Anda di halaman 1dari 16

I.

AnalisisMasalah
1. Ny.

,umur

56

tahundatangkepolisarafdengankeluhanutamaseringtersesatsaatakanpulangkerumahsete
lahdaripasar.
a. Apahubunganusia

,jeniskelamindanpekerjaan

(iburumahtangga)

dengankeluhan yang dialami ?123


Jawab :
Beberapa penelitian menunjukkan bahwa wanita berada pada risiko yang
lebih tinggi dari demensia dibandingkan laki-laki. Namun, hal tersebut
berdasarkan data yang agak terbatas. Kami menyelidiki perbedaan jenis
kelamin dalam kemungkinan kejadian demensia, penyakit Alzheimer dan
demensia vascular. Di Rotterdam Study, sebuah penelitian kohort
prospektif berbasis populasi yang besar di Belanda dari 7046 orang
berusia 55 tahun dan lebih tua, bebas dari demensia pada awal. Penyakit
Alzheimer adalah subtipe demensia yang paling sering (293 kasus; 7,2 per
1.000). demensia vaskular didiagnosis pada 57 orang

(1,5 per 1.000).

Secara keseluruhan, kejadian demensia adalah sama untuk pria dan


wanita. Namun, setelah 90 tahun kejadian usia demensia menurun pada
pria tapi tidak pada wanita, khususnya untuk penyakit Alzheimer.. studi
berbasis populasi yang besar ini menunjukkan tidak ada perbedaan
gender dalam kejadian demensia hingga usia tinggi. Setelah 90 tahun
kejadian penyakit Alzheimer lebih tinggi bagi perempuan daripada lakilaki. Kejadian demensia vaskular lebih tinggi untuk laki-laki dibandingkan
perempuan

di

semua

kelompok

umur.

(sumber

https://www.ncbi.nlm.nih.gov. Incidence of dementia: does gender make a


difference?. 2001 Jul-Aug;22(4):575-80.)
b.
c.
d.
e.

Apasaja organ yang terlibatpadakasus?456


Bagaimanastrukturdanfungsi organ yang terlibatsesuaikasus?789
Apasaja yang dapatmenyebabkantimbulnyakeluhanpadaNy.N?10 1 2
Bagaimanamekanismetimbulnyakeluhanpadakasus ?3 4 5

Jawab :
Kerusakan fungsi memori organik disebabkan antara lain, ada penyakit
di otak akibat stroke, infeksi, tumor, dan degeneratif sehingga ada kerusakan di

otak. Akibatnya, fungsi otak terganggu, terutama ingatan. Umumnya, yang


pertama kali terganggu adalah ingatan jangka pendek.
Gangguan fungsi kognitif, demensia, misalnya, dapat disebabkan
alzheimer. Penurunan fungsi itu dapat pula diakibatkan gangguan pembuluh
darah otak (demensia vaskular, di antaranya stroke). Adanya sumbatan kecil
pada pembuluh darah otak yang meluas menyebabkan banyak sel-sel otak
yang mati.
Demensia bersifat progresif dan ingatan sulit dikembalikan. Ketika
seseorang terkena stroke, fungsi otak, termasuk ingatan, ada yang terganggu,
bisa saja fungsi ingatan jangka pendek, jangka panjang, atau bahkan keduanya.

2. Akhir-akhirinipenderitajugaseringmarahataumudahtersinggung.
a. Apasaja organ yang terlibatpadakasus?9 10 1
b. Bagaimanastrukturdanfungsi
organ
yang

terlibatsesuaikasus

(seringmarahataumudahtersinggung)? 234
c. Bagaimanahubunganseringmarahataumudahtersinggungdanseringlupa ?567

3. Menurutkeluargapenderitajugaseringlupadenganaktivitasrutin

yang

biasadilakukannya. Penderitajugaseringlupapadaanakataucucunya. Aktivitassehariharimasihbisadilakukansendiritanpabantuankeluarga.


a. Apasjamacam-macammemori/ingatan?8 9 10
b. Berdasarkankasus,apamemori yang terganggu? 123
Jawab :
Sering merupakan gejala yang pertama timbul pada demensia dini. Tahap
awal terganggu adalah memori baru, yakni cepat lupa apa yang baru saja
dikerjakan, lambat laun memori lama juga dapat terganggu.
Fungsi memori dibagi dalam tiga tingkatan bergantung lamanya rentang
waktu antara stimulus dan recall, yaitu:
1) Memori segera (immediate memory), rentang waktu antara stimulus
dan recall hanya beberapa detik. Di sini hanya dibutuhkan pemusatan
perhatian untuk mengingat (attention).
2) Memori baru (recent memory), rentang waktu lebih lama yaitu
beberapa menit, jam, bulan bahkan tahun.

