Anda di halaman 1dari 44

FISIOTERAPIA E TERAPIA OCUPACIONAL

NOME DO CANDIDATO

N DE INSCRIO

INSTRUES
1 - Esta prova contm o tema para redao e um espao para rascunho.
2 - Escreva seu nome e nmero de inscrio nos espaos prprios.
3 - Voc receber uma Folha de Redao Definitiva onde dever transcrever seu texto.
4 - Esta prova dever ser entregue juntamente com a Folha de Redao Definitiva.
5 - Use apenas caneta para fazer esta prova.
6 - A redao dever conter o mnimo de 15 linhas e o mximo de 20 linhas (no mais que 140
palavras).

RED A O
Para sua redao, leia novamente o texto de Ivan Lessa.

3523267$'(5('$d2

L-se, no texto de Ivan Lessa, a seguinte afirmao:


2&RQVHOKRGR6RQRGHSRVVHGHVVHVGDGRVIDVFLQDQWHVFKHJDjFRQFOXVmRGHTXHWRGR
PXQGRQmRLPSRUWDDSURILVVmRSUHFLVDGHXPDERDQRLWHGHVRQRHPERUDQmRPHQFLRQH
VHFRPRXVHPVRQKRMiTXHLVVRpFRPRXWURFRQVHOKR

5(',-$ um t ext o DUJXPHQWDWLYR, expondo o seu pont o de vist a sobre a concluso a
que chegou o Conselho do Sono. $SUHVHQWHargum ent os que sust ent em sua opinio.

5$6&81+2

FCMMG - Concurso Vestibular 2007 (FTO) LNGUA PORT. E LITERATURA 1

/1*8$32578*8(6$(/,7(5$785$ QUESTES DE 01 A 20

Para responder s questes de 01 a 10, leia o texto abaixo atentamente.


ZZZZZZZZZZZZZ
Os britnicos adoram conselhos. No desses que as campanhas
institucionais divulgam pela televiso (Cuidado, no beba), ou os
amigos do no botequim (Vai, pede mais um chope, rapaz!), mas
aqueles em que vrios indivduos se renem, em carter oficial, ou por
a, a fim de executar ou estudar determinado assunto.
Por aqui, tem conselho de tudo. O Conselho do Sono um bom
exemplo.
As regras do cronista medocre ditam que, a esta altura das
ponderaes, estando eu na Gr-Bretanha, deveria abrir um pargrafo
e citar o Cisne de Avon, o Bardo Imortal e outros lugares-comuns, mais
conhecido como Shakespeare: Dormir, sonhar talvez. Sem etcteras.
Tento a originalidade e me agarro a Cervantes: Bendito aquele
que inventou o sono, o manto que cobre todos os pensamentos
humanos.
No que ento, finalmente, acordado e aceso, vou ao assunto. O
Conselho do Sono (6OHHS &RXQFLO) em pesquisa recente revelou que,
entre a populao destas ilhas, h profundas diferenas, e dorme-se de
acordo com a profisso praticada.
No alto da lista, esto esses magnficos dorminhocos que so os
advogados. Dormem uma mdia de sete horas e quarenta minutos por
noite. Vinte por cento deles chegam s dez horas de sono. Deve ser
bom, embora cansativo, ser advogado.
No penltimo lugar da lista, esto vejam vocs os ilustres
parlamentares. No vo alm das cinco horas e vinte minutos por noite.
Quem foi que disse que poltica no profisso de sacrifcio? O
Conselho do Sono, no entanto, no conta as cochiladas tiradas por eles
no decorrer de chatssimos papos ou discusses nas cmaras, tanto a
dos Comuns quanto a dos Lordes.
Em ltimo lugar da lista dos que se entregam aos braos de
Morfeu (resolvi no poupar lugar-comum ou frase-feita), esto os
mdicos, cuja vida profissional exige a decantada (olha outro lugarcomum) eterna vigilncia na espera da ambulncia (s para quase
rimar).

LNGUA PORT. E LITERATURA (FTO)

O Conselho do Sono, de posse desses dados fascinantes,


chega concluso de que todo mundo, no importa a profisso, precisa
de uma boa noite de sono, embora no mencione se com ou sem
sonho, j que isso com outro conselho.
E por falar em conselho, olha a marmelada a, digo eu, indo
agora de gria antiga. O Conselho do Sono subsidiado pela
Federao Nacional de Camas. Como todos sabem, uma boa noite de
sono tem de se passar em cama com colcho, lenol e travesseiro.
Menos no caso excepcional de nossos nordestinos, esses fortes,
que preferem uma boa rede. Que, entre outras coisas, tem a vantagem
de s ser montada com imensa dificuldade no plenrio de uma cmara.
(LESSA, Ivan .

  
    So Paulo: Companhia das Letras, 2005. p.285)

01. Com base na leitura feita, CORRETO afirmar que o objetivo


principal do texto :
A) provocar uma reflexo sobre o sono.
B) ironizar um aspecto cultural ingls.
C) difundir uma terapia satisfatria.
D) informar uma pesquisa popular.

02. As aspas e/ou os parnteses foram empregados com as seguintes


funes, EXCETO:
A) indicar uma citao textual da fala de outra pessoa.
B) evidenciar a metalinguagem e interagir com o leitor.
C) preservar uma expresso em sua lngua original.
D) detalhar um ponto de vista de forma cientfica.

FCMMG - Concurso Vestibular 2007 (FTO) LNGUA PORT. E LITERATURA 3

03. CORRETO afirmar que, entre os recursos empregados no


desenvolvimento do texto, NO se inclui:
A) a manuteno de um registro lingstico marcado pela
formalidade.
B) a insero de perguntas que estabeleam interao com o
receptor.
C) a considerao irnica sobre os prprios meios de expresso.
D) a utilizao de recursos fnicos, prprios da poesia.

