Anda di halaman 1dari 19

PENERAPAN

RAPAN GREEN ARCH


ARCHITECT
ECTURE DAN GREE
REEN BUILDING
SEBA
SEBAGAI UPAYA
AYA PENCAP
NCAPAIAN SUSTAIN
AINABL
ABLE ARCH
ARCHITECTURE
TURE
Abstrak
Permasalahan lingkungan
khususnya pemanasan global
menjadi topik
permasalahan yang mencuat akhir-akhir ini. Dalam dunia arsitektur muncul
fenomena sick building syndrome yaitu permasalahan kesehatan dan ketidak
nyamanan karena kualitas udara dan polusi udara dalam bangunan yang ditempati
yang mempengaruhi produktivitas penghuni, adanya ventilasi udara yang buruk, dan
pencahayaan alami kurang.
Selain karna adanya pemanasan global, penciptaan atau inovasi energi yang
terbarukan juga menjadi latar belakang timbulnya konsep green architecture.
Sampai pada akhirnya timbul konsep Green Building. Gedung Hemat Energi atau
dikenal dengan sebutan green building terus digalakkan pembangunannya sebagai
salah satu langkah antisipasi terhadap perubahan iklim global.
Indikasi arsitektur
disebut sebagai 'green' jika dikaitkan dengan praktek arsitektur antara lain
penggunaan renewable resources (sumber-sumber yang dapat diperbaharui, passiveactive solar photovoltaic (sel surya pembangkit listrik), teknik menggunakan tanaman
untuk atap, taman tadah hujan, menggunakan kerikil yang dipadatkan untuk area
perkerasan, dan sebagainya.
Kata Kunci: Green Architecture, Green Building, Suistainable Architecture
1.

PENDAHULUAN
Permasalahan lingkungan khususnya pemanasan global menjadi topik

permasalahan yangmencuatakhir-akhirini.Dalamduniaarsitekturmunculfenomena
sick building syndrome yaitu permasalahan kesehatan dan ketidak nyamanan karena
kualitasudaradanpolusiudaradalambangunan yangditempati yangmempengaruhi
produktivitas penghuni, adanya ventilasi udara yang buruk, dan pencahayaan alami
kurang. Halinidisebabkan olehbeberapa hal,misalnya: emisiozonmesin fotocopy,
polusidariperabotdanpanelkayu,asaprokok,dsb.
Menurut World Health Organisation (WHO), 30% bangunan gedung di dunia
mengalami masalah kualitas udara dalam ruangan. Untukitumuncul adanya konsep

Yusrisal|D51114022

green architecture

yaitu pendekatan perencanaan arsitektur yang berusaha

meminimalisasi berbagai pengaruh membahayakan pada kesehatan manusia dan


lingkungan.Konsep green architecture ini memiliki beberapa manfaat diantaranya
bangunan lebih tahan lama, hemat energi, perawatan bangunan lebih minimal, lebih
nyamanditinggali, sertalebihsehatbagi penghuni. Konsep greenarchitecture
memberi kontribusi pada masalah lingkungan khususnya pemanasan global. Apalagi
bangunanadalah penghasilterbesarlebih dari30% emisiglobalkarbondioksida
sebagaisalahsatupenyebabpemanasanglobal.
Selain karna adanya pemanasan global, penciptaan atauinovasi energi yang
terbarukan jugamenjadi latarbelakangtimbulnya konsepgreen architecture. Sampai
pada akhirnya timbul konsep Green Building. Gedung Hemat Energi atau dikenal
dengansebutangreen building terusdigalakkan pembangunannya sebagaisalahsatu
langkah antisipasiterhadap perubahaniklim global. Dengankonsep hemat energi
yang tepat,konsumsienergisuatugedungdapat diturunkanhingga50%, dengan
hanya menambah investasi sebesar 5% saat pembangunannya. Dengan hanya
menambah5%daribiayapembangunan gedungbiasa,konsumsienergigedungdapat
diturunkan hingga50%.GreenBuilding dibangundenganperencanaan energi
modern.Selaindarisisidesainyangdipertimbangkanuntukmeminimalkan
masuknya sinar matahari sehingga mengurangi penggunaan beban Air Conditioner
(AC), pada atap gedung bisa dipasang panel surya yang dapat dimanfaatkan sebagai
sumberenergidalamgedung.Beberapasudutpandangdapatdipertimbangkan dalam
perencanaan tersebut diantaranya adalahaspekPassive Design,Active Design,
KondisiUdaraRuangan,Management,sertaService & Maintenance.
Indikasi arsitektur disebut sebagai 'green' jika dikaitkan dengan praktek
arsitektur antara lain penggunaan renewable resources (sumber-sumberyang dapat
diperbaharui, passive-active solar photovoltaic (sel surya pembangkit listrik), teknik
menggunakantanaman untuk atap, taman tadah hujan, menggunakankerikilyang
dipadatkanuntukareaperkerasan,dansebagainya.