3) Memori lama (remote memory), rentang waktunya bertahun-tahun


bahkan seusia hidup.
Karena memori yang dilupakan oleh Ny. N yakni nama cucu dan anak serta
aktivitas sehari-hari yang mana seharunya hal hal tersebut telah menjadi kebiasaan
selama bertahun tahun, maka memori yang terganggu memori lama
c. Bagaimanamekanismependeritalupapadanamaanakdancucunya ?456
d. Bagaimanamekanismependeritaseringlupadenganaktifitasrutin

yang

biasadilakukan? 789
4. Penderitapernahdirawatdengankelemahanseparuhtubuhsebelahkanankarena
iskemik. Riwayathipertensiadatapitidakrutinminumobat.
a. Apahubungan

stroke
stroke

iskemikdanhipertensitidakterkontroldengankeluhanseringlupa ?10 1 2
Jawab :
Mekanisme pasti terjadinya gangguan kognitif pada hipertensi
belum sepenuhnya dipahami. Suatu hipertensi menyebabkan percepatan
terjadinya arterosklerosis pada jaringan otak yang berimplikasi pada
gangguan kognitif, yang mana pada penelitian sebelumnya ditunjukan
adanya hubungan bermakna antara derajat retinopati hipertensi sebagai
akibat hipertensi lama yang mana selain proses terjadinya vasokontriksi
pada pembuluh darah retina sendiri juga peristiwa arterosklerosis.
Kapiler dan arteriola jaringan otak akan mengalami penebalan
dinding oleh karena terjadi deposisi hyalin dan proliferasi tunika intima
yang akan menyebabkan penyempitan diameter lumen dan peningkatan
resistensi pembuluh darah. Hal tersebut memicu terjadinya gangguan
perfusi serebral, memungkinkan terjadinya iskemia berkelanjutan pada
gangguan aliran pembuluh darah yang kecil hingga timbul suatu infark
lakuner. Hipertensi kronik dapat menyebabkan gangguan fungsi sawar
otak yang menyebabkan peningkatan permeabilitas sawar otak. Hal ini
akan menyebabkan jaringan otak khususnya substansi alba menjadi lebih
mudah mengalami kerusakan akibat adanya stimulus dari luar.
Hipertensi tak terkontrol yang menetap berhubungan dengan kerusakan WMH
(White Matter Hyperintensities) yang lebih besar. Tingkat tekanan darah

tampaknya juga berperan, dengan nilai tekanan darah yang lebih tinggi
berhubungan dengan derajat WMH yang lebih tinggi.WMH dan silent infarct
dianggap sebagai penanda iskemi serebral kronik yang disebabkan oleh kerusakan
pembuluh darah serebral kecil. Peningkatan tekanan darah sistolik mepengaruhi
fungsi kognitif terutama pada usia lanjut, dimana terjadinya gangguan
mikrosirkulasi dan disfungsi endotel juga berperan pada gangguan fungsi kognitif
pada hipertensi.
b. Apahubunganlokasilesiakibat stroke iskemikdengankeluhanutama (seringlupa)
? 345
Jawab :
Otak sebagai saraf pusat mempunyai salah satu peran yaitu mengatur fungsi
kognitif, yang diatur oleh suatu sistem bernama sistem limbik
. Sistem limbik mencakup
thalamus, ganglia basalis, serebelum, lobus frontalis, lobus temporal, lobus parietal,
lobus oksipital, dimana masing-masing lokasi tersebut memiliki peran dalam mengatur
fungsi kognitif. Fungsi kognitif juga diatur oleh suatu mekanisme kerja yang disebut
dengan jalur korteks-subkortikal, yang lebih dikenal dengan jalur frontal-subkortikal.
Jalur ini, dengan lobus frontalis sebagai korteks yang paling berperan, saling berkaitan
satu sama lain dalam menjalankan perannya mengatur fungsi kognitif