04. Assinale a alternativa em que a palavra destacada NO pode ser


considerada como integrante de uma expresso coloquial.
A) No que HQWmR...
B) .. olha a marmelada Dt...
C) Por DTXL, tem conselho de tudo.
D) ... se renem, em carter oficial, ou porDt...

05. Assinale a alternativa em que o trecho transcrito NO apresenta


intertextualidade literria.
A) Tento a originalidade e me agarro a Cervantes...
B) Menos no caso excepcional de nossos nordestinos, esses
fortes...
C) Em ltimo lugar da lista dos que se entregam aos braos de
Morfeu...
D) O Conselho do Sono subsidiado pela Federao Nacional de
Camas.

LNGUA PORT. E LITERATURA (FTO)

06. Os termos arrolados abaixo constituem


metalinguagem na crnica, EXCETO:

exemplos

de

A) sem etcteras
B) chatssimos papos
C) abrir um pargrafo
D) e por falar em conselho

07. Com base no texto, a relao feita INCORRETAMENTE :


A) frase-feita = originalidade
B) Marmelada = gria antiga
C) Gr-Bretanha = destas ilhas
D) Bardo Imortal = Shakespeare

08. Considerando-se as informaes do texto, INCORRETO afirmar que:


A) O cronista demonstra ter senso de humor.
B) As referncias aos polticos esto despojadas de ironia.
C) O epteto Cisne de Avon apresenta carter metafrico.
D) O pargrafo final faz aluso a uma frase de Euclides da Cunha.

09. Assinale a alternativa em que o comentrio NO adequado ao


texto.
A) O ttulo do texto sugere o assunto do sono.
B) Os nordestinos no tm o hbito de armar redes no plenrio.
C) O cronista faz um comentrio crtico vigilncia dos mdicos.
D) Os advogados e os polticos dormem mais do que os mdicos.

FCMMG - Concurso Vestibular 2007 (FTO) LNGUA PORT. E LITERATURA 5

10. As passagens abaixo so marcadas pela ironia, EXCETO:


A) Deve ser bom, embora cansativo, ser advogado.
B) No penltimo lugar da lista, esto vejam vocs os ilustres
parlamentares.
C) Que, entre outras coisas, tem a vantagem de s ser montada
com imensa dificuldade no plenrio de uma cmara.
D) O Conselho do Sono, no entanto, no conta as cochiladas
tiradas por eles no decorrer de chatssimos papos ou discusses
nas cmaras...

As questes de 11 a 20 relacionam-se com as obras literrias


escolhidas para este concurso.
11. Com base na leitura de 6HQKRUD, de Jos de Alencar,
INCORRETO afirmar que esse texto:
A) compe-se de quatro partes, com ttulos ligados economia.
B) apresenta uma linguagem repleta de termos naturalistas.
C) aborda o tema do casamento associado ao dinheiro.
D) filia-se ao gnero narrativo e ao estilo romntico.

LNGUA PORT. E LITERATURA (FTO)

12. Jos de Alencar, em 6HQKRUD, valoriza a descrio, como as


passagens exemplificam, EXCETO:
A) Trazia Aurlia uma tnica de cetim verde, colhida cintura por
um cordo de toral de ouro, como o andar com que as deusas
perlustravam no cu a galxia quando subiam no Olimpo.
B) No se via uma teia de aranha na parede, nem sinal de poeira
nos trastes. O soalho mostrava-se aqui e ali fendas na madeira,
mas uma ndoa sequer no manchava as tbuas areadas.
C) O aposento iluminado por uma grande lmpada de gs, cujo
globo de cristal opaco filtra uma claridade serena e doce, que
derrama-se sobre os objetos e os envolve como de um creme de
luz.
D) Como todas as almas que se regeneram, a de Seixas exercia
sobre si mesma uma disciplina rigorosa. Tinha severidade que
em outras circunstncias haviam de parecer ridculas. A
desculpa, o inofensivo pretexto tomavam para ele propores de
mentira.
13. Com base na leitura de 4XLQFDV %RUED, de Machado de Assis,
INCORRETO afirmar que a linguagem empregada na obra
apresenta:
A) vocbulos de baixo calo.
B) termos em lngua estrangeira.
C) recursos de cunho intertextual.
D) consideraes sobre a prpria narrativa.

FCMMG - Concurso Vestibular 2007 (FTO) LNGUA PORT. E LITERATURA 7

14. Considerando-se a narrao do salvamento de Deolindo, em


4XLQFDV %RUED, de Machado de Assis, CORRETO afirmar que
esse fato:
A) serve de contraponto ao episdio dos meninos que apupam o
gira.
B) exemplifica que Rubio j estava com os sintomas da demncia.
C) evidencia que os seres humanos so movidos por interesses.
D) une os laos de amizade entre Rubio e o casal Palha.

15. Com base na leitura de 6HQKRUD, de Jos de Alencar, e de 4XLQFDV


%RUED, de Machado de Assis, CORRETO afirmar que ambas as
obras tm como elemento comum:
A) a abordagem alegrica do contexto histrico.
B) o foco narrativo na primeira pessoa.
C) o mesmo espao narrativo.
D) o mesmo estilo de poca.

LNGUA PORT. E LITERATURA (FTO)

16. CORRETO afirmar que, entre os elementos que evidenciam a


presena da intertextualidade na composio de +LVWyULDGR%UDVLO,
de Murilo Mendes, NO se inclui:
A) a poesia indianista de Gonalves Dias, revista em tom de
pardia.
B) o episdio de Calabar, segundo a pea de Ruy Guerra e Chico
Buarque.
C) a referncia ao ficcionista francs Julio Verne, no episdio de
Padre Ccero.
D) as personagens Paraguau e Moema, do poema narrativo de
Santa Rita Duro.

