengecualian (WTP) diberikan jika pospos laporan keuangan tidak
mengandung salah saji material dan laporan keuangan secara keseluruhan disajikan
secara wajar. Opini WTP dengan paragraf penjelas diberikan apabila terdapat
permasalahan yang belum dapat dituntaskan tetapi tidak berpengaruh secara signifikan
terhadap kewajaran laporan keuangan. Opini wajar dengan pengecualian jika terdapat
pospostertentudalamlaporankeuanganmengandungsalahsajisecaramaterialnamun
secara keseluruhan tidak mengganggu kewajaran laporan keuangan. Opini tidak wajar
diberikanjikaposposlaporankeuanganmengandungsalahsajimaterialsehinggalaporan
keuangansecarakeseluruhantidakwajar.Opinidisclaimerdiberikanjikapemeriksatidak
dapat memperoleh keyakinan atas kewajaran informasi yang disajikan dalam laporan
keuangan.
2.

PemeriksaanKinerja
Pemeriksaan kinerja sering juga disebut value for money audit. Pemeriksaan kinerja
adalahpemeriksaanatasaspekekonomidanefisiensi,sertapemeriksaanatasefektivitas.
Pemeriksaaninilazimdilakukanolehaparatpengawasaninternuntukkepentinganjajaran
manajemen. Namun demikian UUD RI Tahun 1945 juga mengamanatkan kepada BPK
untuk melakukan pemeriksaan kinerja, terutama untuk mengidentifikasi areaarea yang
potensialuntukpeningkatankinerjayangmenjadiperhatianlembagaperwakilan.
Hasil pemeriksaan kinerja adalah temuan, kesimpulan, dan rekomendasi. Pemeriksaan
kinerja antara lain dilakukan dengan melakukan evaluasi atas efisiensi pelaksanaan
kegiatansertaefektivitassuatuprogram.Pemeriksaankinerjatidakdapatdilepaskandari
hierarkikriteriadanindikatorkinerja.Hierarkitersebutdapatdilihatpadagambarberikut.

Manajemen Pemerintahan Pusat

257


Gambar8.1HierarkiKriteriadanIndikatorKinerja

PolicyGoals

ProgramObjectives

Planned Outcomes

process

ActualOutcomes
Effectiveness

Planned Outputs

process

ActualOutputs
Efficiency

Planned Inputs

process

Actual Inputs

Compliance

Adapunbagipemerintah,pemeriksaankinerjainidimaksudkanuntukmengarahkanagar
sumber daya yang tersedia dimanfaatkan secara efisien dan efektif untuk pelayanan
kepadamasyarakat.
3.

PemeriksaandenganTujuanTertentu
Pemeriksaan dengan tujuan tertentu adalah pemeriksaan yang dilakukan dengan tujuan
khusus, di luar pemeriksaan keuangan dan pemeriksaan kinerja. Termasuk dalam
pemeriksaaniniadalahpemeriksaanatashalhallainyangbersifatkeuangan,pemeriksaan
atassistempengendalianintern,danpemeriksaaninvestigatif.
Hasil pemeriksaan dengan tujuan tertentu adalah kesimpulan. Dalam hal pemeriksaan
investigatif, apabila diketemukan adanya indikasi tindak pidana atau tindakan yang
membawa dampak pada kerugian negara, BPK segera melaporkannya kepada instansi
yangberwenangsesuaidenganperaturanperundangundangan.

258

2014 |Pusdiklatwas BPKP


B.