Yusrisal|D51114022

Gambar 1. Salah satu bangunan yang merupakan Top Ten Green Architecture

Projects Of 2008
Konsep 'green' juga bisa diaplikasikan pada pengurangan penggunaan energi
(misalnya energi listrik), low energy house dan zero energy building dengan
Penggunaan energi
memaksimalkanpenutup bangunan (building envelope).
terbarukansepertienergimatahari,air,biomass,danpengolahanlimbahmenjadi
juga patut
diperhitungkan.
energi
Arsitekturhijau tentunyalebih dari sekedar menanamrumputataumenambah
tanaman lebih banyak di sebuah bangunan, tapi juga lebih luas dari itu, misalnya
memberdayakan arsitektur atau bangunan agar lebih bermanfaat bagi lingkungan,
menciptakan ruang-ruang publik baru, menciptakan alat pemberdayaan masyarakat,
dansebagainya.
Arsitektur berkelanjutan, adalah sebuah topik yang menarik. Akhir-akhir ini
semakinbanyakdiberitakandandipromosikan dalamkalanganarsitek,karenaarsitek
memiliki peran penting dalam pengelolaan sumber daya alam dalam desain-desain
bangunannya.Apresiasiyangbesarbagimerekayangturutmempromosikan
arsitektur berkelanjutan agar kita lebih bijaksana dalam menggunakan sumber daya
alam yangmakin menipis. Sustainable architecture ataudalam bahasa Indonesianya

adalah arsitektur berkelanjutan, adalahsebuah konsep mempertahankan sumber daya


alam agar bertahan lebih lama, yang dikaitkan dengan umur potensi vital sumber
daya alam dan lingkungan ekologis manusia, seperti sistem iklim planet, sistem
pertanian, industri, kehutanan, dan tentu saja arsitektur. Kerusakan alam akibat
eksploitasi sumberdayaalamtelahmencapai tarafpengrusakan secaraglobal,
sehingga lambat tetapi pasti, bumi akan semakin kehilangan potensinya untuk
mendukungkehidupan manusia,akibatdariberbagaimacameksploitasi sumberdaya
alamtersebut.
2.

PERMASALAHAN
Penerapan
an

Green Arch
rchitectu
itecture Dan
an Gree
reen Building

Pencapaia
aian Susta
stainab
nable

Arch
rchitectu
itecture

Sebagai
ai Upaya

merupakan studi untuk mendapatkan

pemahaman yang jelas mengenai makna penerapan Green Architectu


cture Dan
Green Building

yang timbul sebagai ekspresi bangunan. Yang sering

menjadipertanyaan adalahbagaimana cara menerapkan perencanaan


bangunansejakawalberdasarkankonsepgreen architecture dan green building?
bagaimana mendesain sebuah bangunan yang 'green' sekaligus memiliki estetika
bangunan yang baik? Karena bisa saja bangunan memiliki fasilitas yang
mendukung konsepgreen,namunternyatasecaraestetikaterlihatkurangmenarik.
Dalamhalini,peranarsitekmenjadipenting.Standarbangunanyang'green'jugabisa
menuntut lebih banyak dana, karena fasilitas yang dibeli agar bangunan menjadi
'green'tidakmurah,misalnyapenggunaanphotovoltaic(selsuryapembangkitlistrik).
Teknologi agar bangunan menjadi 'green' biasanya tidak murah. Bagaimana
konsep terapan green architecture dan green building dapat mendukung konsep
arsitekturberkelanjutan?
3. KAJIAN PUSTAKA
3.1. GREEN ARCHITECTURE
KonsepGreen Architecture atauarsitekturhijaumenjaditopikyangmenarik
saat ini, salah satunya karena kebutuhan untuk memberdayakan potensi site dan
menghematsumberdayaalamakibatmenipisnyasumberenergitakterbarukan.

Berbagaipemikirandaninterpretasiarsitekbermunculuan secaraberbeda-beda, yang


masing-masing diakibatkan olehpersinggungan dengan kondisi profesi yangmereka
hadapi.
Green

Architecture

ialah sebuah konsep arsitektur yang berusaha

meminimalkan pengaruh buruk terhadap lingkungan alam maupun manusia dan


menghasilkan tempat hidup yang lebih baik dan lebih sehat, yang dilakukan dengan
caramemanfaatkansumberenergidansumberdayaalamsecaraefisiendanoptimal.
Green

dapat diinterpretasikan

sebagai sustainable

(berkelanjutan),

earthfriendly (ramah lingkungan), dan high performance building (bangunan dengan


performasangatbaik).Ukuran'green' ditentukanoleh berbagaifaktor,dimana
terdapatperingkatyangmerujukpadakesadaranuntukmenjadilebihhijau.Di
negara-negara majuterdapataward,pengurangan pajak,insentif yangdiberikan pada
bangunan-bangunan yangtergolong'green'.
Indikasi arsitektur disebut sebagai 'green' jika dikaitkan dengan praktek
arsitektur antara lain penggunaan renewable resources (sumber-sumberyang dapat
diperbaharui, passive-active solar photovoltaic (sel surya pembangkit listrik), teknik
menggunakantanaman untuk atap, taman tadah hujan, menggunakankerikilyang
dipadatkanuntukareaperkerasan,dansebagainya.
Konsep 'green' juga bisa diaplikasikan pada pengurangan penggunaan energi
(misalnya energi listrik), low energy house dan zero energy building dengan
memaksimalkan penutup bangunan (building

