Anda di halaman 1dari 21

Askep Infeksi

asuhan keperawatan pada pasien dengan


infeksi dan potensial infeksi
by : Mas Irul

Kesehatanyangbaiktergantungsebagianpadalingkunganyangaman.Praktisiatauteknisi
yang memantau atau mencegah penularan infeksi membantu melindungi klien dan pekerja
kesehatandaripenyakit.Setiaptahundiperkirakan2jutapasienmengalamiinfeksisaatdirawat
diRumahSakit.HaliniterjadikarenapasienyangdirawatdiRumahSakitmempunyaidaya
tahantubuhyangmelemahsehinggaresistensiterhadapmikroorganismepenyebabpenyakit
menjadi turun, adanya peningkatan paparan terhadap berbagai mikroorganisme dan
dilakukannyaprosedurinvasiveterhadappasiendiRumahSakit.Mikroorganismebisaeksisdi
setiaptempat,dalamair,tanah,permukaantubuhsepertikulit,saluranpencernaandanarea
terbuka lainnya. Infeksi yang di derita pasien karena dirawat di Rumah Sakit, dimana
sebelumnyapasientidakmengalamiinfeksitersebutdinamakaninfeksinosokomial.Menurut
PatriciaCParen,pasiendikatakanmengalamiinfeksinosokomialjikapadasaatmasukbelum
mengalamiinfeksikemudiansetelahdirawatselama4872jamklienmenjaditerinfeksi.
Infeksi nosokomial bisa bersumber dari petugas kesehatan, pasien yang lain, alat dan
bahanyangdigunakanuntukpengobatanmaupundarilingkunganRumahSakit.Faktorfaktor
yang mempengaruhiterjadinya infeksi nosokomial antara lain: faktor internal (seperti usia,
penggunaan obat, penyakit penyerta, malnutrisi, kolonisasi flora normal tubuh, personal
hygieneyangrendah,perilakupersonaldll)sertafaktoreksternal(sepertibanyaknyapetugas
kesehatanyangkontaklangsungdenganpasien,banyaknyaprosedurinvasif,lamatinggaldi
RS,lingkunganyangterkontaminasidll).Dengancaramempraktikkanteknikpencegahandan
pengendalian infeksi, perawat dapat menghindarkan penyebaran mikroorganisme terhadap
klien.
Infeksiadalahprosesinvasifolehmikroorganismedanberpoliferasididalamtubuhyang
menyebabkansakit(Potter&Perry,2005).Infeksiadalahinvasitubuholehmikroorganisme
danberproliferasidalamjaringantubuh.(Kozier,etal,1995).Dalam Kamus Keperawatan
disebutkanbahwainfeksiadalahinvasidanmultiplikasimikroorganismedalamjaringantubuh,
khususnyayangmenimbulkancederaselulersetempatakibatmetabolismekompetitif,toksin,
replikasi intraseluler atau reaksi antigenantibodi. Munculnya infeksi dipengaruhi oleh
beberapa faktor yang saling berkaitan dalam rantai infeksi. Adanya patogen tidak berarti
bahwa

infeksi

akan

terjadi.
Mikroorganismeyangbisamenimbulkanpenyakitdisebutpathogen(ageninfeksi),sedangkan
mikroorganisme yang tidak menimbulkan penyakit/kerusakan disebut asimtomatik. Penyakit
timbuljikapathogenberkembangbiakdanmenyebabkanperubahanpadajaringannormal.Jika

penyakit bisa ditularkan dari satu orang ke orang lain, penyakit ini merupakan penyakit
menular(contagius).Mikroorganismemempunyaikeragamandalamvirulensi/keganasandan
jugaberagamdalammenyebabkanberatnyasuatupenyakityangdisebabkan.
TIPE MIKROORGANISME PENYEBAB INFEKSI
Penyebab infeksi dibagi menjadi 4 kategori, yaitu:
1.
Bakteri. Bakteri merupakan penyebab terbanyak dari infeksi. Ratusan spesies
bakteri dapat menyebabkan penyakit pada tubuh manusia dan dapat hidup didalamnya,
bakteri bisa masuk melalui udara, air, tanah, makanan, cairan dan jaringan tubuh dan
benda mati lainnya.
2.
Virus. Virus terutama berisi asam nukleat (nucleic acid), karenanya harus masuk
dalam sel hidup untuk diproduksi.
3.

Fungi. Fungi terdiri dari ragi dan jamur

4.
Parasit. Parasit hidup dalam organisme hidup lain, termasuk kelompok parasit
adalah protozoa, cacing dan arthropoda.

PERTAHANAN TUBUH NORMAL TERHADAP INFEKSI


Tubuh memiliki pertahanan normal terhadap infeksi. Flora normal tubuh yang
tinggal di dalam dan luar tubuh melindungi seseorang dari beberapa patogen. Setiap
sistem organ memiliki mekanisme pertahanan terhadap agen infeksius. Flora normal,
sistem pertahanan tubuh dan inflamasi adalah pertahanan nonspesifik yang melindungi
terhadap mikroorganisme.
Flora normal. Secara normal tubuh memiliki mikroorganisme yang ada pada
lapisan permukaan dan di dalam kulit, saliva, mukosa oral dan saluran gastrointestinal.
Manusia secara normal mengekskresi setiap hari trilyunan mikroba melalui usus. Flora
normal biasanya tidak menyebabkan sakit tetapi justru turut berperan dalam
memelihara kesehatan. Flora ini bersaing dengan mikroorganisme penyebab penyakit
unuk mendapatkan makanan. Flora normal juga mengekskresi substansi antibakteri
dalam dinding usus. Flora normal kulit menggunakan tindakan protektif dengan
meghambat multiplikasi organisme yang menempel di kulit. Flora normal dalam jumlah
banyak mempertahankan keseimbangan yang sensitif dengan mikroorganisme lain
untuk mencegah infeksi. Setiap faktor yang mengganggu keseimbangan ini
mengakibatkan individu semakin berisiko mendapat penyakit infeksi.
Pertahanan sistem tubuh. Sejumlah sistem organ tubuh memiliki pertahanan
unik terhadap mikroorganisme. Kulit, saluran pernafasan dan saluran gastrointestinal
sangat mudah dimasuki oleh mikroorganisme. Organisme patogen dengan mudah
menempel pada permukaan kulit, diinhalasi melalui pernafasan atau dicerna melalui
makanan. Setiap sistem organ memiliki mekanisme pertahanan yang secara fisiologis
disesuaikan dengan struktur dan fungsinya.

