Anda di halaman 1dari 6

STERILISASIALAT

STERILISASI
Sterilisasi atau suci hama yaitu suatu proses dimana membunuh segala bentuk
kehidupanmikroorganismeyangadadalamsampleataucontoh,alatalatataulingkungan
tertentu.
Dalamilmubedah,sterilisasiberartimemusnahkansemuamikroorganismebeserta
sporanya, sedangkan desinfeksi berarti memusnahkn semua mikroorganisme yang tidak
mempunyai spora, misalnya kumankuman. Desinfeksi biasanya dilakukan pada pakaian,
alatalatlinen,tempattidur,alatbuangairkecildanbesar,dansebagainya.
Metodesterilisasipadadasarnyadapatditempuhmelaluitigacarayaitu:
1.Secarafisika
Yaitudimanaprosessterilisasimengunakanhukumfisikayaitudengan:
Pemanasankering
Prinsipnya adalah protein mikroba pertamatama akan mengalami dehidrasi sampai
kering.Selanjutnyateroksidasiolehoksigendariudarasehinggamenyebabkanmikrobanya
mati.
a.Udarapanasoven
Digunakanuntuksterilisasialatgelasyangtidakberskala,alatbedah,minyaklemak,
parafin,petrolatum,serbukstabilsepertitalk,kaolin,ZnO.Suhusterilisasiyangdigunakan
adalah170oCselama1jam,160oCselama2jam,150oCselam3jam.

b.Pemijaranlangsung
Digunakan untuk sterilisasi alat logam, bahan yang terbuat dari porselen, tidak cocok
untukalatyangberlekukkarenapemanasannyatidakrata.
c.Minyakdanpenangaslain
Digunakanuntuksterilisasialatbedahsepertiguntingbedahsebagailubrikanmenjaga
ketajamanalat,bahankimiastabildalamampul.

Pemanasanbasah
Prinsipnyaadalahdengancaramengkoagulasiataudenaturasiproteinpenyusuntubuh
mikrobasehinggadapatmembunuhmikroba.
a.Uapbertekanan(autoklaf)
Digunakanuntuksterilisasialatgelas,larutanyangdimaksudkanuntukdiinjeksikan
kedalamtubuh,alatberskala,bahankaret.Waktuyangdibutuhkanuntuksterilisasilarutan
suhu121oCadalah12menit.Uapjenuhpadasuhu121 oCmampumembunuhsecaracepat
semua bentuk vegetatif mikroorganisme dalam 1 atau 2 menit. Uap jenuh ini dapat
menghancurkansporabakteriyangtahanpemanasan.
b.Pemanasandenganbakterisida
Digunakanuntuksterilisasilarutanberairataususpensiobatyangtidakstabildalam
autoklaf.Tidakdigunakanuntuklarutanobatinjeksiintravenadosistunggallebihdari15ml,
injeksiintratekal,atauintrasisternal.
c.Airmendidih
Digunakan untuk sterilisasi alat bedah seperti jarum spoit. Hanya dilakukan dalam
keadaandarurat.Dapatmembunuhbentukvegetatifmikroorganismetetapitidaksporanya.
Carabukanpanas
a.Sterilisasidenganradiasi
PrinsipnyaadalahradiasimenembusdindingseldenganlangsungmengenaiDNAdariinti
selsehinggamikrobamengalamimutasi.Digunakanuntuksterilisasibahanatauprodukyang
pekaterhadappanas(termolabil).Adaduamacamradiasiyangdigunakanyaknigelombang
elektromagnetik(sinarx,sinar)danaruspartikelkecil(sinardan).