PELAKSANAANPEMERIKSAAN

BPK mempunyai kebebasan dan kemandirian dalam melaksanakan pemeriksaan. Kemandirian


initermasukdalamperencanaanpemeriksaan,pelaksanaanpemeriksaan,maupunpenyusunan
danpenyajianlaporanhasilpemeriksaan.Kebebasandalamperencanaanmencakuppenetapan
objekpemeriksaan(auditee),kecualiuntukobjekpemeriksaanyangtelahdiaturdalamundang
undangatauberdasarkanpermintaankhususdarilembagaperwakilan.
Dalampelaksanaanpemeriksaan,BPKdapatmemanfaatkaninformasidariberbagaipihakyang
kompeten dan terkait, seperti hasil pemeriksaan aparat pengawasan intern pemerintah,
masukandarilembagalegislatif,sertainformasidaripihaklainyangandal.Dalampelaksanaan
pemeriksaan, BPK dapat memanfaatkan anggaran serta sumber daya yang dimiliki secara
mandiridanakuntabel.DenganmekanismeyangdemikiandiharapkanBPKdapatmemfokuskan
pemeriksaannyapadahalhalyangmenjadiperhatianlembagalegislatifsertapadaberbagaihal
yangberdampakpadakewajaranpenyajianlaporankeuangan,efisiensi,danefektivitasprogram
dankegiatan.
Selama menjalankan pemeriksaan, BPK dapat mengakses data yang diperlukan, meminta
informasidariorangorangterkait,memperolehbuktidokumen,wawancara,maupunbuktifisik
untuk mendukung hasil pemeriksaannya, termasuk melakukan penyegelan tempat
penyimpananuang,barang,ataudokumenjikadipandangperlu.
Standar Pemeriksaan Keuangan Negara (SPKN) yang ditetapkan dengan Peraturan Ketua BPK
Nomor1Tahun2007mengamanatkanbahwapemeriksaanharusdilaksanakanolehpemeriksa
yang kompeten. Apabila BPK tidak mempunyai tenaga ahli pada bidang tertentu, sementara
keahlianinidiperlukan,makaBPKdapatmenggunakanbantuantenagaahlidariluarBPK.
Di dalam UndangUndang Nomor 15 Tahun 2004 tentang Pemeriksaan Pengelolaan dan
TanggungJawabKeuanganNegara,diatursecarakhususmengenaiketentuanpidanapadapasal
24sampaipasal26denganmateripokoksebagaiberikut.

Manajemen Pemerintahan Pusat

259


Tabel8.1KetentuanPidanaTerkaitPemeriksaanPengelolaan
danTanggungJawabKeuanganNegara

No

Subjek

Pelanggaran
(dengansengaja)

AncamanPidanaMaksimal

1.

Setiaporang

tidakmenjalankankewajiban
menyerahkandokumendan/atau
menolakmemberikanketerangan
yangdiperlukanuntukkepentingan
kelancaranpemeriksaan

penjarasatutahunenambulan
dan/ataudendaRp500.000.000,00

2.

Setiaporang

mencegah,menghalangi,dan/atau
menggagalkanpelaksanaan
pemeriksaan

penjarasatutahunenambulan
dan/ataudendaRp500.000.000,00

3.

Setiaporang

menolakpemanggilanyang
dilakukanolehBPKtanpa
menyampaikanalasanpenolakan
secaratertulis

penjarasatutahunenambulan
dan/ataudendaRp500.000.000,00

4.

Setiaporang

memalsukanataumembuatpalsu
dokumenyangdiserahkan

penjaratigatahundan/ataudenda
Rp1.000.000.000,00

5.

Setiap
pemeriksa

mempergunakandokumenyang
diperolehdalampelaksanaantugas
pemeriksaanmelampauibatas
kewenangannya

penjaratigatahundan/ataudenda
Rp1.000.000.000,00

6.

Setiap
pemeriksa

menyalahgunakankewenangannya
sehubungandengankedudukan
dan/atautugaspemeriksaan

penjarasatutahundanpalinglama
limatahundan/ataudendasetinggi
tingginyaRp1.000.000.000,00

7.

Setiap
pemeriksa

tidakmelaporkantemuan
pemeriksaanyangmengandung
unsurpidanayangdiperolehnya
padawaktumelakukanpemeriksaan

penjarasatutahunenambulan
dan/ataudendapalingbanyak
Rp500.000.000,00

8.