Mekanisme pertahanan Faktor pengganggu pertahanan


1. Kulit
Permukaan, lapisan yang utuh
Pergantian lapisan kulit paling luar
Sebum. Luka abrasi, luka pungsi, daerah maserasi, Mandi tidak teratur, Mandi
berlebihan
2. Mulut
Lapisan mukosa yang utuh

Saliva

Laserasi, trauma, cabut gigi

Higiene oral yang tidak baik, dehidrasi

3. Saluran pernafasan
Lapisan silia di jalan nafas bagian atas diselimuti oleh mukus

Makrofag

Merokok, karbondioksida & oksigen konsentrasi tinggi, kurang lembab, air dingin

4. Saluran urinarius
Tindakan pembilasan dari aliran urine
Lapisan epitel yang utuh

Obstruksi aliran normal karena pemasangan kateter, menahan kencing,


obstruksi karena pertumbuhan tumor.
Memasukkan kateter urine, pergerakan kontinyu dari kateter dalam uretra.

5. Saluran gastrointestinal
Keasaman sekresi gaster

Peristaltik yang cepat dalam usus kecil

Pemberian antasida

Melambatnya motilitas karena pengaruh fekal atau obstruksi karena massa

6. Vagina
Pada puberitas, flora normal menyebabkan sekresi vagina untuk mencapai Ph
yang rendah
Antibiotik dan kontrasepsi oral mengganggu flora normal
RANTAI INFEKSI
Proses terjadinya infeksi seperti rantai yang saling terkait antar berbagai faktor yang
mempengaruhi, yaitu agen infeksi, reservoir, portal of exit, cara penularan, portal of
entry dan host/ pejamu yang rentan.

AGEN INFEKSI
Microorganisme yang termasuk dalam agen infeksi antara lain bakteri, virus,
jamur dan protozoa. Mikroorganisme di kulit bisa merupakan flora transient maupun
resident. Organisme transient normalnya ada dan jumlahnya stabil, organisme ini bisa
hidup dan berbiak di kulit. Organisme transien melekat pada kulit saat seseorang
kontak dengan obyek atau orang lain dalam aktivitas normal. Organisme ini siap
ditularkan, kecuali dihilangkan dengan cuci tangan. Organisme residen tidak dengan
mudah bisa dihilangkan melalui cuci tangan dengan sabun dan deterjen biasa kecuali
bila gosokan dilakukan dengan seksama. Mikroorganisme dapat menyebabkan infeksi
tergantung pada: jumlah microorganisme, virulensi (kemampuan menyebabkan
penyakit), kemampuan untuk masuk dan bertahan hidup dalam host serta kerentanan
dari host/penjamu.
RESERVOAR (sumber mikroorganisme)
Adalah tempat dimana mikroorganisme patogen dapat hidup baik berkembang
biak atau tidak. Yang bisa berperan sebagai reservoir adalah manusia, binatang,
makanan, air, serangga dan benda lain. Kebanyakan reservoir adalah tubuh manusia,
misalnya di kulit, mukosa, cairan maupun drainase. Adanya microorganisme patogen
dalam tubuh tidak selalu menyebabkan penyakit pada hostnya. Sehingga reservoir
yang di dalamnya terdapat mikroorganisme patogen bisa menyebabkan orang lain
menjadi sakit (carier). Kuman akan hidup dan berkembang biak dalam reservoar jika
karakteristik reservoarnya cocok dengan kuman. Karakteristik tersebut yaitu oksigen,
air, suhu, pH, dan pencahayaan.
PORTAL OF EXIT (jalan keluar)
Mikroorganisme yang hidup di dalam reservoir harus menemukan jalan keluar
(portal of exit untuk masuk ke dalam host dan menyebabkan infeksi. Sebelum
menimbulkan infeksi, mikroorganisme harus keluar terlebih dahulu dari reservoarnya.
Jika reservoarnya manusia, kuman dapat keluar melalui saluran pernapasan,
pencernaan, perkemihan, genitalia, kulit dan membrane mukosa yang rusak serta
darah.
CARA PENULARAN
Kuman dapat menular atau berpindah ke orang lain dengan berbagai cara seperti
kontak langsung dengan penderita melalui oral, fekal, kulit atau darahnya;kontak tidak
langsung melalui jarum atau balutan bekas luka penderita; peralatan yang
terkontaminasi; makanan yang diolah tidak tepat; melalui vektor nyamuk atau lalat.

PORTAL MASUK
Sebelum seseorang terinfeksi, mikroorganisme harus masuk dalam tubuh. Kulit
merupakan barier pelindung tubuh terhadap masuknya kuman infeksius. Rusaknya kulit
atau ketidakutuhan kulit dapat menjadi portal masuk. Mikroba dapat masuk ke dalam
tubuh melalui rute atau jalan yang sama dengan portal keluar. Faktor-faktor yang

menurunkan daya tahan tubuh memperbesar kesempatan patogen masuk ke dalam


tubuh.

DAYA TAHAN HOSPES (MANUSIA)


Seseorang terkena infeksi bergantung pada kerentanan terhadap agen infeksius.
Kerentanan bergantung pada derajat ketahanan tubuh individu terhadap patogen.
Meskipun seseorang secara konstan kontak dengan mikroorganisme dalam jumlah
yang besar, infeksi tidak akan terjadi sampai individu rentan terhadap kekuatan dan
jumlah mikroorganisme tersebut. Beberapa faktor yang mempengaruhi kerentanan
tubuh terhadap kuman yaitu usia, keturunan, stress (fisik dan emosional), status nutrisi,
terapi medis, pemberian obat dan penyakit penyerta.
FAKTOR YANG MEMPENGARUHI
1.
Usia

2.

Status nutrisi

3.

Stress

4.

Kelelahan

5.

Bed rest

6.

Hereditas

7.

Tidak diimuniasi

8.

Proses penyakit

9.

terapi medis

TIPE INFEKSI
Kolonisasi
Merupakan suatu proses dimana benih mikroorganisme menjadi flora yang
menetap/flora residen. Mikroorganisme bisa tumbuh dan berkembang biak tetapi tidak
dapat menimbulkan penyakit. Infeksi terjadi ketika mikroorganisme yang menetap tadi
sukses menginvasi/menyerang bagian tubuh host/manusia yang sistem pertahanannya
tidak efektif dan patogen menyebabkan kerusakan jaringan.
Infeksi lokal : spesifik dan terbatas pada bagain tubuh dimana mikroorganisme
tinggal.
Infeksi sistemik : terjadi bila mikroorganisme menyebar ke bagian tubuh yang
lain dan menimbulkan kerusakan.
Bakterimia : terjadi ketika dalam darah ditemukan adanya bakteri

Septikemia : multiplikasi bakteri dalam darah sebagai hasil dari infeksi sistemik

Infeksi akut : infeksi yang muncul dalam waktu singkat

Infeksi kronik : infeksi yang terjadi secara lambat dalam periode yang lama
(dalam hitungan bulan sampai tahun)
RESIKO INFEKSI