2.Secarakimia
a.Menggunakanbahankimia
Dalampensterilandigunakanbahankimiasepertialkohol96%,fenol5%,selainitujuga
Aceton tab formalin, sulfur dioxida dan chlorin. Materi yang akan disuci hamakan
dibersihkan terlebih dahulu kemudian direndam dalam alkhohol aceton atau tab formalin
selamakuranglebih24jam.

b.Sterilisasigas
Dalampensterilandigunakanbahankimiadalambentukgasatauuap,sepertietilen
oksida, formaldehid, propilen oksida, klorin oksida, beta propiolakton, metilbromida,
kloropikrin. Digunakan untuk sterilisasi bahan yang termolabil seperti bahan biologi,
makanan,plastik,antibiotik.
3.Metodemekanik
a.Filtrasi
Digunakanuntuksterilisasilarutanyangtermolabil.Penyaringaninimenggunakan
filterbakteri.Metodeinitidakdapatmembunuhmikroba,mikrobahanyaakantertahanoleh
poriporifilterdanterpisahdarifiltratnya.

PELAKSANAANSTERILISASIALAT
1.STERILISASITERHADAPBAHANBAKUKARET(HandSchoen)
HandschoenatauSarungtangandapatdisterilkandenganuapformalinataudengan
otoklaf.Sebelumsarungtangandisterilkan,terlebihdahuluharusdibersihkandenganjalan
mencucidenganairdansabun.Bilahendakmemakaiuapformalin,sarungtanganyangtelah
siap,dimasukkankedalamtromolataustoples,laludimasukkanbeebrapatabletformalin.
Sarungtanganbarusucihama(steril)setelahterkenauapformalinpalingsedikit24jam.
Sebaiknyadisediakanbeberapabuahstoplesatautromolagarselaluadasarungtenganyang
steril.Sarungtangandapatpuladimasukkankedalamotoklafuntukdisterilkan.
2.STERILISASITERHADAPBAHANBAKULOGAM
Alat yang terbuat dari logam sebelum disteril dicuci terlebih dahulu. Perbiasakan
segeramencucialatalatbegituselesaimemakainya,agarkotoranyangmelengketmudah
dibersihkan.
Alatalat logam seperti jarum suntik, pinset, gunting, jarum oprasi, scapel blede
maupuntabungreaksimulamuladibersihkanterlebihdahulukemudiandibungkusdengan
kaingaas.Setelahitumenggunakanmetodepemanasansecarakering,agarsuhumencapai
160oC,jarakwaktumencapai12jam,kemudiandidiamkanagarsuhuturunperlahanlahan.
3.STERILISASITERHADAPBAHANBAKUKACA

Sterilisasibahanbakukacasamadengansterilisasilogamyaitudenganmenggunakan
pemanasankering,selainitubahanbakukacajugaseringdisterilisasidenganmenggunakan
metoderadiasikarenabahanbakukacabanyakmenyerapbahankacasehinggasterilisasi
denganradiasisangatefektive,pelaksanaanyayaitualatbahanbakukacadibersihkanterlebih
dahulu dari kotoran yang melekat kemudian keringkan dengan udara setelah kering alat
bahanbakukacadimasukanketempatelektronikyaitudengankatodapanas(emisitermis)
yangmengeluarkansinarultravioletkemudiansinarikacatersebutdengansinarultraviolet
dengan kekuatan kurang lebih 2500 s/d 2600 angstrom sehingga spora dan bakteri yang
melekatpadaalattersebutdapatterbakar.
4. STERILISASITERHADAPBAHANBAKUKAINATAUMEDIAKULTUR (kain
doek)
Mediakulturyangakandisteril,terlebihdahuludibersihkandarikotoran,kemudian
kainresebutdibungkusdengankertasagarsetelahsterildandikeluarkandarialatsterilisator
tidakterkontaminasidengankumanmaupunbakterilagi.Demikianpulakaindoektersebut
dibersihkan terlebih dahulu, setelah dibersihkan bungkus dengan plastik terlebih dahulu
sebelumsterilisasi,metodesterilisasiyangakandilakukanmenggunakanmetodepemanasan
denganuapairdanjugadipengaruhidengantekanan(autoclave).Metodesterilisasidenga
menggunakan autoclave ini yaitu dengan adanya pertukaran anatara oksigen dan carbon
dioxida.
5.STERILISASITERHADAPBAHANBAKUPLASTIK
Bahan baku plastik misalnya mayo apabila disterilkan sebaiknya jangan
menggunakanmetodepemanasan,olehkarnaitumakaakanmerubahbentukdariplastik
tersebut. Untuk mensucikan alat dari bahan baku plastik sebaiknya mulamula bersihkan
terlebih dahulu dengan menggunakan detergen, kemudian keringkan, setelah itu rendam
dalamlarutanalkoholsetelahitucucidengaaquadeslalurendamdalamlarutanantiseptik.