envelope). Penggunaan energi

terbarukansepertienergimatahari,air,biomass,danpengolahanlimbahmenjadi
energijugapatutdiperhitungkan.
Daripengertiandiatas,GreenArchitecture sangatberpengaruh pentingterhadap
kehidupanmanusia,baikdimasalampau,sekarangterutamaakandatang.
3.2. GREEN BUILDING
Bangunan hijau (Green Building) mengacu pada struktur dan menggunakan
prosesyangbertanggungjawabterhadaplingkungandansumberdayayangefisiendi
seluruhsiklushidupbangunan:daripenentuantapaksampaidesain,konstruksi,

operasi, pemeliharaan, renovasi pembongkaran, dan. Praktik ini memperluas dan


melengkapi desain bangunan klasik keprihatinan ekonomi, dayatahan utilitas,, dan
kenyamanan.
Green

building

adalah konsep untuk bangunan berkelanjutandan

mempunyai syarat tertentu, yaitu lokasi, sistim perencanaan dan perancangan,


renovasidan pengoperasian,yang menganutprinsip hemat enrgiserta harus
berdampakpositifbagilingkungan,ekonomidansosial.
Meskipunteknologibaruyangterusdikembangkan untukmelengkapipraktek
saatinidalammenciptakanstrukturhijau,tujuanumumadalahbahwabangunanhijau
dirancang untuk mengurangi dampak keseluruhan lingkungan binaan terhadap
kesehatanmanusiadanlingkunganalamdengancara:
1) Efisien menggunakan energi, air, dansumber daya lainnya. Dirancang dengan
biayalebih sedikituntuk mengoperasikandanmemilikikinerjaenergiyang
sangatbaik.
2) Melindungikesehatanpenghunidanmeningkatkanproduktivitaskaryawan
3) Mengurangisampah,polusidandegradasilingkungan
4) Bangunanalami,yangbiasanyapada skalayang lebihkecildancenderung
untukfokuspadapenggunaanbahan-bahanalamiyangtersediasecaralokal.
5) Bangunanhijautidaksecarakhususmenangani masalahperkuatanrumahyang
ada..
6) Mengurangi dampak lingkungan : Praktek green building bertujuan untuk
mengurangidampaklingkungandaribangunan.
3.3. SUSTAINABLE ARCHITECTURE
Arsitektur Berkelanjutan, adalah sebuah topik yang menarik. Akhir-akhir ini
semakinbanyakdiberitakandandipromosikan dalamkalanganarsitek,karenaarsitek
memiliki peran penting dalam pengelolaan sumber daya alam dalam desain-desain
bangunannya.Apresiasiyangbesarbagimerekayangturutmempromosikan
arsitektur berkelanjutan agar kita lebih bijaksana dalam menggunakan sumber daya
alamyangmakinmenipis.

Sustainable Architecture atau dalam bahasa Indonesianya adalah Arsitektur


Berkelanjutan,adalahsebuahkonsepterapandalambidangarsitekturuntuk
mendukung konsep berkelanjutan, yaitu konsep mempertahankan sumber daya alam
agar bertahan lebih lama, yang dikaitkan dengan umur potensi vital sumber daya
alam danlingkungan ekologis manusia, seperti sistem iklimplanet,sistem pertanian,
industri,kehutanan,dantentusajaarsitektur.Kerusakanalamakibateksploitasi
sumber daya alamtelah mencapai taraf pengrusakan secara global, sehingga lambat
tetapi pasti, bumi akan semakin kehilangan potensinya untuk mendukung kehidupan
manusia,akibatdariberbagaieksploitasiterhadapalamtersebut.
Keberlanjutan dapat didefinisikan sebagai memenuhi kebutuhan generasi
sekarang tanpa mengorbankan kemampuan generasi mendatang untuk memenuhi
kebutuhan mereka Cara-cara baru dapat dipikirkan berdasarkan pengalaman
membangun,dariarsitekturvernakularmaupunmodern.
4. PEMBAHASAN
4.1. PENERAPAN GREEN ARCHITECTURE
1) MemilikiKonsepHighPerfomanceBuilding&EarthFriendly.
a.Dapatdilihatdaridindingbangunan,terdapatkacadibeberapa
bagiannya.Fungsinyaadalahuntukmenghematpenggunaanelektrisiti
untukbangunanterutamadarisegipencahayaandarilampu.
b.Menggunakanenergialamsepertiangin,sebagaipenyejuklingkungan.
c.Bahan-bahan bangunan yang digunakan cenderung ramah pada
lingkungan seperti keramik dengan motif kasar pada lantai untuk
mengurangipantulanpanasyangdihasilkandaridindingyangberkaca.
d.KolamairdisekitarBangunanberfungsiselaindapatmemantulkan sinar
lampu,jugadapatmereduksipanasmataharisehinggaudaratampak
sejukdanlembab.
2) MemilikiKonsepSustainable
Pembangunannya sangatdikonsepkan, menelaahlahanlingkunganwilayah
yangsangatterbatas,dengankonsepalamiahdannatural,dipadukandengan