c. Apasajakemungkinanpenyakitdarihasil anamnesis? 6 7 8
5. Pemeriksaanfisik:
KeadaanUmum : GCS 15
Tandavital : TD 160/100 mmHg, Nadi 80x/menit, RR 20x/menit, temp 37,0 C
a. Bagaimanainterpretasidarihasilpemeriksaanfisik? 9 10 1
Jawab :
Glasgow Coma Scale(GCS)
Nilai Ny. N ialah 15.
Interpretasi skor Glasgow Coma Scale:
Skor 14-15 : compos mentis
Skor 12-13 : apatis
Skor 11-12 : somnolen
Skor 8-10 : stupor

Cara Pemeriksaan
Respon buka mata (Eye Opening, E)

Nilai

a.
b.
c.
d.

Respon spontan (tanpa stimulus/rangsang)


Respon terhadap suara (suruh buka mata)
Respon terhadap nyeri (dicubit)
Tidak ada respon (meski dicubit)

3
2
1

Respon verbal (V)


a. Berorientasi baik
5
b. Berbicara mengacau (bingung)
4
c. Kata-kata tidak teratur (kata-kata jelas dengan substansi tidak
3
jelasdan non-kalimat, misalnya, aduh bapak..)
d. Suara tidak jelas (tanpa arti, mengerang)
e. Tidak ada suara
2
1
Respon motorik terbaik (M)
a. Ikut perintah
6
b. Melokalisir nyeri (menjangkau & menjauhkan stimulus saat
5
diberi rangsang nyeri)
c. Fleksi normal (menarik anggota yang dirangsang)
d. Fleksi abnormal (dekortikasi: tangan satu atau keduanya posisi 4
kaku diatas dada & kaki extensi saat diberi rangsang nyeri)
3
e. Ekstensi abnormal (deserebrasi: tangan satu atau keduanya
extensi di sisi tubuh, dengan jari mengepal & kaki extensi saat

diberi rangsang nyeri)


f. Tidak ada (flasid)
1
Tabel 1. Cara Penilaian GCS
Tekanan Darah 160/100 mmHg
Interpretasi: Hipertensi Derajat 2
Kategori
Normal
Normal Tinggi
Hipertensi
Derajat 1
Derajat 2
Derajat 3
Derajat 4

Sistolik (mmHg)
< 130
130 139

Diastolik (mmHg)
< 85
85 89

140 159
160 179
180 209
> 210

90 99
100 109
110 119
> 120

Nadi 80x/mnt
Normal
Interpretasi

: 60-100 x/menit.
: Normal

Suhu 370C
Normal
: 36,5 -37,20C
Interpretasi
: Normal
RR 20 x / menit
Normal : 16-24x/menit
Interpretasi : normal
6. Pemeriksaanneurologis :
PemeriksaanNnKranialis :
- Paresenn vii kanandan xii kanantipesentral
Pemeriksaanfungsimotoric :
-

Kekuatanlengandantungkaikanan 4 dengan reflex fisiologismeningkat


a. Bagaimanainterpretasidarihasilpemeriksaanneurologis? 2 3 4
b. Berdasarkanhasilpemeriksaanneurologis ,dimanaletaklesi yang terjadiakibat
stroke padakasus?5 6 7
c. Apasajakemungkinanpenyakitdarihasilpemeriksaanfisikumumdanpemeriksaan
fisikkhusus ?8 9 10

7. AspekKlinis
a. Algoritmapenegakan diagnosis 1 2 3
Jawab :
Anamnesis12
Masalah apa yang dilaporkan? Siapa yang melaporkannya: pasien, kerabat, teman,
atau profesional lain?
-

Pernakah ada kesulitan ingatan, disorientasi, konsentrasi, dan apatis? Adakah


akibat fungsional atau sosial (pengucilan, malnutrisi, dan sebagainya)?

Adakah pemicu yang jelas, seperti cedera kepala?