Luka

Kateter

Pemasangan terapi IV

Tindakan invasive

Pengambilan darah

TAHAP PROSES INFEKSI


Infeksi terjadi secara progresif dan beratnya infeksi pada klien tergantung dari
tingkat infeksi, patogenesitas mikroorganisme dan kerentanan penjamu. Dengan
proses perawatan yang tepat, maka akan meminimalisir penyebaran dan
meminimalkan penyakit. Perkembangan infeksi mempengaruhi tingkat asuhan
keperawatan yang diberikan.
Berbagai komponen dari sistem imun memberikan jaringan kompleks
mekanisme yang sangat baik, yang jika utuh, berfungsi mempertahankan tubuh
terhadap mikroorganisme asing dan sel-sel ganas. Pada beberapa keadaan,
komponen-komponen baik respon spesifik maupun nonspesifik bisa gagal dan hal
tersebut mengakibatkan kerusakan pertahanan hospes. Orang-orang yang mendapat
infeksi yang disebabkan oleh defisiensi dalam pertahanan dari segi hospesnya disebut
hospes yang melemah. Sedangkan orang-orang dengan kerusakan mayor yang
berhubungan dengan respon imun spesifik disebut hospes yang terimunosupres.
Efek dan gejala nyata yang berhubungan dengan kelainan pertahanan hospes
bervariasi berdasarkan pada sistem imun yang rusak. Ciri-ciri umum yang berkaitan
dengan hospes yang melemah adalah: infeksi berulang, infeksi kronik, ruam kulit, diare,
kerusakan pertumbuhan dan meningkatnya kerentanan terhadap kanker tertentu.
Secara umum proses infeksi adalah sebagai berikut:
Periode inkubasi
Interval antara masuknya patogen ke dalam tubuh dan munculnya gejala pertama.
Contoh: flu 1-3 hari, campak 2-3 minggu, mumps/gondongan 18 hari
Tahap prodromal
Interval dari awitan tanda dan gejala nonspesifik (malaise, demam ringan,
keletihan) sampai gejala yang spesifik. Selama masa ini, mikroorganisme tumbuh dan
berkembang biak dan klien lebih mampu menyebarkan penyakit ke orang lain.
Tahap sakit
Klien memanifestasikan tanda dan gejala yang spesifik terhadap jenis infeksi.
Contoh: demam dimanifestasikan dengan sakit tenggorokan, mumps dimanifestasikan
dengan sakit telinga, demam tinggi, pembengkakan kelenjar parotid dan saliva.
Pemulihan
Interval saat munculnya gejala akut infeksi
Inflamasi
Inflamasi merupakan reaksi protektif vaskular dengan menghantarkan cairan,
produk darah dan nutrien ke jaringan interstisial ke daerah cidera. Proses ini
menetralisasi dan mengeliminasi patogen atau jaringan mati (nekrotik) dan memulai

cara-cara perbaikan jaringa tubuh. Tanda inflamasi termasuk bengkak, kemerahan,


panas, nyeri/nyeri tekan, dan hilangnya fungsi bagian tubuh yang terinflamasi. Bila
inflamasi menjadi sistemik akan muncul tanda dan gejala demam, leukositas, malaise,
anoreksia, mual, muntah dan pembesaran kelenjar limfe.
Respon inflamasi dapat dicetuskan oleh agen fisik, kimiawi atau mikroorganisme.
Respon inflamasi termasuk hal berikut ini:
1.
respon seluler dan vaskuler. Arteriol yang menyuplai darah yang terinfeksi atau
yang cidera berdilatasi, memungkinkan lebih banyak darah masuk dala sirkulasi.
Peningkatan darah tersebut menyebabkan kemerahan pada inflamasi. Gejala hangat
lokal dihasilkan dari volume darah yang meningkat pada area yang inflamasi. Cidera
menyebabkan nekrosis jaringan dan akibatnya tubuh mengeluarkan histamin,
bradikinin, prostaglandin dan serotonin. Mediator kimiawi tersebut meningkatkan
permeabilitas pembuluh darah kecil. Cairan, protein dan sel memasuki ruang
interstisial, akibatnya muncul edema lokal.. Tanda lain inflamasi adalah nyeri.
Pembengkakan jaringan yang terinflamasi meningkatkan tekanan pada ujung syaraf
yang mengakibatkan nyeri. Substansi kimia seperti histamin menstimuli ujung syaraf.
Sebagai akibat dari terjadinya perubahan fisiologis dari inflamasi, bagian tubuh yang
terkena biasanya mengalami kehilangan fungsi sementara dan akan kembali normal
setelah inflamasi berkurang.
2.
pembentukan eksudat inflamasi. akumulasi cairan dan jaringan mati serta SDP
membentuk eksudat pada daerah inflamasi. Eksudat dapat berupa serosa (jernih
seperti plasma), sanguinosa (mengandung sel darah merah) atau purulen
(mengandung SDP dan bakteri). Akhirnya eksudat disapu melalui drainase limfatik.
Trombosit dan protein plasma seperti fibrinogen membentuk matriks yang berbentuk
jala pada tempat inflamasi untuk mencegah penyebaran.
3.
perbaikan jaringan. Sel yang rusak akhirnya digantikan oleh sel baru yang sehat.
Sel baru mengalami maturasi bertahap sampai sel tersebut mencapai karakteristik
struktur dan bentuk yang sama dengan sel sebelumnya

Respon imun
Saat mikroorganisme masuk dalam tubuh, pertama kali akan diserang oleh
monosit. Sisa mikroorganisme tersebut yang akan memicu respon imun. Materi asing
yang tertinggal (antigen) menyebabkan rentetan respon yang mengubah susunan
biologis tubuh. Setelah antigen masuk dala tubuh, antigen tersebut bergerak ke darah
atau limfe dan memulai imunitas seluler atau humural.
1.
Imunitas selular. Ada kelas limfosit, limfosit T (CD4T) dan limfosit B (sel B).
Limfosit T memainkan peran utama dalam imunitas seluler. Ada reseptor antigen pada
membran permukaan limfosit CD4T. Bila antigen bertemu dengan sel yang reseptor

permukaannya sesuai dengan antigen, maka akan terjadi ikatan. Ikatan ini
mengaktifkan limfosit CD4T untuk membagi diri dengan cepat untuk membentuk sel
yang peka. Limfosit yang peka bergerak ke daerah inflamasi, berikatan dengan antigen
dan melepaskan limfokin. Limfokin menarik & menstimulasi makrofag untuk menyerang
antigen
2.
Imunitas humoral. Stimulasi sel B akan memicu respon imun humoral,
menyebabkan sintesa imunoglobulin/antibodi yang akan membunuh antigen. Sel B
plasma dan sel B memori akan terbentuk apabila sel B berikatan dengan satu antigen.
Sel B mensintesis antibodi dalam jumlah besar untuk mempertahankan imunitas,
sedangkan sel B memori untuk mempersiapkan tubuh menghadapi invasi antigen.
3.
Antibodi. Merupakan protein bermolekul besar, terbagi menjadi imunoglobulin A,
M, D, E, G. Imunoglobulin M dibentuk pada saat kontak awal dengan antigen,
sedangkan IgG menandakan infeksi yang terakhir. Pembentukan antibodi merupakan
dasar melakukan imunisasi.
4.
Komplemen. Merupakan senyawa protein yang ditemukan dalam serum darah.
Komplemen diaktifkan saat antigen dan antibodi terikat. Komplemen diaktifkan, maka
akan terjadi serangkaian proses katalitik.
5.
Interferon. Pada saat tertentu diinvasi oleh virus. Interferon akan mengganggu
kemampuan virus dalam bermultiplikasi.