konsep teknologi tinggi, bangunan ini memungkinkan terus bertahan dalam


jangkapanjangkarenatidakmerusaklingkungansekitaryangada.
3) MemilikiKonsepFutureHealthly.
a.Dapatdilihatdaribeberapatanamanrindangyangmengelilingi
bangunan, membuat iklim udara yang sejuk dan sehat bagi kehidupan
sekitar, lingkungan tampak tenang, karena beberapa vegetasi dapat
digunakansebagaipenahankebisingan.
b.Dindingbangunan curtain walldilapisialumunium dapatberguna untuk
UV protector untuk bangunan itu sendiri. Tentunya ini semua dapat
memberiefekpositifuntukkehidupan.
c.Pada bagian atap gedung, terdapat tangga untuk para penggunayang
akan menuju lantai atas. Ini dapat meminimalisasipenggunaan listrik
untukliftataueskalator.
d.Tentulebihmenyehatkan,selainsejukpadaatapbangunanterdapat
rumputyangdigunakansebagaigreenroof,penggunajugamendapatkan
sinarmatahari.
4) MemilikiKonsepClimateSupportly.
Dengankonseppenghijauan,sangatcocokuntukiklimyangmasih
tergolong tropis (khatulistiwa). Pada saat penghujan, dapat sebagai resapan
air,danpadasaatkemarau,dapatsebagaipenyejukudara.
5) MemilikiKonsepEstheticUsefully.
Penggunaan green roof pada kampus ini, selain untuk keindahan dan agar
terlihat menyatu dengan alam, juga dapat digunakan sebagai water catcher
sebagi proses pendingin ruangan alami karena sinar matahari tidak diserap
beton secara langsung. Ini juga menurunkan suhu panas di siang hari dan
sejuk di malam hari untuk lingkungan sekitarnya. Desainnya yang
melengkungdigunakanagarpenyerapan matahariolehkulitbangunandapat
diminimalisasikan.
4.2. PENERAPAN GREEN BUILDING

1) Efisiensi Energy
Bangunanhijauseringtermasuklangkah-langkah untukmengurangi
konsumsienergi-energiyangterkandungbaikdiperlukanuntuk
mengekstrak, proses,transportasi dan menginstal bahanbangunan dan
energi operasi untuk menyediakanlayananseperti pemanasandan listrik
untukperalatan.
Seperti kinerja tinggi bangunan menggunakan energi operasi yang kurang,
energi yang terkandung telah diasumsikan penting jauh lebih besar - dan
mungkin membuat sebanyak 30% dari konsumsi energi secara keseluruhan
siklus hidup. Studi gedung menunjukanbahwabangunanyang dibangun
terutama dengan kayu akan memiliki energi yang terkandung lebih rendah
daripadamerekadibangunterutamadenganbata,betonataubaja
Untuk mengurangi operasi penggunaan energi, efisiensi tinggi jendela dan
isolasi di dinding, plafon, dan lantai meningkatkan efisiensi selubung
bangunan,(penghalangantara ruang AC dan tanpa syarat). Strategi lain,
desainbangunan pasifsurya,seringdiimplementasikan dalamenergirendah
rumah. Desainer mengorientasikan jendela dan dinding dan tenda tempat,
beranda, dan pohon untukjendela naungan danatap selama musim panas
sambil memaksimalkankeuntungansurya di musim kemarau.Selain itu,
penempatan jendela yang efektif (pencahayaan) dapat memberikan lebih
banyak cahaya alami dan mengurangi kebutuhan untuk penerangan listrik
pada siang hari. Pemanas air tenaga surya lebih lanjut mengurangi biaya
energi.
Ruanggenerasienergiterbarukanmelaluitenagasurya,tenagaangin,tenaga
air,atau biomassa secara signifikan dapat mengurangi dampak lingkungan
dari bangunan. Pembangkit listrik umumnya fitur yang paling mahal untuk
ditambahkankesebuahbangunan.
2) Efisiensi Air
Mengurangikonsumsiair danmelindungikualitasair merupakantujuan
utamadalambangunanyangberkelanjutan.Salahsatuisupentingdari