Adakah kemunduran mendadak? Adakah pemicunya (misalnya perubahan obat,


penyakit lain, atau perubahan lingkungan)?

Adakah perubahan gradual atau bertahap?

Adakah tanda-tanda depresi? (hati-hati terhadap pseudodemensia.)

Adakah tanda-tanda hipotiroidisme?

Adakah tanda yang menunjukkan penyakit fisik?

Adakah tanda neurologis yang tidak biasa (misalnya ataksia, kelemahan,


mioklonus, nyeri kepala, atau gejala neuropati)?

Riwayat penyakit dahulu


-

Adakah riwayat penyakit lain sebelumnya, khususnya penyakit ateromatosa


dan faktor risikonya?

Adakah riwayat kondisi neurologis lain sebelumnya?


Obat-obatan

Apakah pasien mengkonsumsi obat, khususnya obat penenang, sedatif, dan


sebagainya?

Apakah pasien sedang menjalani terapi untuk demensia (misalnya inhibitor


kolinesterase)?

Adakah tanda-tanda penyalahgunaan alkohol?


Riwayat keluarga dan sosial

Adakah riwayat demensia dalam keluarga (pertimbangkan penyebab turunan


yang jarang ditemukan seperti penyakit Huntington)?

Tentukan deskripsi lengkap dari situasi sosial, orang yang merawat, dukungan,
dan keluarga.

Pemeriksaan fisik12
-

Lakukan pemeriksaan fisik lengkap

Pertimbangkan secara khusus hipotiroidisme, penyakit lain, dan sebab potensial


keadaan bingung akut

Lakukan pemeriksaan neurologis lengkap

Cari refleks primitif: refleks menggenggam, mencucu, dan palmo-mental.


Pada demensia, daerah motorik, piramidal dan ekstrapiramidal ikut terlibat

secara difus maka hemiparesis atau monoparesis dan diplegia dapat melengkapkan
sindrom demensia. Apabila manifestasi gangguan korteks piramidal dan
ekstrapiramidal tidak nyata, tanda-tanda lesi organik yang mencerminkan
gangguan pada korteks premotorik atau prefrontal dapat membangkitkan refleksrefleks. Refleks tersebut merupakan petanda keadaan regresi atau kemunduran
kualitas fungsi.12

a. Refleks memegang (grasp reflex). Jari telunjuk dan tengah si pemeriksa


diletakkan pada telapak tangan si penderita. Refleks memegang adalah positif
apabila jari si pemeriksa dipegang oleh tangan penderita

b. Refleks glabela. Orang dengan demensia akan memejamkan matanya tiap kali
glabelanya diketuk. Pada orang sehat,pemejaman mata pada ketukan berkalikali pada glabela hanya timbul dua tiga kali saja dan selanjutnya tidak akan
memejam lagi
c. Refleks palmomental. Goresan pada kulit tenar membangkitkan kontraksi otot
mentalis ipsilateral pada penderita dengan demensia
d. Refleks korneomandibular. Goresan kornea pada pasien dengan demensia
membangkitkan pemejaman mata ipsilateral yang disertai oleh gerakan
mandibula ke sisi kontralateral
e. Snout reflex. Pada penderita dengan demensia setiap kali bibir atas atau bawah
diketuk m. orbikularis oris berkontraksi

f. Refleks menetek (suck reflex). Refleks menetek adalah positif apabila bibir
penderita dicucurkan secara reflektorik seolah-olah mau menetek jika bibirnya
tersentuh oleh sesuatu misalnya sebatang pensil

g. Refleks kaki tonik. Pada demensia, penggoresan pada telapak kaki


membangkitkan kontraksi tonik dari kaki berikut jari-jarinya.
-

Periksa fungsi mental luhur.