INFEKSI NOSOKOMIAL
Nosokomial berasal dari kata Yunani nosocomium, yang berarti rumah sakit.
Maka, kata nosokomial artinya "yang berasal dari rumah sakit" kata infeksi cukup jelas
artinya, yaitu terkena hama penyakit. Menurut Patricia C Paren, pasien dikatakan
mengalami infeksi nosokomial jika pada saat masuk belum mengalami infeksi
kemudian setelah dirawat selama 48-72 jam klien menjadi terinfeksi Infeksi nosokomial
bisa bersumber dari petugas kesehatan, pasien yang lain, alat dan bahan yang
digunakan untuk pengobatan maupun dari lingkungan Rumah Sakit
Unit perawatan intensif (UPI) merupakan area dalam RS yang berisiko tinggi
terkena Inos. Alasan ruang UPI berisiko terjadi infeksi nosokomial:
Klien di ruang ini mempunyai penyakit kritis

Peralatan invasif lebih banyak digunakan di ruang ini

Prosedur invasif lebih banyak dilakukan

Seringkali prosedur pembedahan dilakukan di ruang ini karena kondisi darurat

Penggunaan antibiotik spektrum luas

Tuntutan tindakan yang cepat membuat perawat lupa melakukan tehnik aseptik

Infeksi iatroigenik merupakan jenis inos yg diakibatkan oleh prosedur diagnostik


(ex:infeksi pada traktus urinarius yg terjadi setelah insersi kateter). Inos dapat terjadi
secara eksogen dan endogen. Infeksi eksogen didapat dari mikroorganisme eksternal
terhadap individu, yang bukan merupakan flora normal. Infeksi endogen terjadi bila
sebagian dari flora normal klien berubah dan terjadi pertumbuhan yang berlebihan.
Faktor yang berpengaruh pada kejadian infeksi klien:
Jumlah tenaga kesehatan yang kontak langsung dng pasien

Jenis dan jumlah prosedur invasif

Terapi yang diterima

Lamanya perawatan
Penyebab infeksi nosokomial meliputi:
1.
Traktus urinarius:
2.

Pemasangan kateter urine

3.

Sistem drainase terbuka

4.

Kateter dan selang tdk tersambung

5.

Obstruksi pada drainase urine

6.

Tehnik mencuci tangan tidak tepat

Traktus respiratorius:
Peralatan terapi pernafasan yang terkontaminasi

Tdk tepat penggunaan tehnik aseptif saat suction

Pembuangan sekresi mukosa yg kurang tepat

Tehnik mencuci tangan tidak tepat

Luka bedah/traumatik:
Persiapan kulit yg tdk tepat sblm pembedahan

Tehnik mencuci tangan tidak tepat

Tdk memperhatikan tehnik aseptif selama perawatan luka

Menggunakan larutan antiseptik yg terkontaminasi

Aliran darah:

Kontaminasi cairan intravena saat penggantian

Memasukkan obat tambahan dalam cairan intravena

Perawatan area insersi yg kurang tepat

Jarum kateter yg terkontaminasi

Tehnik mencuci tangan tidak tepat


Asepsis
Asepsis berarti tidak adanya patogen penyebab penyakit. Tehnik aseptik adalah
usaha yang dilakukan untuk mempertahankan klien sedapat mungkin bebas dari
mikroorganisme. Asepsis terdiri dari asepsis medis dan asepsis bedah. Asepsis medis
dimaksudkan untuk mencegah penyebaran mikroorganisme. Contoh tindakan: mencuci
tangan, mengganti linen, menggunakan cangkir untuk obat. Obyek dinyatakan
terkontaminasi jika mengandung/diduga mengandung patogen. Asepsis bedah, disebut
juga tehnik steril, merupakan prosedur untuk membunuh mikroorganisme. Sterilisasi
membunuh semua mikroorganisme dan spora, tehnik ini digunakan untuk tindakan
invasif. Obyek terkontaminasi jika tersentuh oleh benda tidak steril. Prinsip-prinsip
asepsis bedah adalah sebagai berikut:
Segala alat yang digunakan harus steril

Alat yang steril akan tidak steril jika tersentuh

Alat yang steril harus ada pada area steril

Alat yang steril akan tidak steril jika terpapar udara dalam waktu lama

Alat yang steril dapat terkontaminasi oleh alat yang tidak steril

Kulit tidak dapat disterilkan


ASUHAN KEPERAWATAN TERKAIT DENGAN INFEKSI

Pengkajian
Perawat mengkaji hal-hal dibawah ini:
a. Status mekanisme pertahanan
Pertahanan primer tidak adequat (kulit/mukosa rusak, jaringan trauma, obstruksi
aliran limfe, gangguan peristaltik, penurunan mobilitas)
Pertahanan sekunder tidak adequat (penurunan Hb, supresi SDP, supresi respon
inflamasi, leukopenia)
b. Kerentanan klien
Usia
Bayi mempunyai pertahanan yang lemah terhadap infeksi, lahir mempunyai
antibody dari ibu, sedangkan system imunnya masih imatur. Seiring bertumbuhnya
anak, sistem imun semakin matur, namun bayi masih rentan terhadap organisme
penyebab demam, infeksi usus, dan penyakit infeksius lainnya (mumps dan campak).
Dewasa awal sistem imun telah memberikan pertahanan pada bakteri yang
menginvasi. Pada usia lanjut, karena fungsi dan organ tubuh mengalami penurunan,
system imun juga mengalami perubahan.
Status nutrisi
Pengurangan asupan protein dan dan nutrien lain seperti karbohidrat
menyebabkan penurunan pertahanan tubuh. Perawat mengkaji asupan diet klien dan

kemampuan klien untuk mengkonsumsi makanan (ada tidak gangguan dalam proses
menelan maupun sistem pencernaannya).
Stress

Tubuh berespon terhadap stess emosi atau fisik melalui sindrom adaptasi umum.
Jika stess terus berlangsung, kadar kortison yan tinggi menyebabkan daya tahan tubuh
menurun.
Hereditas
Kelainan hereditas tertentu mengganggu pertahanan individu terhadap infeksi.

Proses penyakit
Klien yang sakit pada system imun berisiko terutama terhadap infeksi. Klien
yang mengalami sakit komplek (komplikasi) lebih berisiko terhadap infeksi.