Setiaporang

tidakmemenuhikewajibanuntuk
menindaklanjutirekomendasiyang
disampaikandalamlaporanhasil
pemeriksaan

penjarasatutahunenambulan
dan/ataudendapalingbanyak
Rp500.000.000,00

Ketentuan mengenai pemeriksaan atas laporan keuangan sebagaimana dimaksud dalam


UndangUndang Nomor 15 Tahun 2004 dilaksanakan mulai laporan keuangan tahun anggaran
2006,denganketentuantransisisebagaiberikut.
a.

Tata cara penyelesaian ganti kerugian negara selambatlambatnya satu tahun setelah
berlakunyaUndangUndangNomor15Tahun2004.

260

2014 |Pusdiklatwas BPKP


b.

Penyelesaian ganti kerugian negara/daerah yang sedang dilakukan oleh BPK dan/atau
Pemerintah pada saat UndangUndang Nomor 15 Tahun 2004 mulai berlaku dan belum
ditetapkannyatatacarapenyelesaiangantikerugiannegara,dilaksanakansesuaidengan
ketentuanperaturanperundangundanganyangadasebelumberlakunyaUndangUndang
Nomor15Tahun2004.

C.

HASILPEMERIKSAANDANTINDAKLANJUT

Hasil pemeriksaan BPK dituangkan dalam Laporan Hasil Pemeriksaan (LHP) segera setelah
berakhirnya pemeriksaan. LHP ini disampaikan kepada lembaga legislatif sesuai dengan
kewenangannya. Pada saat yang bersamaan, LHP ini juga disampaikan kepada presiden/
gubernur/bupati/walikota untuk ditindaklanjuti. Hasil pemeriksaan BPK akan digunakan oleh
pemerintah untuk melakukan koreksi atau penyesuaianpenyesuaian yang diperlukan. Di
samping itu, pemerintah berkewajiban menyampaikan tanggapan atas temuan hasil
pemeriksaan. Tanggapan ini wajib dimuat dalam LHP. Dengan dimuatnya tanggapan ini maka
pengguna dapat memperoleh informasi secara berimbang dari pemeriksa dan dari objek yang
diperiksa(auditee).
BPK wajib menyusun ikhtisar hasil pemeriksaan yang dilakukan selama 1 (satu) semester.
Ikhtisar ini disampaikan kepada lembaga legislatif sesuai dengan kewenangannya dan kepada
presidensertagubernur/bupati/walikotayangbersangkutanagarmemperolehinformasisecara
menyeluruhtentanghasilpemeriksaan.
Hasil pemeriksaan yang telah disampaikan kepada lembaga legislatif berarti telah
dipertanggungjawabkan kepada publik. Oleh karena itu, terhadap hasil pemeriksaan tersebut
dinyatakan terbuka untuk umum, sehingga dapat diakses oleh masyarakat. Selanjutnya,
Pemerintah berkewajiban melaksanakan tindak lanjut atas rekomendasi BPK. Di sisi lain, BPK
wajibmemantauperkembanganpelaksanaantindaklanjuttersebutsertamenginformasikannya
kepadalembagalegislatifterkait.