a. Periksa orientasi
b. Periksa bahasa

MMSE

c. Periksa ingatan
d. Periksa pemahaman
e. Mood: nilai mood pasien dan cari tanda-tanda penyakit psikiatrik,
khususnya depresi.12
1. Kriteria Diagnosis
Terdapat beberapa kriteria diagnostik yang melibatkan tes kognitif dan
neurofisiologi pasien yang digunakan untuk diagnosis demensia vaskular.
Diantaranya adalah:
a. Kriteria Diagnostic and Statistical Manual of Mental Disorders, fourth
edition, text revision (DSM-IV-TR)10,8
Kriteria ini mempunyai sensitiviti yang baik tetapi spesifitas yang rendah.
Rumusan dari kriteria diagnostik DSM-IV-TR adalah seperti berikut:
Perkembangan defisit kognitif multipel terdiri dari:

Gangguan memori (gangguan kemampuan dalam mempelajari


informasi baru atau mengingat informasi yang sudah dipelajari)
Salah satu atau lebih gangguan kognitif berikut:
- Afasia (gangguan berbahasa)
- Apraksia (gangguan kemampuan untuk melakukan aktivitas
-

motorik dalam keadaan fungsi otot yang normal)


Agnosia (kegagalan untuk mengenali atau menamai objek)
Gangguan fungsi berfikir abstrak (eg merencanakan,

berorganisasi)
Gangguan kognitif di atas menyebabkan gangguan yang berat pada fungsi
sosial dan pekerjaan penderita
Kelainan ini ditandai dengan proses yang bertahap dan penurunan fungsi
kognitif yang berkelanjutan
Gangguan kognitif di atas tidak disebabkan oleh hal-hal berikut:

Kelainan SSP lain yang menyebabkan gangguan memori yang


progresif (misalnya gangguan peredaran darah otak, Parkinson dan

tumor otak)
Kelainan sistemik yang dapat menyebabkan demensia (misalnya

hipotiroidisme, defisiensi vitamin B dan asam folat, defisiensi niasin,


hiperkalemi, neurosifilis dan infeksi HIV)
Kelainan pasien tidak disebabkan oleh delirium
Kelainan tidak disebabkan oleh kelainan aksis 1 (misalnya gangguan depresi
dan skizofrenia)
b. Skor iskemik Hachinski
Skor Iskemik Hachinski adalah seperti berikut:
Riwayat dan gejala
Skor
Awitan mendadak
2
Deteriorasi bertahap
1
Perjalanan klinis fluktuatif
2
Kebingungan malam hari
1
Kepribadian relatif terganggu
1
Depresi
1
Keluhan somatik
1
Emosi labil
1
Riwayat hipertensi
1
Skor
ini
Riwayat penyakit serebrovaskuler
2
berguna
Arteriosklerosis penyerta
1
untuk
Keluhan neurologi fokal
2
Gajala neurologi fokal
2
membedakan demensia Alzheimer dengan demensia vaskular. Bila skor 7:
demensia vaskular. Skor 4: penyakit Alzheimer.
c. Kriteria theNational Institute of Neurological Disorders and StrokeAssociation

International

pour

la

Recherch

at

L'Enseignement

en

Neurosciences (NINDS-AIREN).
1) Kriteria untuk diagnosis probable vascular dementia:
a) Demensia
Didefinisikan dengan penurunan kognitif dan dimanifestasikan
dengan kemunduran memori dan dua atau lebih domain kognitif
(orientasi, atensi, bahasa, fungsi visuospasial, fungsi eksekutif, kontrol
motor, praksis), ditemukan dengan pemeriksaan klinis dan tes
neuropsikologi, defisit harus cukup berat sehingga mengganggu aktivitas
harian dan tidak disebablan oleh efek stroke saja.Kriteria eksklusi: kasus
dengan penurunan kesadaran, delirium, psikosis, aphasia berat atau
kemunduran sensorimotor major. Juga gangguan sistemik / penyakit lain
yang menyebabkan defisit memori dan kognisi.
b) Penyakit serebrovaskular
Adanya tanda fokal pada pemeriksaan neurologi seperti
hemiparesis, kelemahan fasial bawah, tanda Babinski, defisit sensori,
hemianopia, dan disartria yang konsisten dengan stroke (dengan atau

tanpa riwayat stroke) dan bukti penyakit serebrovaskular yang relevan


dengan pencitraan otak (CT Scan atau MRI) seperti infark pembuluh
darah multipel atau infark strategi single (girus angular, thalamus, basal
forebrain), lakuna ganglia basal multipel dan substansia alba atau lesi
substansia alba periventrikular yang ekstensif, atau kombinasi dari yang
di atas.
c) Hubungan antara dua kelainan di atas
- Awitan demensia 3 bulan pasca stroke
- Deteriorasi fungsi kognitif mendadak atau progresi defisit kognitif
d. Diagnosis