konsumsi airadalahbahwadibanyak daerah, tuntutan terhadap penyediaan


akuifer melampaui kemampuannya untuk mengisi dirinya sendiri.
Semaksimal mungkin, fasilitas harus meningkatkan ketergantungan mereka
padaairyangdikumpulkan,digunakan,dimurnikan,dandigunakankembali
di tempat. Perlindungan dan konservasi airsepanjang kehidupan bangunan
dapat dicapai dengan merancang untuk pipa ganda yang mendaur ulang air
ditoiletdisiram.
Limbah-air dapat diminimalkan dengan memanfaatkan perlengkapan
konservasi air seperti ultra-rendah toilet flush dan aliran rendah kepala
pancuran. Bidets membantu menghilangkan penggunaan kertas toilet,
mengurangi lalu lintas selokan dan kemungkinan meningkatnya kembali
menggunakan airditempat.Titikperawatan menggunakan airdanpemanas
meningkatkan baik kualitas air dan efisiensi energi sementara mengurangi
jumlah air dalam sirkulasi. Penggunaan non-limbah dan greywater untuksitus digunakan seperti situs-irigasi akan meminimalkan tuntutanpada
akuifersetempat.
3) Efisiensi Bahan / Material
Bahanbangunanbiasanyadianggapsebagai'hijau'termasukkayudarihutan
yangtelah disertifikasi dengan standar hutan pihak ketiga, bahan tanaman
cepat terbarukan seperti bambu dan jerami, batu dimensi, batu daur ulang,
logam daur ulang, dan produk lainnya yangnon- beracun, dapat digunakan
kembali, terbarukan, dan / atau didaur ulang (misalnya, Trass, Linoleum,
wol domba, panel terbuat dari kertas serpih, tanah liat, vermikulit,linen
rami, sisal, padang lamun, gabus , kelapa, kayu piring serat, kalsium pasir
batu, beton) juga menyarankan menggunakan barang-barang industri daur
ulang, seperti produk pembakaran batubara, pasir pengecoran, dan puingpuingpembongkarandalamproyekkonstruksi
Bahan bangunan harus diekstrak dan diproduksi secara lokal ke situs
bangunan untuk meminimalkan energi tertanam dalamtransportasi mereka.
Bila memungkinkan, elemen bangunan harus diproduksi off-situs dan

dikirimkan kesitus,untuk memaksimalkan manfaat darioff-situs


manufakturtermasukmeminimalkanlimbah,daur ulang memaksimalkan
(karena manufaktur adalah disatu lokasi), kebisingan unsur kualitas tinggi,
lebihbaikmanajemenKeselamatandanKesehatanKerja.

4) Peningkatan Mutu Lingkungan


Kualitas Lingkungan diwujudkan dalam kategori untuk memberikan
kenyamanan, kesejahteraan, dan produktivitas penghuninya, kualitas udara
dalamruangan,kualitastermal,danpencahayaankualitas.
IndoorAirQualityberusahauntukmengurangi senyawaorganikyang
mudah menguap, atau kotoran udara lainnya seperti kontaminan mikroba.
Bangunanbergantungpada sistemventilasiyang dirancangdenganbaik
(passively/naturally- atau mekanis bertenaga) untuk menyediakan ventilasi
yangmemadaiudara bersihdariluar rumah ataudiresirkulasi, udara
disaring serta operasi terisolasi (dapur, pembersih kering, dll) dari hunian
lain. Selamaprosesdesaindan konstruksimemilihbahan bangunandan
produk selesai interior dengan emisi nol atau rendah akan meningkatkan
kualitasudara.
Sebagian besar bahan bangunan dan pembersihan/ pemeliharaanproduk
memancarkan gas, beberapa dari mereka beracun, termasuk formaldehida.
Gas-gas ini dapat memiliki dampak merugikan pada kesehatan penghuni,
kenyamanan,danproduktivitas.
Juga penting untuk kualitas udara dalam ruangan adalah kontrol akumulasi
kelembaban (kelembaban) yangmengarah ke pertumbuhan jamur dan
adanya bakteri dan virus serta tungau debu dan organisme lain dan
kekhawatiran mikrobiologi. Intrusi air melalui amplop bangunan atau
kondensasi air pada permukaan dingin pada interior bangunan dapat
meningkatkan danmempertahankan pertumbuhan mikroba. Sebuah amplop

baik berisolasi dan tertutup rapat akan mengurangimasalah kelembaban,


tetapiventilasiyangmemadaijugadiperlukan untukmenghilangkan uapair
daridalamruangansumbertermasukprosesmetabolismemanusia,
memasak,mandi,membersihkan,dankegiatanlainnya.
KontrolsuhualiranudaraatassistemAC ditambahdenganselubung
bangunan yang dirancang dengan baik juga akan membantu dalam
meningkatkan kualitas termal bangunan. Menciptakan lingkungan
bercahayakinerjatinggimelaluiintegrasihati-hatidansumbercahayasiang
harilistrik akan memperbaiki kualitas pencahayaan dan kinerja energi dari
struktur.
Produk-produkkayu solid, khususnya lantai, seringkaliditentukandalam
lingkungan di mana penghuni diketahui memiliki alergi terhadap debu atau
partikel lainnya. Kayu itusendiri dianggap hypo-allergenic dan permukaan
halus mencegah penumpukan partikel lembut seperti karpet. Untuk itu
direkomendasikankayu, vinil, ubin lantai linoleum atau batu tulis bukan
karpet. Penggunaan produk kayu juga dapat meningkatkan kualitas udara
dengan menyerap atau melepaskan uap air di udara untuk kelembaban
moderat.
Interaksi antara semua komponen indoor dan penghuni bersama-sama
membentukproses-prosesyangmenentukankualitasudaradalamruangan.
5) Operasi Dan Optimasi Pemeliharaan
Keberkelanjutanbangunandapatdioperasikansecarabertanggungjawab
dandipeliharadenganbaik.Jikatahapoperasidanpemeliharaan merupakan
bagian dari perencanaan proyek dan proses pembangunan akan membantu
mempertahankankriteria hijauyang dirancangpada awal proyek.Setiap
aspek dari bangunan hijau adalah diintegrasikan ke dalam fase Operating
danMaintenance. Meskipun tujuan pengurangan limbah dapat diterapkan
selama fase desain, konstruksi dan pembongkaran tetapi siklus hidup
bangunan ituadalah dalamfaseO&Mdengan carasepertidaur ulangdan
peningkatankualitasudaraberlangsung.