17. Assinale a alternativa em que NO h relao entre os versos de


Murilo Mendes e os fatos da histria do Brasil.
A) Se embolaram com os paulistas,/ atiraram eles no rio,/ lhes do
gua pra beber,/ toda vermelha de sangue/ na cuia do rio das
Mortes. -> GUERRA DOS EMBOABAS
B) Cedo o imprio brasileiro/ ao dito das circunstncias./ S levo
daqui saudades./ Justia aguardo de Deus. -> PROCLAMAO
DA REPBLICA
C) O homem no sai/ de dentro da igreja./ H mais de seis meses/
que ele est ali. -> FREI CANECA E A CONFEDERAO DO
EQUADOR
D) Vivi abafando revoltas,/ at a revolta do mar;/ sou amigo da
unidade,/ o pas consolidei. -> GOVERNO DE FLORIANO
PEIXOTO

FCMMG - Concurso Vestibular 2007 (FTO) LNGUA PORT. E LITERATURA 9

18. Assinale a alternativa em que os versos de Ceclia Meireles fazem


referncia metafrica ao sujeito potico.
A) Desde o tempo sem nmero em que as origens se elaboram,/ se
estendem para mim os teus braos eternos,/ que um estaturio
de caminhos invisveis/ construiu com a cor e o frio e o som
morto de mrmores/ para que em teu abrao haja imveis
invernos.
B) A menina enferma chegou perto do dia to mansa/ e to simples
como uma lgrima sobre a esperana./ E acaba de descobrir
que as nuvens tambm tm movimento.
C) Nuvem, caravela branca/ no ar azul do meio-dia:/ - quem te viu
como eu te via?// Rolaram troves escuros/ pela vertente dos
montes./ Tremeram sbitas fontes.
D) Pastora de nuvens, fui posta a servio/ por uma campina to
desamparada/ que no principia nem tambm termina,/ e onde
nunca noite e nunca madrugada.
19. Com base na leitura de 9LDJHP, de Ceclia Meireles, CORRETO
afirmar que essa obra:
A) abarca diferentes regies do pas.
B) reflete criticamente o contexto histrico.
C) valoriza elementos da musicalidade e do sonho.
D) corresponde ao perodo concretista da poesia moderna.

10

LNGUA PORT. E LITERATURA (FTO)

20. Assinale a passagem que apresenta um aspecto endmico.


A) D. Fernanda no entendeu esta palavra. &UHLRTXHPDLVSRUTXH
HX R DGRUR Em verdade, a concluso no parecia estar nas
premissas; mas era caso de emendar outra vez Hamlet: H
entre o cu e a terra, Horcio, muitas cousas mais do que sonha
a vossa v GLDOpWLFD.
B) Por isso cresciam as inquietaes e tristezas da boa me, ao
pensar que tambm esta filha estaria condenada mesquinha
sorte do aleijo social, que se chama celibato.
C) Teu corpo, e teu rosto, e teu nome,/ teu corao, tua existncia,/
tudo o espao evita e consome:/ e eu s conheo a tua
ausncia.
D) O clera-morbus amigo de Lpez./ Enquanto ele ataca, o
amigo descansa,/ - o clera-morbus piedade no tem -.

FCMMG - Concurso Vestibular 2007 (FTO)

11

QUMICA

480,&$QUESTES DE 21 A 35
21. Um estudante realizou, temperatura constante, o experimento
esquematizado na figura abaixo:

ACETONA

500g
500g

No incio

Aps algum tempo

A partir do experimento, ele tirou as seguintes concluses:

O volume da acetona diminuiu durante o experimento.


A massa inicial da acetona era 500 g.
A acetona uma substncia voltil.
A densidade da acetona diminuiu durante o experimento.

O nmero total de concluses CORRETAS, tiradas pelo estudante, foi:


A) 4.
B) 3.
C) 2.
D) 1.

12

QUMICA (FTO)

22. Um densmetro, calibrado para o etanol, foi usado para identificar


quatro lquidos incolores etanol, gua, mistura de etanol e gua e
mistura de etanol e hexano. As densidades das substncias puras
so as seguintes:
gua:
Etanol:
Hexano:

1,00 g/mL
0,79 g/mL
0,66 g/mL

Colocado em cada lquido, o densmetro permanece nas posies


mostradas nas figuras abaixo:

,,

,,,

Considerando as informaes dadas, pode-se concluir que:


A) I a gua.
B) II etanol.
C) III a mistura etanol gua.
D) IV a mistura etanol hexano.

,9

FCMMG - Concurso Vestibular 2007 (FTO)

QUMICA

13

23 Considere, em fase gasosa, as espcies O, F, Na e Mg e os ons


isoeletrnicos delas derivados: O2, F, Na+ e Mg2+.
Com relao a essas espcies, a afirmativa ERRADA :
A) O raio do on O2 maior do que o raio do on F.
B) O raio do on Mg2+ menor do que o raio do on Na+.
C) A primeira energia de ionizao de Mg(g) menor do que a
primeira energia de ionizao de Na(g).
D) O mdulo da primeira afinidade eletrnica de O(g) menor do
que o da primeira afinidade eletrnica de F(g).

24. Um tubo de ensaio, contendo amnia e nitrognio gasosos, foi


emborcado sobre um recipiente contendo gua, como mostrado na
figura I. A gua sobe no interior do tubo e estaciona na posio
indicada na figura II.