yang fluktuasi atau stepwise


Berdasarkan PPDGJ (Pedoman

Penggolongan

Diagnosis

Gangguan Jiwa)14
Pedoman Diagnostik Demensia Vaskular (F01) :
- Terdapatnya gejala demensia
- Hendaya fungsi kognitif biasanya tidak merata (mungkin terdapat hilangnya
daya ingat, gangguan daya pikir, gejala neurologis fokal). Daya tilik diri
-

(insight) dan daya nilai (judgment) secara relatif tetap baik.


Suatu onset yang mendadak atau deteriorasi yang bertahap, disertai adanya
gejala neurologis fokal, meningkatkan kemungkinan diagnosis vaskuler.
Pada beberapa kasus penetapan hanya dapat dilakukan dengan pemeriksaan

CT-Scan atau pemeriksaan neuropatologis


1) F01.0 Demensia Vaskular Onset Akut
Biasanya terjadi secara cepat sesudah serangkaian episode iskemik minor
yang menimbulkan akumulasi dari infark parenkim otak.
2) F01.1 Demensia Multi-infark
Onsetmya lebih lambat, biasanya setelah serangkaian episode iskemik minor
yang menimbulkan akumulasi dari infark pada parenkim otak
3) F01.2 Demensia Vaskular Subkortikal
Fokus kerusakan akibat iskemia pada substansia alba di hemisfere serebral,
yang dapat diduga secara klinis dan dibuktikan dengan CT-Scan. Korteks
serebri biasanya tetap baik, walaupun demikian gambaran klinis masih mirip
dengan demensia pada penyakit Alzheimer.
4) F01.3 Demensia Vaskular Campuran Kortikal dan Subkortika;
Komponen campuran kortikal dan subkorikal dapat diduga dari gambaran
klinis, hasil pemeriksaan (terasuk autopsi) atau keduanya
5) F01.8 Demensia Vaskular Lainnya
6) F01.9 Demensia Vaskular YTT

b. Diagnosis Banding456

Jawab :
Gejala klinik

Demensia
Vaskular
Sering lupa sebelum stroke
+
Lupa jalan ke rumah, lupa mandi, tidak +
mengenali anggota keluarga
Riwayat penyakit stroke
+
Hipertensi
+
Hiperkolestrolemia
+
Onset Mendadak
+
Progresivitas bertahap
+
Hemiparese dextra spastik
+
Neuroimaging infark ganglia basalis
+
MMSE 23
+
Skoriskemik Hachinski
7
Pemeriksaan neurologi
Defisit neurologi
Demensia Vaskular
Lebih banyak mengenai pria
Awitan akut dengan perburukan mendadak
kinerja kognitif atau adanya episode
hemiparesis
Memburuk seperti anak tangga (stepwise)
Gejala neurologik fokal menonjol

Demensia
Alzheimer
+
+
+
+
4
Normal

Demensia Alzheimer
Lebih banyak mengenai wanita
Awitan lambat, menyelinap

Memburuk secara bertahap progresif


Tidak terdapat tanda neurologik fokal
sampai tahap lanjut
Perubahan afek, misal imbalans emosi, Afek tumpul
depresi, kecemasan
Kepribadian biasanya tetap baik
Perubahan kepribadian
Penilaian diri tetap baik
Penilaian terhadap diri sendiri (insight)
hilang secara dini
Keluhan somatik sering
Keluhan somatik jarang
Bukti
adanya
penyakit
ateromatosa Bukti adanya penyakit ateromatosa
menyeluruh sering ada
menyeluruh kecil
Hipertensi dan kejang lebih sering
Hipertensi dan kejang jarang
Skor iskemik Hachinsky >7
Skor iskemik Hachinsky <4
Tidak terdapat
Terdapat plak senilis dan kekusutan
neurofibriler
Tidak terdapat kerusakan spesifik pada Defisiensi
beberapa
sistem
neurotransmitter
neurotransmitter, terutama pada sistem
neurotransmitter kolinergik
CT-scan menunjukkan perubahan lokal, CT-scan menunjukkan dilatasi ventrikuler
terutama regio temporal
sedang
PET
scan
menunjukkan
penurunan PET scan menunjukkan pengurangan
penggunaan oksigen bercak (patchy)
umum dari penggunaan oksigen

c. Pemeriksaanpenunjang 789
d. Diagnosis kerja ? semua
Jawab :
Diagnosis Multiaksial
Aksis I