Manajemen Pemerintahan Pusat

261

262

2014 |Pusdiklatwas BPKP

DaftarPustaka

Badan Pemeriksa Keuangan. 1976. Petunjuk Pelaksanaan Tuntutan Perbendaharaan dan


TuntutanGantiRugi.
BadanPengawasanKeuangandanPembangunan.2000.ManajemenPemerintahanBaru.
Badan Pengawasan Keuangan dan Pembangunan. 1993. Pedoman Penanganan Penggantian
KerugianNegara.
Djoko Susilo. 2005. Good Governance Melalui Implementasi SAKIP, Kementerian
PendayagunaanAparaturNegara.Jakarta.
Goedhart C. 1981. GarisGaris Besar Ilmu Keuangan Negara. Ratmoko, penerjemah. Jakarta:
PenerbitJembatan.
George R. Terry, 2000. PrinsipPrinsip Manajemen. (edisi bahasa Indonesia). PT Bumi Aksara:
Bandung.
Hadi,M.1981.AdministrasiKeuanganRI.Jakarta.
InpresNomor7Tahun1999tentangAkuntabilitasKinerjaInstansiPemerintah.
InpresNomor5Tahun2004tentangPercepatanPemberantasanKorupsi.
Kementerian Keuangan RI. 2011. Tim Percepatan Pelaksanaan Akuntabilitas Keuangan
Pemerintah.ModulKeuanganNegara.
Keputusan Presiden Nomor 42 Tahun 2002 sebagaimana telah diubah dengan Keputusan
Presiden Nomor 53 Tahun 2010 tentang Perubahan Kedua atas Kepres Nomor 42
Tahun2002tentangPedomanPelaksanaanAPBN.
KementerianPANdanReformasiBirokrasi,ModulPenyusunanLAKIP,2010.
KementerianDalamNegeridanLembagaAdministrasiNegara,ModulDiklatTeknisAkuntabilitas
KinerjaInstansiPemerintah,2007.
KomisiPemberantasanKorupsiRepublikIndonesia,RencanaStrategisTahun20082011.
Lembaga Administrasi Negara (LAN), Modul Sistem Akuntabilitas Kinerja Instansi Pemerintah,
EdisiKedua,2004,Jakarta.
_________, Pedoman Penyusunan dan Pelaporan Akuntabilitas Kinerja Instansi Pemerintah,
2003,Jakarta.
LeonardD.,Goodstein,TimothyM.,Nolan,andJ.WilliamPfelffer.AppliedStrategicPlanning.
McGrrawHill,Inc.

Manajemen Pemerintahan Pusat

263


LembagaAdministrasiNegaradanBPKP,AkuntabilitasdanGoodGovernance,2000,Jakarta.
Mardiasmo.2004.AkuntansiSektorPublik.Yogyakarta:PenerbitAndi.
Mulgan,Richard.,HoldingPowertoAccount,Palgrave,2003,NewYork.
Peraturan Direktur Jenderal Perbendaharaan Nomor PER66/PB/2005 sebagaimana telah
diubah dengan Perdirjen Nomor 11/PB/2010 tentang Mekanisme Pelaksanaan
PembayaranatasBebanAPBN.
__________, Nomor: PER01/PB/2006 tentang Petunjuk Teknis Pengesahan dan Pencairan
Daftar Isian Pelaksanaan Anggaran (DIPA) Dana Alokasi Khusus (DAK) Tahun
Anggaran2006.
Peraturan Menteri Keuangan Nomor 112/PMK.02/2012 tentang Petunjuk Penyusunan dan
PenelaahanRKAKLTahun2013.
_________, Nomor 134 Tahun 2005 tentang Pedoman Pembayaran dalam Pelaksanaan
AnggaranPendapatandanBelanjaNegara.
_________, Nomor 171/PMK.02/2013 Tanggal 29 November 2012 tentang Petunjuk
PenyusunandanPengesahanDIPA.
_________, Nomor: 190/PMK.06/2012 tentang Pedoman Pembayaran dalam Pelaksanaan
APBN.
Peraturan Pemerintah Nomor 14 Tahun 2005 tentang Tatacara Penghapusan Piutang
Negara/Daerah.
_________,Nomor2Tahun2006tentangTatacaraPengadanPinjamandanatauPenerimaan
HibahsertaPenerimaanPinjamandan/atauHibahLuarNegeri.
_________,Nomor20Tahun2004tentangRencanaKerjaPemerintah.
_________,Nomor21Tahun2004(diperbaikidenganPeraturanPemerintahNomor90Tahun
2010)tentangRencanaKerjadanAnggaranKementerianNegara/Lembaga.
_________, Nomor 23 Tahun 2003 tentang Pengendalian Jumlah Kumulatif APBN dan APBD
sertaJumlahKumulatifPinjamanPemerintahPusatdanPemerintahDaerah.
_________,Nomor23Tahun2005tentangPengelolaanKeuanganBadanLayananUmum(BLU).
_________, Nomor 40 Tahun 2006 tentang Tatacara Penyusunan Rencana Pembangunan
Nasional.
_________,Nomor6Tahun2006tentangPengelolaanBarangMilikNegara/Daerah.
_________,Nomor71Tahun2010tentangStandarAkuntansiPemerintahan(SAP).
_________,Nomor8Tahun2006tentangPelaporanKeuangandanKinerjaInstansiPemerintah.