PERAWATANALATALAT
1.PERAWATANALATDARIBAHANBAKULOGAMYANGSUDAHDISTERILKAN

Alatalatyangterbuatdarilogammisalnyabesi,tembagamaupunalumuniumsering
terjadi karatan. Untuk menghindari terjadinya hal demikian maka alatalat tersebut harus
disimpanpadatempatyangmempunyaitemperaturtinggi(sekitar37 oC)danlingkunganyang
keringkalauperlumemakaibahansilikonsebagaipenyerapuapair,sebelumalattersebut
disimpan maka alat tersebut harus bebas dari kotoran debu maupun air yang melekat,
kemudianolesidenganolieatauparafin.
2.PERAWATANALATDARIBAHANBAKUKACASETELAHDISTERIL
Bahan baku kaca banyak dipakai dalam laboratorium medis. Ada beberapa
keuntungandankelemahandaribahanbakukacatersebut.
Keuntungan:
Bahanbakukacatahanterhadapreaksikimia,terutamabahangelaspyrex,tahanterhadap
perubahantemperaturyangmendadak,koefisienmuaiyangkecildantembuscahayayang
besar.
Kelemahan:
Mudahpecahterhadaptekananmekanik,danmudahtumbuhjamursehinggamenggagudaya
tembus sinar, kadangkadang dengan menggunakan kain katun untuk membersihkan saja
timbulgoresan.
Dengan memeperhatikan keuntungan dan kelemahan dari bahan gelas, maka dalam segi
perawatanmaupunmemperlakukanalatalatgelasharusmemperhatikan:
a.Penyimpananpadaruanganyangsuhunyaberkisar27oC37oCdanberitambahanlampu25
watt
b.Ruangantempatpenyimpanadiberibahansilikonsebagaizathigroskopis.
c.Gunakanalkohol,aceton,kapas,sikathalusdanpompaanginuntukmembersihakandebu
daripermukaankaca.Usahakanpadawaktumembersihkanlensajangansampaimerusak
lapisanlensa.
d. Padawaktumemanaskantabungreaksihendaknayaditempatkandiataskawatkasa,atau
bolehmelakukanpemanasanasalbahanbakudaripyrex.

e. Gelas yang direbus hendaknya jangan dimasukkan langsung kedalam air yang sedang
mendidih melainkan gelas dimasukkan ke dalam air dingin kemudian dipanaskan secara
perlahanlahan.Sebaiknyauntukpendinginanmendadaktidakdiperkenankan.
f.Membersihkankotorandarikacasebaiknyasegerasetelahdipakaidapatmenggunakan:
Airbersih
Detergen:menghilangkanefeklemakdantidakmembawaefeklemak
Larutan
kaliumdichromat:10gram
Asambelerang:25ml.
Aquades:75ml.

3.PERAWATANALATDARIBAHANBAKUKARET
Sarungtangandarikaretmudahmelelehataulengketapabiladisimpanterlalulama.
Untuk menghindari kerusakan dari bahan baku karet, sebelum melakukan penyimpanan
mulamula bersihkan kotoran darah atau cairan obat dengan cara mencuci dengan sabun
kemudiandikeringkandenganmenjemurdibawasinarmatahariatauhembusanudarahangat.
Setelahitutaburitalpadaseluruhpermukaankaret.