Em relao a esse experimento, a afirmativa ERRADA :


A) O gs residual no sistema II constitudo, principalmente, de
nitrognio.
B) A mistura no sistema I continha volumes iguais de nitrognio e
amnia.
C) O interior do tubo no sistema II contm uma soluo lquida
bsica.
D) A gua sobe no tubo devido dissoluo da amnia.

14

QUMICA (FTO)

25. Considere um experimento em que magnsio metlico reage com


uma soluo de cido clordrico, formando MgCl2(aq) e 20,0 mL de
H2(g), medidos a 0,500 atm e 27 oC.
Em relao a esse experimento, a afirmativa CORRETA :
-4

A) A massa de H2(g) formada 8,13 x 10 g.


B) A massa de magnsio que reage 9,75 g.
C) A massa da soluo no se altera durante a reao.
D) A quantidade de ons na soluo no se altera durante a
reao.

26. A soluo lquida de um soluto no voltil congela a uma


temperatura menor do que a temperatura de congelao do solvente
puro.
Para explicar esse fenmeno, a afirmativa CORRETA :
A) A congelao ocorre com aumento da entalpia do sistema.
B) O soluto no voltil no contribui para congelar o solvente.
C) A soluo mais desordenada do que o solvente.
D) O soluto e o solvente estabelecem ligaes entre si

FCMMG - Concurso Vestibular 2007 (FTO)

QUMICA

15

27. Considere os seguintes grficos relativos aos processos descritos


pelas respectivas equaes qumicas:
I - Vaporizao de acetona em um recipiente fechado, a volume constante:
CH3COCH3(g)

presso

CH3COCH3( )

tempo

II - Dissoluo de cloro gasoso em gua:


Cl2(aq)

solubilidade

Cl2(g)

temperatura

III - Adio de Na2SO4 (aq) ao sistema em equilbrio:


BaSO4(s)

Ba2+(aq) + SO42(aq)

2+

Ba

2-

SO4

Est CORRETA a correlao entre o processo e o grfico em:


A) I somente
B) II somente
C) I e III somente
D) I, II e III

16

QUMICA (FTO)

28. Considere o seguinte sistema em equilbrio:


COCl2(g)

CO(g) + Cl2(g) ;

. = 0,3

Para que metade dos tomos de carbono esteja sob a forma de COCl2(g),
a concentrao de equilbrio do cloro deve ser igual a:
A) 0,6 mol/L.
B) 0,5 mol/L.
C) 0,4 mol/L.
D) 0,3 mol/L

29. Um mtodo mais recente para o tratamento da gua de piscinas


envolve a gerao de cloro molecular gasoso, pela eletrlise de
NaCl(aq), no prprio sistema de recirculao da gua. Ocorre a
reao:
2 H2O( ) + 2 NaCl(aq) Cl2(g) + H2(g) + 2 NaOH(aq).
Com relao a esse processo, a afirmativa ERRADA :
A) A massa de ons sdio permanece constante durante o
processo.
B) A semi-reao andica 2 H2O( ) + 2 e H2(g) + 2OH(aq).
D) O pH da gua da piscina aumenta durante o processo.
C) A gerao de cloro molecular consome energia eltrica.

FCMMG - Concurso Vestibular 2007 (FTO)

QUMICA

17

30. xido ntrico reage com cloro molecular, conforme a equao


2 NO(g) + Cl2(g)

2 NOCl(g).

Considere um experimento em que, em um reator de volume constante,


apenas os reagentes estavam presentes inicialmente. Suas presses
parciais, no tempo W = 0, eram SNO = 1,0 atm e SCl2 = 0,60 atm. O grfico
mostra a variao da presso parcial de NO(g) com o tempo, at que o
equilbrio foi atingido.
1,0 -

S NO

0,8 0,6 0,4 0,2 0,0


0

WHPSR

Com relao ao sistema em equilbrio, a afirmativa ERRADA :


A) A presso parcial de NOCl(g) igual de NO(g).
B) A presso parcial de Cl2(g) menor do que a sua presso
parcial inicial.
C) A rapidez, em mol/L, da formao de NOCl(g) igual da
formao de NO(g).
D) A rapidez, em mol/L, da formao de Cl2(g) igual metade da
rapidez de formao de NO(g).

18

QUMICA (FTO)

31. Considere o grfico relativo cintica da reao total:


2 ICl(g) +

H2(g)

2HCl(g)

I2(g)

Essa reao se processa segundo o seguinte mecanismo de duas etapas:


I)

ICl(g) + H2(g)

HI(g) + HCl(g)

II)

ICl(g) + HI(g)

I2(g) + HCl(g)

IC + H2
86
H

IC + HI + HC
75

I2 + HC

Coordenada da reao

Usando os seus conhecimentos e as informaes do grfico, pode-se


concluir o seguinte, EXCETO:
A) A variao de entalpia da reao total de 161 kJ/mol.
B) O HI, que um composto intermedirio, no se acumula no
sistema.
C) A primeira etapa do mecanismo determina a velocidade da
reao total.
D) A segunda etapa do mecanismo s se inicia aps a primeira
etapa estar completa.

FCMMG - Concurso Vestibular 2007 (FTO)

19

QUMICA

32. Um processo industrial para a purificao do nquel metlico


envolve, numa primeira etapa, a reao entre essa espcie e o
monxido de carbono, em que ocorre o equilbrio:
4 CO(g) + Ni(s)

Ni(CO)4(g).

A reao direta exotrmica.


Foram propostos os seguintes procedimentos para aumentar a
concentrao de Ni(CO)4(g) no equilbrio:

Adio de CO(g);
Adio de Ni(s);
Aumento da temperatura;
Diminuio da presso.

O nmero de procedimentos efetivos para o objetivo desejado :


A) 4.
B) 3.
C) 2.
D) 1.