264

2014 |Pusdiklatwas BPKP


_________,Nomor22Tahun2005tentangPemeriksaanPenerimaanNegaraBukanPajak.
_________, Nomor 90 Tahun 2010 tentang Penyusunan Rencana Kerja dan Anggaran
KementerianNegara/Lembaga.
_________, Nomor 10 Tahun 2011 tentang Tata Cara Pengadaan Pinjaman Luar Negeri dan
PenerimaanHibah.
Peraturan Presiden Nomor 5 Tahun 2010 tentang Rencana Pembangunan Jangka Menengah
Nasional(RPJMN)Periode20102014.
_________,Nomor39Tahun2013tentangRencanaKerjaPemerintah(RKP)Tahun2014.
_________, Nomor 54 Tahun 2010, sebagaimana telah diubah dengan Peraturan Presiden
Nomor70Tahun2012,tentangPengadaanBarang/JasaPemerintah.
_________,Nomor164Tahun2011tentangPetunjukPenyusunandanPengesahanDaftarIsian
PelaksanaanAnggaran.
_________,Nomor49Tahun2012tentangTataCaraRevisiAnggaranTahunAnggaran2012.
Peraturan Menteri Dalam Negeri Nomor 13 Tahun 2006, sebagaimana telah diubah dengan
Peraturan Menteri Dalam Negeri Nomor 59 Tahun 2007 dan Peraturan Menteri
Dalam Negeri Nomor 21 Tahun 2011, tentang Pedoman Pengelolaan Keuangan
Daerah.
PusdiklatwasBPKP.2010.ModulPedomanPelaksanaanAnggaranIdanII.
PeraturanMenpanNomor29Tahun2010tentangPedomanPenyusunanPenetapanKinerjadan
PelaporanAkuntabilitasKinerjaInstansiPemerintah.
_________,Nomor9Tahun2007tentangPedomanUmumPenetapanIndikatorKinerjaUtama
diLingkunganInstansiPemerintah.
_________,Nomor20Tahun2008tentangPetunjukPenyusunanIndikatorKinerjaUtama.
PusdiklatwasBPKP,ModulAkuntabilitasInstansiPemerintah,EdisiKelima,2007.
Rasul, Sjahruddin. 2003. Pengintegrasian Sistem Akuntabilitas Kinerja dan Anggaran Dalam
PerspektifUUNo.17Tahun2003tentangKeuanganNegara.Jakarta:PNRI.
RobertS.Kaplan&DavidP.Norton.2000.BalancedScorecard.Jakara:PenerbitErlangga.
Simatupang,DianPujiN.2005.DeterminasiKebijakanAnggaranNegaraIndonesia,StudiYuridis.
Jakarta:PapasSinarSinanti.
SoeriaAtmadja,ArifinP.1986.MekanismePertanggungjawabanKeuanganNegara.Jakarta:PT.
Gramedia.