Terapi medis
Beberapa obat dan terapi medis mempengaruhi system imun. Perawat perlu
mengkaji obat yang dikonsumsi klien.

c. Penampilan klinis
Tanda dan gejala infeksi bisa berupa infeksi lokal maupun sistemik. Perawat
perlu mengkaji tanda yang muncul pada klien.

d. Data laboratorium
Perawat mengkaji hasil pemeriksaan laboratorium klien.
Diagnosa
1.
Risiko infeksi b.d gangguan imunitas
2.

Risiko infeksi b.d kerusakan jaringan

3.

Risiko cidera b.d gangguan imunitas

4.

Kerusakan integritas kulit b.d gangguan sirkulasi

5.

Gangguan nutrisi kurang dari kebutuhan tubuh b.d kebiasaan diet yg buruk

6.

Gangguan nutrisi kurang dari kebutuhan tubuh b.d gangguan fungsi GI

Perencanaan
Tujuan umum dari perawatan termasuk hal berikut:
1.
Pencegahan paparan terhadap organisme infeksius
2.

Memantau & menurunkan penyebaran infeksi

3.

Mempertahankan resistensi terhadap infeksi

4.

Klien& keluarga belajar tentang kontrol infeksi

Implementasi

Pencegahan penyakit (menghancurkan reservoar infeksi, mengontrol portal


keluar dan masuk, menghindari tindakan penularan, mencegah bakteri menemukan
tempat untuk tumbuh)
Tindakan perawatan akut (pemberian antibiotik yg tepat dan tindakan perawatan
lainnya)
Kontrol agen infeksius:
Pembersihan. Membuang semua material asing seperti kotoran dan materi
organic dari suatu obyek.
Desinfeksi. Merupakan proses memusnahkan bakteri, kecuali bagian spora

Sterilisasi. Penghancuran dan pemusnahan seluruh mikroorganisme, termasuk


spora.

Kontrol reservoar
Mandi secara teratur

Mengganti balutan yang basah atau kotor

Benda terkontaminasi dibuang pada tempat yang tepat

Jarum terkontaminasi dibuang pada tempat yang tepat

Luka bedah dirawat dengan benar

Perawatan botol & kantong drainase

Pertahankan larutan dalam botol

Pengendalian penularan:
Cuci tangan

Menghindari penggunaan alat yg sama pada beberapa pasien

Menghindari benda kotor menyentuh seragam perawat

Instruksikan pengunjung untuk cuci tangan sebelum mengunjungi klien

Biasakan klien untuk cuci tangan

Kontrol terhadap portal masuk


Mempertahankan integritas kulit & membran mukosa

Kulit dijaga tetap lembab

Pengaturan posisi

Lakukan hygiene oral

Hati-hati dlm merawat luka

Hati-hati dalam membuang alat-alat medis sekali pakai

Perlindungan terhadap penjamu yang rentan:


Tindakan isolasi

Pertahankan status nutrisi

Pertahankan personal hygiene

Berikan dukungan sosial pd klien yg diisolasi

Lingkungan protektif

Perlindungan terhadap pekerja:


Gown

Masker

Sarung tangan

Kacamata pelindung

Pengumpulan spesimen

Membungkus barang atau linen

Evaluasi
Evaluasi tindakan/implementasi yang telah dilakukan, apabila tindakan belum
bisa menyelesaikan masalah maka tindakan keperawatan diteruskan, bila masalah
sudah teratasi, tindakan dihentikan.
Misalnya, jangan lupa mencuci tangan sebelum dan sesudah memeriksa pasien.
Tidak menggunakan satu alat secara berturut-turut pada beberapa pasien tanpa
dibersihkan dengan baik lebih dahulu setelah dipakai pada seorang pasien.
Memandikan dan membersihkan pasien jangan dianggap pekerjaan rutin yang harus
diselesaikan selekasnya, tetapi harus dikerjakan dengan penuh tanggung jawab akan
keselamatan pasien terhadap ancaman infeksi nosokomial.
Untuk ikut serta mencegah timbulnya resistensi bakteri dan fungi terhadap
antibiotik, gunakanlah antibiotik secara bertanggung jawab, yaitu hanya terhadap
bakteri dan fungi yang rentan, dan dalam jumlah yang memadai serta di bawah
pengawasan dokter.

KETERAMPILAN TERKAIT DENGAN


PENGONTROLAN INFEKSI

PROSEDUR MENCUCI TANGAN


Mencuci tangan adalah kegiatan membersihkan bagian telapak, punggung tangan dan
jari agar bersih dari kotoran dan membunuh kman penyebab penyakit yang merugikan
kesehatan manusia serta membuat tangan menjadi harum baunya.
Banyak orang yang menyepelekan dan melupakan aktifitas mencuci tangan setelah
melakukan suatu pekerjaan dan sebelum makan sehingga mereka beresiko terserang penyakit
yang berasal dari kuman di tangan.
Mencuci tangan yang baik dan sehat membutuhkan beberapa peralatan sebagai berikut di bawah
ini :
1. Sabun / antiseptik
2. Air bersih
3. Lap / tisu kering bersih
Untuk hasil yang maksimal disarankan mencuci tangan dengan baik, tidak terburu-buru,
serius dan teliti yaitu minimal dilakukan selama 20 detik. Dengan melakukan pencucian tangan

yang bersih dan teratur dapat menjauhkan kita dari virus, bakteri dan kuman penyebab penyakit
yang umumnya menyerang sistem pencernaan tubuh kita.
Salah satu penyakit yang biasa diakibatkan oleh kuman yang ikut masuk ke dalam tubuh
manusia bersama makanan adalah diare alias mencret. Selain di disebabkan oleh kuman
penyakit, diare juga dapat ditimbulkan oleh kekurangan cairan tubuh alias dehidrasi (kurang
minum).
Proses Langkah / Tahap Mencuci Tangan Dengan Sabun Antiseptik Yang Baik :
1.
Basahi sampai bersih dan rata tangan kita dengan air bersih yang mengalir.
2.
Sabuni telapak tangan kita sampai berbusa secukupnya dengan sabun batang / cair yang
dapat membunuh kuman.
3.
Usap-usap kedua telapak tangan kita sampai rata.
4.
Usap kedua bagian punggung tangan sampai merata.
5.
Bersihkan jari dan kuku jari kita sampai bersih.
6.
Bilas dengan air bersih yang mengalir sampai busa sabun tidak ada yang tersisa.
7.
Lap tangan kita dengan lap tangan atau tisu yang bersih sampai kering.
Tips Tambahan :
Sebaiknya kuku jari tangan kita tidak dibiarkan panjang, karena dapat menjadi sarang
penyakit. Jika memang suka kuku panjang maka rawatlah dengan baik dan hindarkan dari
benturan / cedera kuku agar kuku tidak terluka atau terlepas.
PROSEDUR PEMASANGAN SARUNG TANGAN
Memakai Sarung Tangan Steril
Pengertian
Menggunakan sarung tangan merupakan komponen kunci dalam meminimalkan
penularan penyakit serta mempertahankan lingkungan bebas infeksi.
Tujuan
Mengurangi resiko petugas terkena infeksi bakterial dari klien
Mencegah penularan flora kulit petugas pada klien
Mengurangi kontaminasi tangan petugas dengan mikroorganisme yang dapat berpindah
dari klien satu ke klien yang lainnya
Persiapan alat
Sarung tangan steril