33. Considere as constantes de equilbrio das reaes descritas pelas


seguintes equaes:
CH3COO

HF

CH3COOH

CH2ClCOO +

HF

CH2ClCOOH

CHCl2COO +

HF

CHCl2COOH

.1

.2

.3

A comparao CORRETA entre os valores das constantes de equilbrio :


A).1 = .2 = .3
B).1 > .2 > .3
C).3 > .2 > .1
D).1 > .2 = .3

20

QUMICA (FTO)

Para responder s questes 34 e 35, considere as substncias cujas


molculas, todas com seis tomos de carbono, esto representadas
pelas estruturas abaixo:
H

HH C H

H
C

H
O

,,
OH

H
O

,9

NH
C

H
O

H
C

,,,

OH

9,

34. Pode-se identificar nas molculas dessas substncias as seguintes


caractersticas, EXCETO:
A) Insaturao na molcula III.
B) Grupo amida na molcula V.
C) Grupo dos lcoois na molcula IV.
D) Grupo carbonila nas molculas I e II.

35. Esto corretos os nomes dessas substncias, EXCETO:


A)
B)
C)
D)

III:
IV:
I:
VI:

4-dimetil buteno-2
cido hexanico.
3-hexanona.
2-hexanol.

FCMMG - Concurso Vestibular 2007

BIOLOGIA (FTO)

21

%,2/2*,$ - QUESTES DE 36 A 50
36.

Atravs da ilustrao acima (Flemming 1882) de clulas de


embrio de salamandra fixadas e coradas, podemos evidenciar:
A) Formao de Retculo
B) Diviso Celular
C) Fecundao
D) Autlise

22

37.

BIOLOGIA (FTO)

Assimilado da cultura paraguaia, os vizinhos da fronteira sul, a


Sopa Paraguaia nada se assemelha sopa conhecida dos
brasileiros. De sopa, somente o nome, pois se trata de um bolo
salgado, consumido diariamente em padarias e lanchonetes.
Nas casas, a Sopa Paraguaia prato obrigatrio durante a
Semana Santa e outros dias festivos, dado o valor nutritivo que
o prato oferece.
(PANTANAL,

   
    

Senac)

Sabendo-se que a Sopa Paraguaia feita base de fub de milho,


ovos, manteiga, queijo e leite, podemos afirmar que:
A) O amido a nica substncia energtica citada.
B) rica em clcio, principal componente das protenas.
C) S possui substncias orgnicas em sua constituio.
D) Este alimento fonte de protenas, acar, gordura e sais minerais.

FCMMG - Concurso Vestibular 2007

BIOLOGIA (FTO)

23

38.

Sobre o desenho acima, assinale a opo com o nome da clula


que possui um menor perodo de vida e a razo dessa curta
existncia.
A) Glbulos Vermelhos, porque no possuem ncleo.
B) Clula Muscular, devido a sua intensa atividade metablica.
C) Glbulo Branco, por estar em constante combate com agentes
estranhos ao organismo.
D) Neurnio, em funo das correntes eltricas que se propagam
ao longo de sua membrana durante os estmulos nervosos.

24

BIOLOGIA (FTO)

Seqncia dos caracteres de identificao

39.

Chave Dicotmica para Classificao das Bactrias da Famlia Enterobacteriaceae.

O critrio adotado na chave acima foi:


A) Tipo de Reproduo
B) Composio Qumica
C) Variedade Morfolgica
D) Capacidade Metablica

FCMMG - Concurso Vestibular 2007

BIOLOGIA (FTO)

25

40. O uso de Bacterifagos como agentes de controle biolgico seria


eficiente em:
A) Mastite Bacteriana
B) Hepatite Virtica
C) Malria
D) Herps

41. Segundo Empdocles de Acragas (492 432 a.C. ), o calor do


tero era decisivo na determinao do sexo; tero quente
produziria homens e o frio, mulheres...
Com relao aos mamferos, isso no se trata de uma realidade,
porm a questo do calor pode vir a ser um problema na proporo
sexual em ninhadas de:
A) Aves
B) Peixes
C) Rpteis
D) Anfbios

42. Um grilo morrer asfixiado se ocorrer com ele, o infortnio de ter:


A) A asa imobilizada.
B) A cabea cortada.
C) A perna arrancada.
D) O abdmen encerado.

26

BIOLOGIA (FTO)

43

Tucum
Bate Tucum
Na garrafa de areia
Sementes peludas
Se penteiam
Bate Tucum
Bate...
( A. C. L. )

Pelos versos acima, pode-se afirmar que o Tucum :


A) Musgo
B) Palmeira
C) Cogumelo
D) Samambaia

FCMMG - Concurso Vestibular 2007

27

BIOLOGIA (FTO)

44.

No esquema acima, podemos afirmar corretamente que os


hormnios 1 e 2 so, respectivamente:
A) Adrenalina e Glicocorticides
B) Glicocorticides e Tiroxina
C) Insulina e Glucagon
D) Insulina e Adrenalina

28

BIOLOGIA (FTO)

45. Uma pessoa imvel, em posio de sentido, por um tempo


prolongado, ter o retorno sangneo comprometido atravs da
circulao venosa dos membros inferiores porque:
A) A presso arterial aumenta.
B) O corao deixa de puxar o sangue.
C) No haver contrao muscular naqueles rgos.
D) Ocorrer maior deslocamento de sangue para os membros
superiores.
46. Pesquisas em diferentes reas da Biologia tm fornecido
numerosas evidncias de que o processo evolutivo o responsvel
pela diversidade da vida.
Entre as principais evidncias da Evoluo, podemos citar,
EXCETO:
A) Fsseis.
B) Mutaes.
C) Semelhanas anatmicas entre as espcies.
D) Adaptaes dos seres vivos a seus ambientes.