: F.01.2 Demensia Vaskular Subkortikal

Aksis II

: Z 03.2 : tidak ada diagnosis Aksis II

Aksis III

: I00 - I99 (penyakit sistem sirkulasi: stroke, hipertensi)

Aksis IV

: Tidak ada stresssor

Aksis V

: GAF Scale 50-41: gejala berat, disabilitas berat.

e. Etiologi 10 1 2
f. Epidemiologi 3 4 5
Jawab :
demensia vaskular (VAD) adalah demensia tersering kedua setelah
penyakit Alzheimer (AD). Studi epidemiologis dari kondisi ini menderita
banyak kekurangan terkait dengan definisi penyakit, kriteria diagnostik
dan penilaian. Prevalensi VAD meningkat secara linear dengan usia dan
sangat bervariasi dari satu negara ke negara, berkisar 1,2 sampai 4,2%
dari orang-orang tua di atas 65 tahun. Insiden VAD diperkirakan 6-12
kasus per 1.000 orang lebih dari 70 tahun per tahun. Durasi rata-rata
penyakit ini sekitar 5 tahun dan kelangsungan hidup kurang dari untuk
masyarakat umum dan untuk AD. Faktor risiko utama untuk VAD tampak
hipertensi, diabetes, penyakit jantung dan stroke. Meskipun beberapa
faktor

risiko

ini

dimodifikasi,

tidak

ada

studi

tentang

efektivitas

pencegahan VAD. (sumber : https://www.ncbi.nlm.nih.gov .Epidemiology


of vascular dementia.
g. Faktorresiko6 7 8
Jawab :
Timbulnya suatu demensia pasca stroke dikaitkan dengan faktor risiko stroke.
Berbagai faktor risiko stroke, seperti hipertensi, penyakit jantung, diabetes melitus,

obesitas, dislipidemia, dan lain-lain, dapat menyebabkan gangguan dan bahkan


kerusakan pada pembuluh darah otak seperti arterosklerosis, infark, pecahnya pembuluh
darah otak dan lain-lain, sehingga mengakibatkan gangguan pada fungsi otak.

h.
i.
j.
k.

Patofisiologi9 10 1
Manifestasiklinis 234
Pemeriksaanpenunjang 5 6 7
Tatalaksana , edukasidan pen cegahan 8 9 10

Jawab :
a. Farmakologi
a) Stroke
Terapi pemeliharaan (pencegahan) stroke yang mungkin terjadi lagi:
Anti platelet
Aspirin dengan mekanisme kerja menghambat sintesis tromboksan (senyawa
yang berperan dalam proses pembekuan darah)
Dosis: 4-6 x 325-650 Mg/hari
Perhatian: adanya suatu interaksi obat antara obat Anti Diabetik dan Aspirin
dapat menyebabkan penurunan kadar gula darah.
Hal yang harus dilakukan dokter:
1. Beri penyuluhan mengenai cara pemberian obat, dengan memberi tahu
bahwa jika ingin mengkonsumsi obat Anti Diabetik dengan Aspirin
minimal diberi rentang waktu minimal 30-60 menit setelah minum obat
yang pertama.
2. Tanyakan juga riwayat penyakit gastritis, agar bisa diberikan obat-obat
terapi untuk melindungi mukosa lambung itu sendiri.
3. Dokter memantau kemungkinan gangguan atau perdarahan GIT.
b) Hipertensi
Pada kasus diketahui pasien menderita diabetes dan hipertensi maka kondisi
ini memiliki kendala karena dapat mencetuskan resistensi insulin. Dalam hal
ini sebaiknya digunakan suatu ACE-Inhibitor atau -Blocker dan Antagonis
Ca.
ACE-inhibitor: Kaptopril (Capoten) Dosis : 2-3x25 Mg/hari
Atau -Blocker selektif : Propranolol
Dosis awal : 2 x 40 Mg/hari diteruskan dosis pemeliharaan 120-240 Mg/hari
c) Demensia Vaskular
Golongan Kolinesterase-Inhibitors (ChE-1)