Wastafel/air mengalir untuk cuci tangan

Handuk bersih

Sabun
Prosedur
1.
Siapkan peralatan dan bahan yang dibutuhkan
2.
Lepaskan cincin, jam tangan dan gelang
3.
Lakukan cuci tangan
4.
Buka pembungkus kemasan bagian luar dengan hati-hati menyibakkannya ke samping

5.
Pegang kemasan bagian dalam dan taruh pada permukaan datar yang bersih tepat
diatas ketinggian pergelangan tangan.
6.
Buka kemasan, pertahankan sarungtangan pada permukaan dalam pembungkus.
7.
Identifikasi sarung tangan kanan dan kiri. Setiap sarung tangan mempunyai manset
kurang lebih 5 cm (2 inci). Kenakan sarung tangan pada sarung tangan yang lebih dominan.
8.
Dengan ibu jari dan dua jari lainnya dari tangan non dominan, pegang tepi manset
sarung tangan untuk tangan dominan. Sentuh hanya pada permukaan dalam sarung tangan.
9.
Tarik sarung tangan pada tangan yang dominan, lebarkan manset, pastikan bahwa
manset tidak menggulung pada tangan, pastikan juga ibu jari dan jari-jari anda pada posisi
yang tepat.
10.
Dengan tangan yang telah memakai sarung tangan, masukkan jari di bawah manset
sarung tangan kedua.
11.
Tarik sarung tangan kedua pada tangan yang non dominan. Jangan biarkan jari-jari dan
ibu jari sarung tangan yang dominan menyentuh bagian tangan non dominan yang terbuka.
Pertahankan ibu jari sarung tangan non dominan abduksi ke belakang
12.
Jika sarung tangan kedua telah terpasang cakupkan kedua tangan, manset biasanya
terbuka saat pemasangan. Pastikan untuk menyentuh bagian yang steril.

PROSEDUR MENYIAPKAN LARUTAN STERIL


Dalam setiap tindakan, wajib hukumnya bagi setiap tenaga medis untuk memperhatikan
tentang pe-I (pencegahan infeksi). Maka dari itu, wajjjjibb pula untuk mengetahui setiap
langkah dari pe-I itu sendiri. Hal dasar yang wajjjjib dimengerti oleh para tenaga medis
mengenai pe-I, salah satunya adalah bagaimana membuat laruan klorin 0,5 %.
Nah, di bawah ini, iang akan share sedikit tentang bagaimana cara membuat larutan
klorin tersebut, mudah-mudahan dapat bermanfaat!
Untuk membuat larutan klorin, yang pertama harus dilakukan adalah menentukan dulu
jenis konsentratnya.
Karena, lain jenis lain pula cara perhitungnnya. Hanya dibutuhkan sedikit perhitungan
yang sangat sederhana..
1.
Bila jenis konsentrat yang digunakan adalah bubuk, maka rumus perhitungannya . . .
2.
Jika jenis kosentrat yang digunakan cair, maka rumusnya..
Contoh:
1.
Cara membuat larutan klorin 0,3% dari konsentrat klorin bubuk 15% yaitu Untuk
membuat larutan klorin 0,3% dari konsentrat klorin15% adalah dengan melarutkan 20 gr bubuk
klorin konsentrat dalam 1 Liter air DTT.
2.
Cara membuat larutan klorin 0,1% dari konsentrat klorin cair 5% Untuk membuat
larutan klorin 0,1% dari konsentrat klorin5% adalah dengan melarutkan 1 bagian klorin dalam
49 bagian air DTT.
STERILISASI ALAT
Sterilisasi
Pengertian ;

Suatu tindakan untuk membunuh kuman pathogen dan apatogen beserta sporanya pada
peralatan perawatan dan kedokteran dengan cara merebus, stoom, panas tinggi, atau
menggunakan bahan kimia.
Jenis peralatanyang dapat disterilkan :
1.
Peralatan yang terbuat dari logam, misalnya pinset, gunting, speculum dan lain-lain.
2.
Peralatan yang terbuat dari kaca, misalnya semprit (spuit), tabung kimia dan lain-lain.
3.
Peralatan yang terbuat dari karet, misalnya, kateter, sarung tangan, pipa penduga
lambung, drain dan lain-lain.
4.
Peralatan yang terbuat dari ebonit, misalnya kanule rectum, kanule trachea dan lainlain.
5.
Peralatan yang terbuat dari email, misalnya bengkok (nierbekken), baskom dan lainlain.
6.
Peralatan yang terbuat dari porselin, misalnya mangkok, cangkir, piring dan lain-lain.
7.
Peralatan yang terbuat dari plastik, misalnya slang i8nfus dan lain-lain.
8.
Peralatan yang terbuat dari tenunan, misalnya kain kasa, tampon, doek operasi, baju,
sprei, sarung bantal dan lain-lain.
Pelaksanaan :
1.
Sterilisasi dengan cara rebus. Mensterikan peralatan dengan cara merebus didalam air
sampai mendidih (1000C) dan ditunggu antara 15 sampai 20 menit. Misalnya peralatan dari
logam, kaca dan karet.
2.
Sterilisasi dengan cara stoom. Mensterikan peralatan dengan uap panas didalam
autoclave dengan waktu, suhu dan tekanan tertentu. Misalnya alat tenun, obat-obatan dan lainlain.
3.
Sterilisasi dengan cara panas kering. Mensterikan peralatan dengan oven dengan uap
panas tinggi. Misalnya peralatan logam yang tajam, peralatan dari kaca dan obat tertentu.
4.
Sterilisasi dengan cara menggunakan bahan kimia. Mensterikan peralatan dengan
menggunakan bahan kimia seperti alkohol, sublimat, uap formalin, khususnya untuk peralatan
yang cepat rusak bila kene panas. Misalnya sarung tangan, kateter, dan lain-lain.
Perhatian :
1.
Sterilisator harus dalam keadaan siap pakai.
2.
Peralatan harus bersih dan masigh berfungsi.
3.
Peralat yang dibungkus harus diberi label yang dengan jelas mencantumkan : nama,
jenis peralatan, tanggal dan jam disterilkan.
4.
Menyusun peralatan didalam sterilisator harus sedemikian rupa, sehingga seluruh
bagian dapat disterilkan.
5.
Waktu yang diperlukan untuk mensterilkan setiap jenis peralatan harus tepat (dihitung
sejak peralatan disterilkan).
6.
Dilarang memasukkan atau menambahkan peralatan lain kedalam sterilisator, sebelum
waktu untuk mensterilkan selesai.
7.
Memindahkan peralatan yang sudah steril ketempatnya harus dengan korentang steril.
8.
Untuk mendinginkan peralatan steril dilarang membuka bungkus maupun tutupnya.