FCMMG - Concurso Vestibular 2007

BIOLOGIA (FTO)

29

47.

(Scientific American Brasil/Nov. 2004)

O grfico acima traduz a percentagem de DNA no-codificador de


protenas nos diversos organismos encontrados na natureza. Com
base na anlise exclusiva desse grfico, possvel afirmar:
A) No existe relao entre a quantidade de DNA No-codificador
de protenas e o grau de complexidade dos organismos.
B) A quantidade de DNA No-codificador de protenas diretamente
proporcional ao grau de evoluo do organismo.
C) A quantidade de protenas diferentes maior nos vegetais do
que nos animais.
D) O homem possui mais genes do que um cachorro ou qualquer
outro ser vivo.

30

48.

BIOLOGIA (FTO)

(...) H muito se sabe que outros danos ao feto em


desenvolvimento podem ser fatores de risco para a
esquizofrenia , inclusive, e especialmente, as complicaes de
parto. difcil interpretar os dados, porque as prprias mes
esquizofrnicas tendem a ter complicaes de parto. Todavia ,
parece que um feto privado de oxignio no tero por preclmpsia tem um risco de esquizofrenia nove vezes maior que
o normal. O que a fraternidade mdica chama delicadamente de
insulto hipxico a quase sufocao durante o nascimento
um fator de risco definido. Novamente parece interagir com os
genes. Voc pode suportar melhor um episdio hipxico com os
genes certos, ou pode superar melhor seu destino gentico com
um parto mais fcil. (...)
RIDLEY, Matt 
Rio de Janeiro, 2004

 

!



Genes Natureza e Experincia.

De acordo com o exposto acima, podemos afirmar que:


A) No existe relao entre gentipo e fentipo.
B) O fentipo determinado s pelo gentipo.
C) O gentipo determinado pelo fentipo.
D) O fentipo influenciado pelo meio.

FCMMG - Concurso Vestibular 2007

BIOLOGIA (FTO)

31

49.
carnvoro

carnvoro

herbvoro

planta

Pelo desenho acima, podemos afirmar, EXCETO:


A) Os produtores de uma cadeia alimentar esto mais sujeitos aos
efeitos txicos de um poluente no-biodegradvel do que os
consumidores, pois se acham em contacto direto com esses
poluentes.
B) A pirmide em questo trata de um fenmeno conhecido como
amplificao

biolgica,

no

qual

componentes

no-

biodegradveis se acumulam ao longo das cadeias alimentares.


C) Poluentes agrcolas (pesticidas) e metais pesados lanados nas
guas so absorvidos por produtores e transferidos para os
consumidores em quantidades cada vez maiores.
D) Quanto mais elevado for o nvel trfico, maior ser o acmulo de
material txico nesses organismos.

32

BIOLOGIA (FTO)

50.

N
L

O
S

Na Enseada de Meape, litoral capixaba, no dia 30 de julho os


barcos dos pescadores que ainda vivem por l estavam todos
ancorados, indicando que, naquele dia, eles no foram pescar.
O fato, percebido no desenho acima, deveu-se ao vento:
A) Oeste
B) Leste
C) Norte
D) Sul

FCMMG Concurso Vestibular 2007 (FTO)

INGLS

33

,1*/6QUESTES DE 51 A 60
,16758&7,216 Questions 51 to 60 will be based on the text below.
Read it carefully and then choose the alternative that answers or
completes the questions or statements placed after it.

0DVVDJH7KHUDS\$6WHS%\6WHS*XLGH
:KDW,V0DVVDJH7KHUDS\"
Massage is one of the oldest, simplest forms of therapy and
is a system of stroking, pressing and kneading different
areas of the body to relieve pain, relax, stimulate, and tone
the body. Massage does much more than create a pleasant
sensation on the skin, it also works on the soft tissues (the
muscles, tendons, and ligaments) to improve muscle tone. Although it
largely affects those muscles just under the skin, its benefits may also
reach the deeper layers of muscle and possibly even the organs
themselves. Massage also stimulates blood circulation and assists the
lymphatic system (which runs parallel to the circulatory system),
improving the elimination of waste throughout the body.
6RPH%HQHILWV2I0DVVDJH
1.Relaxing.
2.Soothing.
3.Healing.
4.Reassuring.
5.Eases tension, stiffness, and pain.
6.Improves breathing.
7.Improves circulation.
8.Enhances well-being.

34

INGLS (FTO)

7KH(IIHFWV2I0DVVDJH
Although a single massage will be enjoyable, the effects of massage are
cumulative and a course of massage treatments will
bring the most benefits. Regular massage can have
the effect of strengthening and toning the entire
body mechanism, and so help to prevent
unnecessary strains and injuries that might
otherwise occur due to excess tension and any
resulting structural weaknesses. Massage can
stimulate or calm the nervous system depending
upon what is required by the individual and thus
help reduce fatigue, leaving the reciever with a
feeling of replenished energy. At its best, massage
has the potential to restore the individual physically,
mentally and spiritually.
(http://www.101lifestyle.com/beauty/massage/massage.html 05/08/2006)

51. The text states that massage is


A) a very old form of therapy.
B) a therapy the old should not use.
C) an old therapy not in use any more.
D) an alternative therapy for old people.

52. Massage therapy consists of


A) making pressure on the knees.
B) circulating around ones own body.
C) a system of kneeling to feel your body.
D) stroking, kneading and pressing the body.