6) Pengurangan Sampah
Arsitektur hijau juga berusaha untuk mengurangipemborosanenergi, air
dan bahan yang digunakan selama konstruksi. Selama fase konstruksi, satu
tujuan harus untuk mengurangi jumlah bahan pergi ke tempat pembuangan
sampah.Bangunan yangdirancangdenganbaikjugamembantumengurangi
jumlah limbah yangdihasilkan olehpenghuni juga,dengan menyediakan di
tempat sampah solusi seperti kompos untuk mengurangi masalah akan ke
tempatpembuangansampah.
Untukmengurangi jumlah kayu yangmasuk keTPA,saat bangunan
mencapaiakhirmasapakainya,merekabiasanyadibongkardandiangkutke
tempatpembuangansampah.Dekonstruksiadalahmetodeapayang
umumnya dianggap "sampah" danreklamasi menjadi bahan bangunan yang
berguna. Memperpanjang masa manfaat struktur jugamengurangi limbah -.
Bahanbangunan sepertikayuyangringandanmudahuntukbekerjadengan
membuatrenovasimudah.
Untukmengurangidampakpadasumurataupabrikpengolahanair,ada
beberapapilihan."Greywater",airlimbahdarisumbersepertipencucipiring
ataumesin cuci,dapatdigunakan untukirigasibawahpermukaan, ataujika
dirawat,untuknon-minumtujuan,misalnya,untukmenyiramtoiletdan
mencucimobil.Kolektorairhujandigunakanuntuktujuanserupa.
Sentralisasi sistem pengolahan air limbah dapat mahal dan menggunakan
banyakenergi.Sebuahalternatifuntukprosesiniadalahmengkonversi
limbahdanairlimbahmenjadipupuk,yangmenghindaribiayainidan
menunjukkan manfaat lainnya. Dengan mengumpulkan limbah manusia di
sumbernya danberjalan kepabrikbiogassemi-terpusat denganlimbah
biologis lainnya, pupuk cair dapat diproduksi. Praktik seperti ini
menyediakan tanah dengan nutrisi organik dan menciptakan penyerap
karbonyangmenghilangkan karbondioksidadariatmosfer,offsettingemisi
gasrumahkaca.Memproduksi pupukbuatanjugalebihmahaldalamenergi
daripadaprosesini.[34]

7) Optimasi Biaya dan Manfaat


Masalahyangpalingdikritiktentangmembangunbangunanramah
lingkungan adalah harga, peralatan baru, dan teknologi modern cenderung
biaya lebih banyak uang. Penghematan uangberasal dari penggunaan yang
lebihefisienutilitasyangmenghasilkantagihanenergimenurun.
Studi telah menunjukkan selama masa hidup rentabilitas investasi green
building,mencapaisewasecarasignifikanlebihtinggi,hargajualdan
tingkat hunian serta tingkat kapitalisasi yang lebih rendah berpotensi
mencerminkanrisikoinvestasiyanglebihrendah
8) Peraturan Dan Operasi
Sebagai akibat dari meningkatnya minat dalam konsep green building dan
praktek, sejumlah organisasi telahmengembangkan standar, kode dan
sistem rating yang memungkinkan regulator pemerintah, membangun
profesionaldankonsumenmenerimagreenbuildingdengankeyakinan.
Dalam beberapa kasus, kode ini ditulis sehingga pemerintah daerah dapat
mengadopsi mereka sebagai peraturan untuk mengurangi dampak
lingkunganlokalbangunan.
PerluKodedanPeraturantentangStandarBangunanHijau/Green Building
yang membantu menentukan tingkat konsumen struktur dari kinerja
lingkungan, membangun fituropsional yangmendukungdesainhijaudalam
kategori seperti lokasi dan pemeliharaan bangunan, konservasi air, energi,
dan bahan bangunan, dan kenyamanan penghuni dan kesehatan, serta
menetapkanpersyaratanminimumuntukelemenbangunanhijauseperti
bahanataupemanasandanpendinginan.
4.3. PENERAPAN SUISTAINABLE ARCHITECTURE
Dampaknegatifdaripembangunankonstruksisangatberagam,antaralain
adalah dieksploitasinya sumber daya alam secara berlebihan. Simak saja,
pertambangansumberdayaalamyang dikerukhabis-habisan,penggundulan
hutan tanpa penanaman kembali, dimana hal-hal semacam ini dapat