9.
Bila peralatan yang baru disterilkan terbuka, peralatan tersebut harus disterilkan
kembali.
10.
Pemeliharaan Peralatan Perawatan dan Kedokteran
Pengertian :
Melaksanakan pemeliharaan peralatan perawatan dan kedokteran dengan cara membersihkan,
mendesinfeksi atau mensterilkan serta menyimpannya.
Tujuan :
(1)Menyiapkan peralatan perawatan dan kedokteran dalam keadaan siap pakai.
(2)Mencegah peralatan cepat rusak.
(3)Mencegah terjadinya infeksi silang.
a.Pemeliharaan Peralatan Dari Logam.
Jenis peralatan :
Misalnya :
1.
pisau operasi.
2.
Gunting.
3.
Pinset.
4.
Kocher.
5.
Korentang.
Persiapan :
1.
Peralatan yang akan dibersihkan.
2.
Tempat pencucuian dengan air yang mengilir atau baskom berisi air bersih.
3.
Sabun cuci.
4.
Sikat halus.
5.
Bengkok (nierbekken).
6.
Lap kering.
7.
Larutan desinfektan.
8.
Kain kasa.
9.
Stalisator dalam keadaan siap pakai.
Pelaksanaan :
1.
Peralatan yang sudah dipergunakan, dibilas air (sebaiknya dibawah air mengalir) untuk
menghilangkan kotoran yang melekat, kemudian direndam didalam larutan desinfektan
sekurang-kurangnya dua jam. Khusus peralatan yang telah dipergunakan pada pasien
berpenyakit menular, harus direndam sekurang-kurangnya 24 jam.
2.
Peralatan disabuni satuper satu, kemudian dibilas. Selanjutnya disterilkan dengan cara
merebus didalam sterilisator yang telah diisi air secukupnya, dimasak sampai mendidih. Setelah
air mendidih sekurang=-kurangnya 15 menit baru diangkat.
3.
Peralatan yang telah disterilkan, diangkat atau dipindahkan dengan korentang steril
ketempat penyiumpanan yang steril.
4.
Setelah selesai, peralatan dibersihkan, di\bereskan dan dikembalikan ketempat semula.
Perhatian :

Khusus peralatan logam yang tajam (misalnya pisau, gunting, jarum dll) harus
dibungkus dulu dengan kain kasa, kemudian barulah dimasukkan kedalam sterilisator, setelah
air mendidih dan ditungguantara tiga sampai lima menit baru diangkat.
b.Pemeliharaan Peralatan dari Gelas.
Jenis peralatan :
Misalnya :
1.
Kateter.
2.
Pengisap lendir bayi
3.
Spuit.
Persiapan :
1.
Peralatan yang akan dibersihkan.
2.
Tempat pencucian dengan air yang mengalir ataubaskom berisi air bersih.
3.
Sabun cuci
4.
Sikat halus.
5.
Bengkok (nierbekken).
6.
Lap kering.
7.
Larutan desinfektan.
8.
Kain kasa.
9.
Sterilisator dalam keadaan siap pakai.
10.
Lidi kapas
Pelaksanaan :
Sama dengan pelaksanaan pemeliharaan peralatan dai logam. Tapi khusus spuit,
pengisapnya dikeluarkan dan jarumnya dilepas, kemudian masing-masing alat dibungkus
dengan kain kasa, dan setelah itu baru dimasukkan kedalam sterilisator yang sudah berisi air
dan diltakkan berdampingan.
c.Pemeliharaan Peralatan Dari Karet.
Jenis peralatan :
Misalnya :
1.
kateter.
2.
Pipa penduga lambung atau maagslang.
3.
Drain.
Persiapan :
1.
Peralatan yang akan dibersihkan.
2.
Tempat pencucian dengan air yang mengalir atau baskom.
3.
Sabun cuci.
4.
Bengkok (nierbekken).
5.
Spuit.
6.
Kapas bersih dan tempatnya.
7.
Larutan desinfektan.
8.
Sterilisator dalam keadaan siap pakai.

Pelaksanaan :
1.
peralatan dibersihkan dan jika ada bekas-bekas plastic dihilangkan dengan kapas
bersih.
2.
Bagian didalamnya dibersihkan dengan menyemprotkan air dari spuit atau air mengalir
sambil dipijit-pijit sampai bersih.
3.
Setelah bersih, peralatan kemudian direndam didalam larutan desinfektan sekurangkurangnya dua jam, selanjutnya disabuni dan dibilas.
4.
Setelah air didalam sterilisator mendidih, peralatan dimasukkan dan dibiarkan antara
lima samapai sepuluh menit, baru diangkat dengan korentang steril. Setelah itu peralatan
disimpan ditempat yang steril.
5.
Setelah selesai, peralatan dibersihkan, dibereskan dan dikembalikan ke tempat semula.
d.Pemeliharaan sarung Tangan.
Persiapan :
1.
Sarung tangan kotor (bekas dipergunakan).
2.
Tempat pencucian dengan air mengalir atau baskom berisi air bersih.
3.
Sabun cuci.
4.
Lap kering atau handuk.
5.
Bedak biasa.
6.
Tablet formalin secukupnya.
7.
Tromol atau stoples yang tertutup rapat.
Pelaksanaan :
1.
Sarung tangan dibersihkan dan disabinu bagian luar dan dalamnya, lalu dibilas.
2.
Sarung tangan diperiksa apakah bocor atau tidak, dengan cara memasukkan udara
kedalamnya, lalu dicelupkan ke dalam air. Bila bocor dipisahkan.
3.
Setelah bersih, sarung tangan dikeringkan dengan cara menggantungkannya terbalik
atau langsungdikeringkan luar dan dalamnya dengan handuk atau lap kering.
4.
Beri bedak tipis secara merata bagian luar dan dalamnya.
5.
Sarung tangan diatur atau digulung sepasang-sepasang atau dipisahkan misalnya satu
kelompok bagian kiri atau kanan saja. Bila dipisahkan kiri atau kanan saja, harus diberi label
pengenal yang jelas pada tromol atau stoples masing-masing yang menunjukkan sebelah kanan
atau kiri, serta tanggal dan jam dimulainya sterilisasi.
6.
Sarung tangan kemudian dimasukkan kedalam tromol atau stoples yang telah berisi
tablet formalin untuk disterilkan selama 24 jam sejak saat dimasukkan. Untuk tromol atau
stoples ukuran satu liter digunakan empat tablet formalin 50 gram.
7.
Setelah selesai, peralatan dibersihkan, dibereskan dan dikembalikan ketempat semula.
TEKNIK ISOLASI
PENDAHULUAN
Di alam bebas tidak ada mikroorganisme yang hidup tersendiri terlepas dari spesies-spesies
lainnya. Sehingga sering kali kuman patogen kedapatan bersama-sama dengan mikroorganisme
saprofit. Untuk mencegah masuknya mikroorganisme yang tidak diinginkan dan untuk menanam
suatu spesies terdapat beberapa cara yaitu :