Manajemen Pemerintahan Pusat

265


Sugijanto, dkk. 1995. Akuntansi Pemerintahan dan Organisasi Non Laba. Jakarta: Pusat
PengembaganAkuntansiFEUI.
Sulaiman,AnwarH.2000.ManajemenAsetDaerah.Jakarta:STIALAN.
Sultan Syah, Mahendra. 2004. Manajemen Proyek Kiat Sukses Mengelola Proyek. Jakarta:
PTGramediaPustakaUtama.
SuratEdaranMenteriNegaraPendayagunaanAparaturNegaraRINomor:SE/03/M.PAN/4/2007
tentangPerlakuanTerhadapPejabatyangTerlibatKorupsi,Kolusi,danNepotisme.
Stone,Bruce.,AdministrativeAccountabilityinTheWestminsterDemocraties:TowardsaNew
ConceptualFramework,1995.
UndangUndangDasarRI1945(setelahamandemenkeempat).
UndangUndangNomor17tahun2003tentangKeuanganNegara.
UndangUndang Nomor 25 tahun 2004 tentang Sistem Perencanaan Pembangunan Nasional
(SPPN).
UndangUndangNomor32tahun2004tentangPemerintahanDaerah.
UndangUndangRINomor1Tahun2004tentangPerbendaharaanNegara.
UndangUndangRINomor15Tahun2002tentangTindakPidanaPencucianUang.
UndangUndang RI Nomor 15 Tahun 2004 tentang Pemeriksaan Pengelolaan dan Tanggung
JawabKeuanganNegara.
UndangUndang RI Nomor 17 Tahun 2007 tentang Rencana Pembangunan Jangka Panjang
(RPJP)Nasional.
UndangUndangRINomor31Tahun1999(jo.UndangUndangNomor20Tahun2000)tentang
PemberantasanTindakPidanaKorupsi.
UndangUndangRINomor33Tahun2004tentangPerimbanganKeuanganantaraPemerintah
PusatdanPemerintahanDaerah.
UndangUndang RI Nomor 5 Tahun 1999 tentang Larangan Praktik Monopoli dan Persaingan
UsahaTidakSehat.
UndangUndangNomor20Tahun1997tentangPenerimaanNegaraBukanPajak.
UndangUndang Nomor 73 Tahun 1999 tentang Tata Cara Penggunaan Penerimaan Negara
BukanPajakyangBersumberdariKegiatanTertentu.
UndangUndangNomor6Tahun1983,sebagaimanadiubahdenganUndangUndangNomor16
Tahun2009tentangKetentuanUmumdanTataCaraPerpajakan.

266

2014 |Pusdiklatwas BPKP


UndangUndangNomor7Tahun1983,sebagaimanadiubahdenganUndangUndangNomor36
Tahun2008tentangPajakPenghasilan.
UndangUndangNomor8Tahun1983,sebagaimanadiubahdenganUndangUndangNomor42
Tahun2009tentangPajakPertambahanNilai.
UndangUndangNomor23Tahun2013tentangAPBNTahunAnggaran2014.
WidjajaTunggal,Amin.2000.CosoBasedAuditing.Harvarindo.
WorldBank,WorldDevelopmentReport(Summary),WorldBank,1997,WashingtonD.C.
Yani, Ahmad. 2004. Hubungan Keuangan Antara Pemerintah Pusat dan Daerah di Indonesia.
Jakarta:DivisiBukuPerguruanTinggi,PTRajaGrafindoPersada.
http://abusyadza.wordpress.com/2008/05/07/gambaranumumsistemakuntansipemerintah
pusat/,diaksestanggal23Maret2013pukul23.00.
http://bisnis.news.viva.co.id/news/read/352249utangindonesiatertinggikeduadiasean,
diaksestanggal26Maret2013pukul21.00.
http://massweeto.blogspot.com/2012/06/rencanakerjapemerintahrkp2013.html,
tanggal25Maret2013pukul21.00.

diakses

http://nasional.kompas.com/read/2011/08/22/08180024/Inilah Celahcelah Mafia Anggaran,


diaksestanggal23Maret2013pukul21.00.
http://pustaka.pu.go.id/new/artikeldetail.asp?id=305, diakses tanggal 26 Maret 2013 pukul
23.00.
http://www.bappenas.go.id/getfileserver/node/10430/,diaksestanggal21Maret2013pukul
19.00.
http://www.bppk.depkeu.go.id/.../743_AW3...,diaksestanggal20Maret2013pukul20.00.
http://www.metrotvnews.com/metronews/read/2013/01/18/2/123886/SetengahPenunggak
PiutangNegaraObligorEksBPPN,diaksestanggal26Maret2013pukul21.00.
http://www.perbendaharaan.go.id/new/cetak.php?id=2938, diakses tanggal 26 Maret 2013
pukul20.00.

Manajemen Pemerintahan Pusat

267

268

2014 |Pusdiklatwas BPKP