menurunkankualitassumberdayaalamlaindibumi.Tidakhanyaitu,teknologi
dan hasil teknologi yang digunakan manusia seperti kendaraan, alat-alat
produksi dalam sistem produksi barang dan jasa (misalnya pabrik), peralatan
rumah tangga dansebagainya dapat menimbulkan dampak negatif akibat emisi
gasbuangan,limbahyangmencemarilingkungan.
Perlunya lebih banyak promosi bagi arsitektur berkelanjutan adalah sebuah
keharusan, mengingat kondisi bumi yang semakin menurun dengan adanya
degradasi kualitasatmosferbumiyangmemberidampakpadapemanasan
global.Semakinbanyakarsitek dan konsultanarsitekturyang menggunakan
prinsipdesainyangberkelanjutan,semakinbanyakpulabangunanyangtanggap
lingkungan dan meminimalkan dampak lingkungan akibat pembangunan.
Dorongan untuk lebih banyak menggunakan prinsip arsitektur berkelanjutan
antara lain dengan mendorong pula pihak-pihak lain untuk berkaitan dengan
pembangunan seperti developer, pemerintah dan lain-lain. Mereka juga perlu
untuk didorong lebih perhatian kepada keberlanjutan dalam pembangunan ini
dengan tidak hanya mengeksploitasi lahan untuk mendapatkan keuntungan
sebanyak-banyaknya tanpa kontribusi bagi lingkungan atau memperhatikan
dampaklingkunganyangdapatterjadi.
Tampaknya,sangattidakmudahuntukmenghilangkan samasekalidampakdari
pembangunandankonstruksiterhadaplingkungan.Tentunyatidakmungkin
untuk melarang orang membangun, karenasudah menjadi kebutuhan manusia,
sehingga yang dapat dilakukan adalah memasukkan konsep arsitektur
berkelanjutan dalamrangka meminimalkan dampaknegatif konstruksi terhadap
lingkungan.Konsep arsitektur berkelanjutanini memiliki banyak persamaan,
yaitu menyerukan agar sumber dayaalam dan potensi lahan tidak digunakan
secarasembarangan,penggunaanpotensilahanuntuk arsitekturyanghemat
energi,dansebagainya.
Berbagai konsep dalam arsitektur yang mendukung arsitektur berkelanjutan,
antaralain;
1) Dalam Efisiensi Penggunaan Energi

Arsitektur dapat menjadi media yang paling berpengaruh dengan


implementasi arsitektur berkelanjutan, karena dampaknya secara langsung
terhadaplahan. Konsep desain yang dapatmeminimalkan penggunaan
energi listrik,misalnya, dapatdigolongkan sebagaikonsepsustainable
dalamenergi,yangdapatdiintegrasikan dengankonseppenggunaansumber
cahaya matahari secara maksimal untuk penerangan, penghawaan alami,
pemanasanairuntukkebutuhandomestik,dansebagainya.
a.Memanfaatkansinar matahari untuk pencahayaanalami secara
maksimalpadasianghari,untukmengurangipenggunaanenergilistrik
b. Memanfaatkan penghawaan alami sebagai ganti pengkondisian udara
buatan (air conditioner). Menggunakan ventilasi dan bukaan,
penghawaansilang,dancara-carainovatiflainnya
c.Memanfaatkanairhujandalamcara-carainovatifuntukmenampungdan
mengolahairhujanuntukkeperluandomestik
d. Konsep efisiensi penggunaan energi seperti pencahayaan dan
penghawaanalamimerupakankonsepspesifikuntuk wilayahdengan
iklimtropis
2) Dalam Efisiensi Penggunaan Lahan
Lahanyang semakinsempit,mahaldan berhargatidak harusdigunakan
seluruhnya untuk bangunan, karena sebaiknya selalu ada lahan hijau dan
penunjangkeberlanjutanpotensilahan.
a. Menggunakan seperlunya lahan yang ada, tidak semua lahan harus
dijadikan bangunan, atau ditutupi dengan bangunan, karena dengan
demikian lahan yang ada tidak memiliki cukup lahan hijau dan taman.
Menggunakanlahansecaraefisien,kompakdanterpadu[ref4]
b. Potensi hijau tumbuhan dalam lahan dapat digantikan atau
dimaksimalkan dengan berbagai inovasi, misalnya pembuatan atap
diatasbangunan(tamanatap),tamangantung(denganmenggantungpotpot tanamanpada sekitar bangunan),pagar tanamanatau yang dapat

diisidengantanaman,dindingdengantamanpadadinding(sepertiyang
didesainAdiPurnomodalambeberaparumah),dansebagainya[ref3]
c. Menghargai kehadiran tanaman yang adadilahan, dengantidakmudah
menebangpohon-pohon,sehinggatumbuhanyang ada dapat menjadi
bagianuntukberbagidenganbangunan
d.Desain terbukadengan ruang-ruang yangterbuka ketaman(sesuai
denganfleksibilitasbuka-tutupyang direncanakansebelumnya)dapat
menjadi inovasi untuk mengintegrasikan luar dan dalam bangunan,
memberikanfleksibilitasruangyanglebihbesar.
e.Dalamperencanaandesain,pertimbangkanberbagaihalyangdapat
menjaditolakukurdalammenggunakanberbagaipotensilahan,
misalnya; berapaluasdanbanyakruangyangdiperlukan? Dimanaletak
lahan (dikota atau didesa) dan bagaimana konsekuensinya terhadap
desain? Bagaimana bentuksitedanpengaruhnya terhadap desain ruangruang?Berapabanyakpotensicahayadanpenghawaanalamiyangdapat
digunakan?
3) Dalam Efisiensi Penggunaan Material
a.Memanfaatkanmaterialsisauntukdigunakanjugadalampembangunan,
sehingga tidak membuang material, misalnya kayu sisa bekisting dapat
digunakanuntukbagianlainbangunan
b.Memanfaatkanmaterial bekas untuk bangunan,komponenlama yang
masihbisadigunakan,misalnyasisabongkaranbangunanlama.
c.Menggunakan material yangmasihberlimpah maupun yangjarang
ditemui dengan sebaik-baiknya, terutama untuk material yang semakin
jarangsepertikayu.
d.Dalampenggunaanteknologidanmaterialbaru
e.Memanfaatkanpotensi energi terbarukan seperti energi angin, cahaya
mataharidanairuntukmenghasilkan energilistrikdomestikuntuk
rumahtanggadanbangunanlainsecaraindependen