1.
Penanaman dengan penggoresan ( penanaman pada permukaan agar-agar ), merupakan
cara rutin yang dipakai untuk mengasingkan kuman agar didapatkan biakan murni. Sebuah ose
(sengkelit) bulat (panjang kawat = 7,5 cm dan diameter 2 mm) digunakan untuk menempelkan
bahan pemeriksaan (BP) yang akan dibiakan lalu goreskan pada tepi permukaan perbenihan
agar padat dan kering. BP disebarkan tipis-tipis di seluruh permukaan lempeng agar dalam
rangkaian garis garis sejajar pada segmen segmen lempeng yang berbeda. Sesudah
dilakukan pengeraman akan didapatkan pertumbuhan yang rapat pada goresan yang pertama,
tetapi selanjutnya pada goresan terakhir akan terlihat koloni-koloni terpisah.
2.
Penanaman lapangan (permadani); penanaman lapangan dikerjakan dengan membasahi
seluruh permukaan lempeng agar dengan suspensi kuman. Setelah dilakukan pengeraman akan
terlihat pertumbuhan kuman yang merata. Biakan ini berguna untuk penentuan jenis kuman
dengan bakteriofaga dan uji kepekaan terhadap antibiotika.
3.
Biakan agar tabung dikerjakan dengan menggoreskan kuman pada agar tabung
biasanya dipergunakan untuk mendapatkan pertumbuhan murni kuman untuk aglutinasi gelas
alas.
4.
Biakan tusukan; dikerjakan dengan menusukkan ose jarum (p=11cm) yang mengandung
biakan / koloni kuman pada perbenihan. Biakan tusukan dipakai untuk menunjukan adanya
pencairan gelatin dan mempertahankan biakan baku.
5.
Biakan agar tuang; perbenihan agar-agar (15 ml) dalam tabung reaksi dicairkan dan
biarkan mendingin dalam penangas air (45-50o C),selanjutnya dituangkan 1 ml biakan yang
telah diencerkan sesuai dengan perkiraan pada media agar yang mencair dan diaduk perlahanlahan. Selanjutnya seluruh isi tabung dituangkan ke dalam lempeng petri, dibiarkan membeku
dan setelah dilakukan pengeraman akan tumbuh koloni yang tersebar dalam perbenihan. Cara
ini menunjukkan jumlah kuman hidup yang terdapat pada suspensi, dapat digunakan untuk
membiakkan air kemih kuantitatif dan perhitungan kuantitatif kuman dalam air / pangan.
6.
Biakan cair, terdapat di dalam tabung, botol atau erlenmayer dapat ditanami denan
mencelupkan ose yang mengandung kuman. Biakan cair diperlukan untuk menunjukkan biakan
yang banyak cepat. Kerugian dari biakan ini adalah tidak dapat membuat biakan murni bahan
yang mengandung berbagai mikroorganisme.

PROSEDUR KERJA
Tujuan :
1.
Mengetahui cara penanaman kuman pada berbagai jenis media
2.
Melakukan isolasi kuman untuk mendapatkan koloni kuman yang terpisah
Cara kerja :
I. PENANAMAN PADA MEDIA PADAT BENTUK PLATE
1. Goresan sejajar : (isolasi)
Ose dibakar sampai steril, dinginkan.
Dengan ose yang sudah steril, diambil sampel atau bakteri kultur, dipulaskan disalah
satu sisi atau tepi media jangan menyentuh dinding petri dish.
Dengan ose steril yang lain, pulasan itu digores-goreskan sejajar sampai memenuhi
permukaan media.
2. Goresan sejajar melingkar : (isolasi)
Ose dibakar sampai steril, dinginkan.

Dengan ose yang sudah steril, diambil sampel atau bakteri kultur, dipulaskan disalah
satu sisi atau tepi media jangan menyentuh dinding petri dish.
Dengan ose steril yang lain, pulasan itu digores-goreskan sejajar pada salah satu tepi
media, dengan salah satu sisinya.
Ose dibalik untuk melanjutkan goresan-goresan sejajar pertama setelah medianya
diputar 90o.
Dengan ose yang dimiringkan goresan-goresan sejajar kedua, digoreskan sejajar lagi
setelah media diputar 90o.
Media diputar 90o, goresan-goresan sejajar yang ketiga digoreskan sejajar lagi dengan
ose yang dibalik, sampai memenuhi permukaan media plate
3. Cara taburan : (isolasi dan memperbanyak).
Suspensi sampel cair atau kultur bakteri di dalam media cair diambil dengan pipet steril
sebanyak 0,1 ml diteteskan dipermukaan media plate tepat ditengah- tengahnya.
Dengan mengunakan spatel yang terbuat dari kaca atau kawat, yang sudah steril dan
dingin, tetesan itu diratakan pada seluruh permukaan media plate.
4. Cara penuangan : (penghitungan)
Suspensi sampel/sampel cair diteteskan ke dalam petri dish steril sebanyak 0,1 atau 1 ml
secara steril.
Dituangi media padat steril yang dicairkan sebanyak sampai menutupi semua
permukaan dasar petri dish.
Campur baik-baik, tunggu sampai agar-agarnya membeku.
Dibalik, masukan ke Inkubator 37oC 48 jam.
Catatan : media yang digunakan tergantung dari jenis bakteri yang dihitung.
Pembacaan :
Pertumbuhan bakteri pada media padat disebut koloni, yaitu kelompokan-kelompokan
bakteri yang tumbuh pada media tersebut.
Koloni bakteri pada media padat denga tujuan isolasi dapat dibedakan
Berdasarkan kriteria sebagai berikut :
1.
Ukuran : diukur berapa diameternya dengan satuan mm
2.
Warna : putih, kuning, hitam, hijau, merah, dan sebagainya
3.
Bentuk : bulat, serabut, bergelombang, rhizoid, dan sebagainya
4.
Permukaan : datar, cembung, cekung, kasar(rough), halus(smooth)
5.
Sifatnya : keruh, jernih, kering, berlendir, melekat pada pembenihan, menjalar, hemolitis,
anhemolitis, dan sebagainya.
Koloni bakteri yang tumbuh pada media padat bentuk plate, dengan tujuan
memperbanyak, yang penting diperhatikan selain adanya pertumbuhan koloni juga kemurnian
koloni itu.
Koloni bakteri yang tumbuh pada media padat bentuk plate, dengan tujuan penghitungan
kriteria koloni tidak perlu diperhatikan, tetapi tinggal dihitung saja.