FCMMG Concurso Vestibular 2007 (FTO)

INGLS

35

53. Massage therapy, among other things, is useful to


A) relieve pain.
B) cure cancer patients.
C) increase a headache.
D) stimulate the memory.
54. According to the text, we understand that massage affects all the
parts listed below, EXCEPT
A) the organs themselves.
B) deep layers of muscles.
C) muscles under the skin.
D) the bones under the muscles.

55. The benefit of massage for the lymphatic system is


A) elimination of blood in the head.
B) helping the body to sweat out liquid.
C) the improvement of waste elimination.
D) bettering the flow of blood in the body.

56. Relaxing, circulation improvement and ease of tension are


A) the symptoms of the need for massage.
B) some of the benefits of massage therapy.
C) the strains and injuries caused by massage.
D) the result of the lack of energy through massage.

36

INGLS (FTO)

57. The best results of massage therapy are achieved when a person
undergoes the treatment
A) in a single session.
B) every month or so.
C) on a regular basis.
D) once in a while.
58. The results of massage therapy are felt in all the ways listed below,
EXCEPT
A) mentally.
B) spiritually.
C) physically.
D) commercially.
59. Although a single massage will be enjoyable, the effects of
massage are cumulative.
Mark the sentence that has the same meaning as this one, found in
the last paragraph.
A) The effects of massage are cumulative because a single
massage will be enjoyable.
B) The effects of massage are cumulative, even though a single
massage will be enjoyable.
C) A single massage is enjoyable, provided the effects of massage
are cumulative.
D) A single massage is enjoyable, as the effects of massage are
cumulative.
60. Although it largely affects those muscles just under the skin, LWV
benefits may also reach the deeper layers of muscle
In this sentence, found in the first paragraph of the text, the
possessive LWVrefers to the
A) massage.
B) muscles.
C) organs.
D) blood.

FCMMG Concurso Vestibular 2007 (FTO)

ESPANHOL

37

(63$1+2/QUESTES DE 51 A 60

Lea el texto atentamente y a continuacin seleccione la alternativa


adecuada para cada una de las cuestiones que siguen.

6HPLQDULR UHJLRQDO SURGXFH XQ PDUFR SDUD OD DFFLyQ


GLVHxDGR SDUD PHMRUDU OD UHVSXHVWD QDFLRQDO D ORV
GHVSOD]DGRVLQWHUQRVHQ$PpULFD
El primer seminario regional sobre desplazamiento en Amrica fue
realizado del 18 al 20 de febrero de 2004 en la ciudad de Mxico,
auspiciado por el Gobierno de Mxico y copatrocinado por el Proyecto
de la Institucin Brookings-Universidad de Johns Hopkins SAIS sobre
5 Desplazamiento Interno y la Oficina del Representante del Secretario
General de las Naciones Unidas para las Personas Internamente
Desplazadas. El propsito del seminario fue examinar las tendencias
actuales del desplazamiento interno en Amrica y fortalecer la
respuesta nacional, regional e internacional hacia los desplazados.
10 En Amrica existen alrededor de 3.3 millones de personas internamente
desplazadas, la mayora de ellas en Colombia, quien ahora cuenta con
la tercera poblacin mas alta de desplazados en el mundo. Los
nmeros son menores en Mxico pero su situacin sigue siendo
precaria y solamente ha recibido atencin recientemente. En Guatemala
15 y Per, muchos desplazados continan a necesitar soluciones
duraderas an cuando los conflictos en estos pases terminaron hace
varios aos atrs. La mayora de los desplazados en Amrica necesitan
ayuda humanitaria, proteccin y apoyo para la reintegracin. Las
poblaciones afro-colombianas e indgenas son desproporcionadamente
20 afectadas por el desplazamiento.
El seminario cont con la participacin de ms de sesenta participantes
incluyendo representantes de los Gobiernos de Colombia, Guatemala,
Mxico y Per, instituciones nacionales de derechos humanos,
organizaciones no gubernamentales locales e internacionales, lideres
25 de comunidades de desplazados, representantes de las Naciones
Unidas, la Organizacin de los Estados Americanos (OEA), el Banco
Mundial y expertos de instituciones de investigacin.

38

ESPANHOL (FTO)

El seminario produjo un documento, Un Marco para la Accin, que


identifica pasos que se pueden tomar por los gobiernos para mejorar la
30 situacin de los desplazados en Amrica. En particular, el Marco hace
un llamado a los gobiernos para:

Reconocer el problema de desplazamiento interno y construir un


consenso nacional alrededor del tema.

Asegurar que la respuesta nacional abarque a todos los grupos,


35 en particular a los indgenas, afro-colombianos y otros grupos
que han sido marginalizados. Tambin esta respuesta debe
dirigirse hacia las injusticias y divisiones sociales que fueran la
causa original del desplazamiento.

Desarrollar leyes y legislacin nacional que sostengan los


40 derechos de los desplazados internos con mecanismos de
refuerzo adecuado. Designar un punto focal institucional
nacional con autoridad y recursos para promover una respuesta
nacional efectiva.

Aumentar la participacin de las instituciones nacionales de


45 derechos humanos con las personas internamente desplazadas,
incluyendo el monitoreo de implantacin de las polticas y leyes,
investigando quejas individuales de personas internamente
desplazadas y proveyendo asesora a los gobiernos.

Capacitar a funcionarios del Gobierno, al ejrcito, a las fuerzas


50 policiales y legisladores, en temas de desplazamiento interno y
en los Principios Rectores de los Desplazamientos Internos.

Recolectar informacin sobre los nmeros y las condiciones de


los desplazados internos.

Establecer mecanismos formales de consultacin con los


55 desplazados internos para asegurar su completa participacin
en la planificacin e implementacin de polticas y programas,
poniendo especial atencin a las mujeres que son cabeza de
familia.