f. Memanfaatkan materialbarumelaluipenemuan baruyangsecaraglobal


dapatmembukakesempatanmenggunakanmaterialterbarukanyang
cepatdiproduksi,murahdanterbukaterhadapinovasi,misalnyabambu.
4) Dalam Manajemen Limbah
a. Membuat sistem pengolahan limbah domestik seperti air kotor (black
water, grey water) yang mandiri dan tidak membebani sistem aliran air
kota.
b.Cara-cara inovatifyang patut dicoba seperti membuatsistem
dekomposisi limbah organik agar terurai secara alami dalam lahan [ref
buku rumah], membuatbenda-bendayang biasa menjadi limbah atau
sampah domestik dari bahan-bahan yang dapat didaur ulang atau dapat
denganmudahterdekomposisisecaraalami.
5. KESIMPULAN
Green

Architecture

ialah sebuah konsep arsitektur yang berusaha

meminimalkan pengaruh buruk terhadap lingkungan alam maupun manusia dan


menghasilkan tempat hidup yang lebih baik dan lebih sehat, yang dilakukan dengan
caramemanfaatkan sumberenergidansumber dayaalamsecaraefisiendanoptimal.
KonsepGreenBuildingataubangunanhijaumengacupadastrukturdan
menggunakan proses yangbertanggung jawab terhadap lingkungan dansumber daya
yang efisien di seluruh siklus hidup bangunan: dari penentuan tapak sampai desain,
konstruksi, operasi, pemeliharaan, renovasi dan pembongkaran. Praktik ini
memperluasdanmelengkapidesainbangunanklasikkeprihatinanekonomi,dayatahan
utilitasdankenyamanan.
Sustainable Architecture atauArsitektur Berkelanjutan, adalah sebuah konsep
terapandalambidangarsitekturuntukmendukungkonsepberkelanjutan,yaitukonsep
mempertahankan sumberdayaalamagarbertahan lebihlama, yangdikaitkandengan
umurpotensivitalsumberdayaalamdan lingkungan ekologismanusia,seperti
sistemiklimplanet,sistempertanian,industri,kehutanan,dantentusajaarsitektur.

DAFTAR PUSTAKA
Agenda21Sektoral.Perencanaan Pembangunan Berkelanjutan, KantorMenteri
NegaraLingkunganHidup,Jakarta,2001.
Agenda21Sektoral,Indikator Pembangunan Berkelanjutan, KantorMenteri
NegaraLingkunganHidup,Jakarta,2001.
CharlesE.Kupchella,MargaretC.Hyland,Environmental Science,PrenticeHall
EnglewoodCliffs,NewJersey,1993.
EdwinS.Mills,PhilipE.Graves,The Economic of Environmental Quality,W-W
Norton&CompanyInc.,NewYork,1986.
EkoBudihardjo,Lingkungan Binaan Dan Tata Ruang Kota,PenerbitAndi,
Yogyakarta,1997.
EkoBudiardjo,DjokoSujarto,Kota Yang Berkelanjutan, DirektoratJenderal
PendidikanTinggiDepartemenPendidikanTinggidanKebudayaan,Jakarta,
1998.
F.DouglasMurcheff,Principles of Sustainable Development,Butterworth
Architecture,Wellington,1996.
GideonS.Golony,Ethics dan Urban Design, Culture, From dan Environment,
JohnWileydanSons.Inc.,NewYork,1995.
HeinzFrick,Seri Eko Arsitektur I,PenerbitKanisius,Jakarta,1998.
Kamala,DL.KanthRao,Environmental Engineering,TataMC.GrawHill
PublishingCo.Ltd,NewDelhi,1989.
KantorMenteriNegaraKependudukanDanLingkunganHidup,Kulaitas
Lingkungan Di Indonesia Tahun 1990,PT.Intermasa,Jakarta,1990.
OttoSoemarwoto,Ekologi Lingkungan Hidup dan Pembangunan,Penerbit
Djambatan,Jakarta,1989.
RuslanD.Prawiro,Ekologi Lingkungan Pencemaran,PenerbitSatyaWacana,
Semarang,1983.
SudhartoP.Hadi,Manusia dan Lingkungan,BadanPenerbitUniversitas
Diponegoro,Semarang,2000.