Donepezil: paling bermakna diantara golongan kholinergik, manfaat pada


stadium ringan sampai sedang.
Mekanisme kerja: menghambat degradasi Ach di sinaps dengan cara
menghambat pemecahannya.
Dosis: 1 dd 5 Mg a.n. (Sebelum tidur)
Sesudah 4 minggu 1 dd 10 Mg
b. Non farmakologi
a) Stroke : Terapi rehabilitasi medik (fisioterapi)
Latihan ke berdiri dan posisi duduk
Latihan berjalan, latihan lengan
Terapi wicara dan bahasa
b) Hipertensi
Diet : mengurangi garam dalam diet dan membatasi kolesterol.
Olahraga teratur
Membatasi minum kopi
Menghindari minum alkohol
Cukup istirahat dan tidur
c) Demensia
Psikoterapi (bisa juga ditujukan untuk semua keluhan yang ada pada pasien).
Lakukan intervensi psikodinamika pada anggota keluarga dari pasien
demensia mungkin menjadi bantuan yang sangat besar.
Preventif dan promotif
Memodifikasi faktor resiko vascular (misalnya, hipertensi, diabetes mellitus,
merokok, hyperhomocystinemia) dan faktor makanan (misalnya,
hiperkolesterolemia) di usia pertengahan dapat membantu untuk mencegah
demensia stroke dan pembuluh darah. Faktor risiko yang paling penting
adalah hipertensi. penelitian kohort epidemiologis dan percobaan intervensi
dengan obat-obat antihipertensi menunjukkan kegunaan obat antihipertensi
dalam pencegahan demensia vaskular.
Perawatan yang tepat untuk fibrilasi atrium, penyakit arteri koroner, gagal
jantung kongestif, dan stroke juga dianjurkan.
manajemen yang memadai faktor risiko vaskular, stroke, dan penyakit jantung
pada usia pertengahan mungkin cara paling efektif untuk mencegah demensia
vaskuler di kemudian hari.Perbedaan antara demensia vaskular dan demensia
Alzheimer menjadi semakin kabur karena faktor-faktor risiko vaskuler
memainkan peran dalam kedua penyakit.
Pada pasien dengan gangguan kognitif awal atau dengan neuroimaging
temuan yang menunjukkan leukoaraiosis atau stroke, pencegahan sekunder

dapat difasilitasi dengan menerapkan terapi stroke-pencegahan standar seperti


agen antiplatelet, warfarin, atau endarterektomi sesuai dengan pedoman
diterima.
Demensia & Lifesytle
Periksa rutin tekanan darah. Jika tinggi, konsultasi ke dokter.
Jangan merokok.
Olahraga secara teratur.
Jangan mengkonsumsi alkohol.
Cukup istirahat dan tidur.
Demensia & Diet
Cegah makan makanan yang berlemak.
Konsumsi suplemen (vitamin) antioksidan.
Kurangi konsumsi garam dalam makanan

l. Komplikasi 6 7 8
m. Prognosis ?semua
Jawab :
Vitam Fungsionam Dubia Ad Malam
Prognosis demensia vaskular lebih bervariasi dari penyakit Alzheimer
Beberapa pasien dapat mengalami beberapa siri stroke dan kemudian bebas
stroke selama beberapa tahun jika diterapi untuk modifikasi faktor resiko dari
-

stroke.
Berdasarkan beberapa penelitian, demensia vaskular dapat memperpendek
jangka hayat sebanyak 50% pada lelaki, individu dengan tingkat edukasi yang

rendah dan pada individu dengan hasil uji neurologi yang memburuk
Penyebab kematian adalah komplikasi dari demensia, penyakit kardiovaskular
dan berbagai lagi faktor seperti keganasan.

n. SKDI? semua