Fortalecer las condiciones de seguridad de los desplazados y de


60 aquellas personas que trabajan en su favor - dado los ataques
deliberados que sufrieran lderes de los desplazados, ONGs y
de las instituciones acadmicas que conducen investigaciones
en desplazamiento- y llevar a la justicia a los responsables de
dichos ataques.

FCMMG Concurso Vestibular 2007 (FTO)

65

ESPANHOL

39

65 Establecer dilogos con los grupos insurgentes para abrir un

espacio de acceso humanitario a los desplazados que se


encuentran en reas bajo el control de estos actores.

Apoyar soluciones duraderas para los desplazados, en particular


el derecho de retornar voluntariamente o de reasentarse en otra
70 parte del pas (EDMRQLQJXQDFLUFXQVWDQFLDORVGHVSOD]DGRV
GHEHUtDQVHUIRU]DGRVDUHWRUQDURUHDVHQWDUVHHQRWUDSDUWH
GHOSDtVHQFRQWUDVXSURSLDYROXQWDG el Marco enfatiza), ser
protegidos en reas de retorno o reasentamiento y recibir
compensacin por las propiedades u otras posesiones perdidas.
75 Debe prestarse especial atencin a UHVWDXUDU HO DFFHVR D
WLHUUDVDODVPLQRUtDVLQGtJHQDV\DIURGHVFHQGLHQWHV como
una manera de integrarlos dentro de la vida de la nacin y para
terminar la larga historia de discriminacin contra ellos y
asegurar que los derechos de propiedad sean asegurados a las
80 mujeres.
El Marco para la Accin tambin identifica pasos que las organizaciones
regionales e internacionales pueden tomar para reforzar la
responsabilidad nacional, en particular reportar sobre la implementacin
de leyes y polticas nacionales, interceder frente a los gobiernos en
85 beneficio de los desplazados internos, establecer una presencia ms
amplia en reas en donde los desplazados estn amenazados y facilitar
negociaciones entre los gobiernos y los actores no estatales.
(http:/www.disaster-info.net/desplazados/)

51. Segn el texto, el equivalente CORRECTO para ... los grupos


insurgentes... ( lnea 65 ) es:
A) Grupos relacionados a arte y cultura que practican acciones
humanitarias.
B) Asociacin de personas rebeldes.
C) Instituciones acadmicas.
D) ONGs.

40

ESPANHOL (FTO)

52. Segn el texto, todas las proposiciones abajo son pasos que se
pueden tomar los gobiernos para mejorar la situacin de los
desplazados en Amrica, MENOS
A) Fortalecer las condiciones de seguridad de los desplazados, sus
lderes,
ONGs y instituciones acadmicas que conducen
estudios relacionados al tema.
B) Preparar a los funcionarios del gobierno, al ejrcito, a las fuerzas
policiales y legisladores en temas de desplazamiento interno.
C) Reconocer el problema de desplazamiento interno y formar un
consenso mundial alrededor del tema.
D) Juntar informacin sobre los nmeros y las condiciones de los
desplazados internos.

53. A cul de las opciones se refiere el fragmento abajo destacado


... como una manera de integrarlosdentro de la vida ... ( lnea 77 )
A) Desplazados.
B) Grupos insurgentes.
C) Los derechos de propriedad.
D) Minoras indgenas y afro-descendientes.

54. Segn el texto, todas las correspondencias estn correctas,


MENOS:
A) Experto ( lnea 27 ) = astuto
B) Desplazados ( lnea 9 ) = descentrados
C) Proveyendo ( lnnea 48 ) = suministrando
D) Investigacin ( lnea 27 ) = estudio de un tema

FCMMG Concurso Vestibular 2007 (FTO)

ESPANHOL

41

55. En cul de las frases el verbo contar tiene el mismo sentido que en
el fragmento del texto ... cont con la participacin de:.. (lnea 21)
A) Cont una larga historia
B) Cont con la ayuda del gobierno.
C) Cont cuantos desplazados existen en Amrica.
D) La Institucin Brookings cont el nmero de participantes en el
seminario.

56. ... duraderas an cuando los conflictos ... ( lnea 16 )


Es CORRECTO afirmar que el fragmento subrayado sea sustituido
por:
A) Todava
B) Mientras
C) Incluyendo
D) Sin embargo

57. Segn el texto, es CORRECTO afirmar que El Marco para la Accin


es:
A) Un seminrio.
B) Un documento.
C) Un momento decisivo.
D) Pasos que se pueden tomar los gobiernos para mejorar la
situacin de los desplazados.

58. A qu se refieren, respectivamente, las palabras destacadas en los


fragmentos
... su situacin sigue siendo precaria... ( lnea 13 )
... personas que trabajan en su favor... ( lnea 60 )
A) Desplazados internos/ lderes de los desplazados
B) Colombia / desplazados
C) Mxico/ desplazados
D) Amrica / ONGs

42

ESPANHOL (FTO)

59. En el fragmento ... auspiciado por el gobierno de Mxico ...


( lnea 3 ), la palabra detacada significa:
A) Ilustrado
B) Jorobado
C) Conducido
D) Favorecido

A) Existe una larga historia de discriminacin contra las mujeres.


B) En Amrica existen cerca de 3.3 millones de personas
internamente desplazadas.
C) Uno de los propsitos del seminario fue examinar las tendencias
actuales del desplazamiento interno en Amrica.
D) El Marco para la Accin hace un llamado a los gobiernos para
apoyar el derecho de los desplazados de retornar
voluntariamente o de reasentarse.

Baixado de www.acheprovas.com (sem modifio do contedo original).

60. Segn el texto, todas las afirmaciones abajo son verdaderas,


MENOS: