(Contributions in Philosophy) S. R. Bhatt, Anu Mehrotra-Buddhist Epistemology-Greenwood Press (2000) PDF

BUDDHIST
EPISTEMOLOGY
S. R. Bhatt and Anu Mehrotra
Foreword by the Dalai Lama
Recent Titles in
Contributions in Philosophy
The Last Choice: Preemptive Suicide in Advanced Age, Second Edition

C. G. Prado
Self-Construction and the Formation of Human Values: Truth, Language, and Desire
Teodros Kiros
Diogenes of Sinope: The Man in the Tub

Luis E. Navia
Simone de Beauvoir Writing the Self: Philosophy Becomes Autobiography
Jo-Ann Pilardi
Stalking Nietzsche
Raymond Angelo Belliotti
The Transient and the Absolute: An Interpretation of the Human Condition and of Human
Endeavor
Mordecai Roshwald
The Adventure of Philosophy

Luis E. Navia
Intentionalist Interpretation: A Philosophical Explanation and Defense

William Irwin
Natural Law Ethics

Philip E. Devine
Anglo-American Idealism, 1865-1927

W. J. Mander, editor
Two Views of Virtue: Absolute Relativism and Relative Absolutism

F F. Centore
Liberty: Its Meaning and Scope

Mordecai Roshwald
BUDDHIST
EPISTEMOLOGY
S. R. Bhatt and Anu Mehrotra
Contributions in Philosophy, Number 75

Frank J. Hoffman, Series Adviser
Westport, Connecticut London
Library of Congress Cataloging-in-Publication Data

Bhatt, S. R. (Siddheswar Rameshwar), 1939
Buddhist epistemology / S.R.BhattandAnuMehrotra ; foreword by the Dalai Lama.
p. cm.(Contributions in philosophy, ISSN 0084-926X ; no. 75)
Includes the text of Digniga's Nyiyamukha.
Includes bibliographical references and index.
ISBN 0-313-31087-4 (alk. paper)
I. Knowledge, Theory of (Buddhism) 2. Digniga, 5th cent. Nyiyamukha.
3. Buddhist logic. I. DignSga, 5th cent. NySyamukha. II. Title. III. Series.
BQ4440.B53 2000
99-044513
British Library Cataloguing in Publication Data is available.
Copyright 2000 by S. R. Bhatt and Anu Mehrotra
All rights reserved. No portion of this book may be
reproduced, by any process or technique, without the
express written consent of the publisher.
Library of Congress Catalog Card Number: 99-044513
ISBN: 0-313-31087-4
ISSN: 0084-926X
First published in 2000
Greenwood Press, 88 Post Road West, Westport, CT 06881
An imprint of Greenwood Publishing Group, Inc.
www.greenwood.com
Printed in the United States ofAmerica
The paper used in this book complies with the

Permanent Paper Standard issued by the National
Information Standards Organization (Z39.48-1984).
10 9 8 7 6 5 4 3 2 1
Contents
vii
Preface
ix
Introduction
1. The Buddhist Theory of Knowledge
11
2. The Buddhist Theory of Perception
25
3. The Buddhist Theory of Inference
49
Appendix 1: Nyayapravesakasutram
101
Appendix 2: Nyayapravesakasutram (Translation)
105
Notes
111
Glossary
125
Bibliography
129
Index
135
Foreword
The Dalai Lama
When Buddha Sakyamuni attained enlightenment beneath the Bodhi tree more
than two and a half thousand years ago, his achievement was not only the result
of having reached the peak of meditative stabilisation, of having brought great
compassion to fruition, but also of clear analytic thought. The lucid simplicity of
his subsequent teachings are ample evidence of this. And indeed he encouraged
his followers to regard even his own advice in the same rigorously critical light.
Thus, the study of logic and the nature of knowledge have been crucial to Buddhist
tradition from the outset.
These disciplines continued to develop and flourish in India after the Buddhas
passing away, reaching their acme in the works of Vasubandhu, Dinnaga and
Dharmaklrti, which were to become seminal to studies in the great monastic
universities, such as Nalanda and Vikramasila. And it was this tradition of acute
logic and analysis that was transmitted and preserved in Tibet for more than a
thousand years, where it was employed not merely to challenge the views of
others but to ensure the clarity and authenticity of ones own view.
Therefore, I am delighted that two distinguished contemporary Indian scholars,
Dr. S.R. Bhatt and Dr. A. Mehrotra, have written the present book on Buddhist
Epistemology, including an English translation of the Nyaya Pravesa. This
valuable work sheds light on abstruse topics and will allow readers to gain a
clearer appreciation of the depths of Buddhist knowledge.
Preface
The present work is an analytical exposition of the theory of knowledge as
propounded in the Dirinaga-Dharmaklrti tradition. It expounds the Buddhist theory
of knowledge in its totality.
Buddhist thinkers unanimously uphold the view that there are two kinds of
objects of knowledge, namely, the unique particular (svalaksana) and the
generalized image (samanyalaksana). Unique particular is discrete and
instantaneous being. It is unique particular in the sense that it is neither identical
nor similar to other unique particulars. It is the only objective real (paramartha
sat). As distinct from unique particular there are objects that are constructs of
our intellect and that are in the form of generalized images. They are subjective
in origin but intersubjective in nature.
On the basis of the preceding analysis Buddhist thinkers emphatically maintain
that since there are only two kinds of objects of knowldege, there are only two
kinds of knowledge (pramdtia) namely, perception (pratyaksa) and inference
(anumdna). The unique particular is amenable to perception only, whereas
generalized image is known through inference only. By implication, unique
particular can never be known through inference and generalized image can
never be known through perception. Thus, each of the two types of knowledge
has its own separate and distinct sphere of operation.
In the following pages is a discussion of Buddhist theory of knowledge,
comparing it with other schools wherever necessary.
To make the logical issues more intelligible to readers, a basic text, Nyaya
Pravesa is given as an appendix of the work. The text of Nyaya Praves'a is
generally ascribed to Dirinaga, a pioneer thinker in Buddhist theory of Knowledge.
Dirinaga provided a solid footing to Buddhist epistemology and logic and gave it
a distinctive character. He has been regarded as the father of Buddhist epistemology
Preface
and logic in particular and of the entire medieval Indian epistemology and logic
in general. There are several works composed by him in this area, among which
Pramana Samuccaya and Nyaya Praves'a are most important. Pramana
Samuccaya is not available in its complete form, even though some of its chapters
have been restored from Tibetan and other sources. However Nyaya Pravesa is
available to us in its full form. An attempt has been made here to translate it in
English for the benefit of English language readers. The text is presented here in
Roman script with a view to have wider readership. Explanatory notes have also
been provided to clarify some knotty points.
Nyaya Praves'a is a classical work pertaining to the modes of knowing and
reasoning in the Buddhist tradition. For centuries it has been studied as a manual
of the Buddhist theory of knowledge in India, Tibet, China, and other countries.
It provides a foundation to the famous Buddhist art of debate (yada-vidhi) . There
are several Tibetan and Chinese commentaries and sub-commentaries on Nyaya
Praves'a apart from the ones in Sanskrit. This accounts for its significance and
popularity among classical scholars.
In a cryptic, but succinct, manner Nyaya Praves'a presents Dirinagas views
on the nature of perception and inference and their fallacies. It also elaborately
discusses the modes of argumentation and refutation along with their fallacies.
We are grateful to Greenwood Publishing Group and its staff and to
Dr. Hoffman who introduced this work to Greenwood. Our thanks are also due to
Indian Council of Philosophical Research for providing financial assistance for
the preparation of the work.
Introduction
DICHOTOMY OF SUBSTANCE AND NO-SUBSTANCE ONTOLOGIES
The varied and multifaceted Indian philosophical thought is characterized by two
broad philosophical tendencies that are antithetical in nature but both of which
can be traced in germinal form to the Upanisadic thought. One tendency, which
can be termed atmavada or substance ontology, has been dominantly
presented in the so-called astika systems, the culmination of which is found in
the Advaita Vedanta. The other tendency, which is popularly known as
andtmavada or no-substance ontology, finds its advocacy and manifestation
in Buddhist thought. The basic contention bifurcating the two tendencies is the
view regarding the ontological status of permanence and change, both of which,
though opposite in nature, are given to us in veridical experience, and therefore
both claim the status of reality. The substance ontology advocates the permanence
aspect and tries to explain the phenomenon of change. The no-substance ontology,
on the contrary, accepts the reality of change alone and explains the experience
of permanence as conceptual superimposition. Thus, the history of Indian
philosophical thought could be approached in terms of a dialectic of these two
divergent tendencies.
The substance-ontology revolves around the idea of permanence or abidance
as the sole criterion of reality. Accordingly, substance, which alone is the substratum
of all attributes and modes, has the sole reality or the primary reality, and the
attributes and modes have either an apparent existence or a derivative existence.
According to Advaita Vedanta substance, which is a unitary, homogeneous, pure
consciousness, alone is real, and all attributes and modes are phenomenal in the
sense that they are mithya (i.e., neither real nor unreal). The Samkhya system
and also the Nyaya-Vaisesika and Mlmamsa systems, however, assign some reality
to change also insofar as matter is regarded as subject to mutation whether in the
Introduction
form of evolution from one mass of matter or in the form of a combination of

d iffe ren t elem en ts of m atter, thereby producing a d iffe re n t o r new
com plex. But the point to be noted is that even in these schools that
display a realistic tendency the prim acy of substance and its perm anent
essence are em phasized. It may be significant to point out that there has also
been another tendency in the school of Jainism wherein the exclusiveness of
substance ontology and no-substance ontology lias been rejected, and equal status
is accorded to both permanence and change.
NO-SUBSTANCE ONTOLOGY OF BUDDHISM

Buddhist thought has centered around no-substance ontology. Gautama,
the Buddha, who initiated Buddhist thought, was led to philosophizing by an
intense longing for the eradication of suffering. He visualized that all suffering is
due to tanlid' (longing) and that all longing is due to attachment to the false
notion of permanence. He wanted to suggest a way out of the labyrinth of suffering
and put forth impermanence or nonsubstantivality as the key to overcoming
suffering. The four Noble Truths, therefore, advocate the idea of impermanence
and nonsubstantivality as the way to eradicate suffering. The entire reality that is
generally understood in terms of matter and consciousness has been understood
by the Buddha as a series of changing moments (kfcuia). The word moment is
suggestive of the fact that all real or existent is time-embedded. All that exists,
exists in time. Therefore, an existence series is identical with time series. The
existence series could be physical or psychical or a conglomeration (sanghdta) of
the two. Every series in itself is also a conglomeration. Material entity is a
physical conglomeration (bhuta sanghdta), whereas mental entity is a psychical
cong lo m eratio n (citia sanghdta). A living being is a psychophysical
conglom eration. Since the psychical conglom eration is of four types, a
psychophysical conglomeration is named as pahcaskandha, consisting of four
psychical and one physical conglomerations. Die four psychical conglomerations are
vedand skandha, saniskdra skandha, tiania skandha, and sariijha skandha. The
only physical conglomeration is rupa skandha.
The existence series, whether of a physical conglomeration or psychical
conglomeration, consists of distinct units of existence that are discrete but not
independent. They are rather interdependent in die sense that every succeeding
unit in the series, is causally dependent on its preceding unit in that series, and
likewise every preceding unit in the series, in order to be real, has to give rise to
its succeeding unit. These two ideas are technically known aspratitya Samutpdda
(dependent origination) and artha kriydkdritva (causal efficiency). Diey constitute
the essence of the four Noble Truths propounded by the Buddha.
The concept of existence series (kfOJia santana) is pivotal to Buddhist
metaphysics. It explains the reality of incessant change in terms of the causal and
dependent origin of the succeeding from the preceding unit in the series. The
experience of permanence in the series is also explained on the basis of continuity
and dependence. The real is always changing, but the change is not random; it is
Introduction
causally regulated. In case of a human being, the series is psychophysical, having

a distinct identity of its own. But this poses the problem of memory, recollection,
and recognition in every distinct personal identity. Buddhist thought explains
these problems also in terms of ksana santana (existence series). In every
psychophysical series that is unique and self-identical the succeeding stems from
the preceding, and this conglomeration of fivefold series, which begins with the
birth of the conglomeration in a particular form, continues till the death of that
conglomeration in that form. From birth to death in this series there is a constant
change, and yet there is retention with the possibility of recollection and recognition
on the basis of which the past is retained in the present and handed over to the
future. In death the total conglomeration does not cease to exist or does not come
to an end and gets retained so as to give rise to another conglomeration in some
other form in the next birth. In this metamorphosis the psychical series is present
only in the form of sarriskaras (latent impressions) sustained by karmic forces.
The karmic forces determine the nature and form of the next birth. They also
determine th epancaskandhas (the fivefold conglomeration), which has to come
into existence in the next birth. There is continuity not only within one particular
birth but also from one birth to another birth. Thus, in Buddhist thought we
find a remarkable explanation of the problems of personal identity, the experience
of permanence, and so on expressed in the phenomena of memory, recollection,
and recognition.
There are some interesting implications of the no-substance ontology
advocated by the Buddha. The idea of impermanence of reality results in the
denial of a permanent and immortal soul. However, this does not mean that there
is no eschatology or soteriology in Buddhist thought. The Buddhist account of
the destiny of the individual self is conditioned by the ideas of anityata
(impermanence), pancaskandhas (fivefold conglomeration), and santana(existence
series), and accordingly, the destiny of the individual self is characterized as
attainment of nirvana.
Another implication is in the form of insistence on human autonomy and
denial of any suprahuman or divine agency for helping the human being to attain
nirvana. Buddha spearheaded the sramana tradition, which emphasized self
effort and noble conduct (arya-astahgika marga). In this scheme there is no role
assigned to any divine or superhuman agency. Buddha always impressed upon his
followers to have a critical attitude and an analytic bent of mind. He was opposed
to blind faith, and that is why he rejected all notions about transcendental entities.
However, it does not mean that Buddha was antispiritualist. He had an abiding
faith in a moral and spiritual order. That is why he was not a materialist like a
Carvaka.
HISTORY OF BUDDHIST THOUGHT

Early Buddhism centers around the teachings of the Buddha, which are
contained in the Pali Tripitakas. This phase of Buddhist thought is therefore
Introduction
popularly known as Pali Buddhism. Buddha was not a mere speculative and
individualistic thinker. He acquired knowledge and enlightenment not for the
eradication of his own suffering but for the eradication of suffering of all living
beings. Thus, his thought has a practical and universalistic dimension that is
essentially correlated with a theoretical aspect. The teachings of the Buddha
were for the benefit of all living beings who have the capacity to acquire knowledge
and to practice the noble conduct professed by him. In his thinking he did not
concentrate on intricate philosophical issues, this task was subsequently performed
by his followers. The history of Buddhist thought evinces two types of following
of the Buddha, one philosophical and the other theological. Theologically, his
followers form two camps known as Hlnayana and Mahay ana, each having
many sects and subsects. Philosophically, Buddhist thought in India has four broad
divisions, namely, Vaibhasika, Sautrantika, Madhyamika, and Yogacara. Narayana
Bhatta in Manameyodaya cryptically summarizes the basic thrust of each of these
four schools as follows:
Mukliyo Mddliyamiko vivartamcikhilam sunyasya mene jagat,
Yogacara mate tu santi matayah tdsam vivarto kliilah
Artho sti ksaniko tvasdvanumito katJxyeti Sautrdntiko.
Pratyaksam ksana bhanguram ca sakalam Vaibhdsiko bhdsate.
That is, the Madhyamika is the most important philosophical school, which regards
the entire world to be an apparent manifestation of sunya. The next school is
Yogacara, according to which ideas alone are real, and the entire world is an
apparent manifestation of ideas. The third school is that of the Sautrantikas,
which maintains that there are objects existing independently of the ideas, but
they are momentary, and their existence is known only through inference. The
last school is known as Vaibhasika, which holds that all objects are momentary
and perceivable.
For the sake of easy understanding, these four schools can be put in a particular
logical order as Vaibhasika, Sautrantika, Madhyamika, and Yogacara. Perhaps
this may also be the chronological order. All these four schools claim authenticity
and faithfulness to Buddhas thought. Buddha was quite prolific in his ideas, and
it may not be difficult to find rudiments of all these four schools in his thoughts.
The doctrine of impermanence (<anityata), which subsequently was formulated as
the doctrine of momentariness (ksanikavada), and the doctrine of dependent
origination (pratityci satnutpada) are the common planks for all these four schools.
All the schools believe in the ideas of rebirth and nirvana. Their difference is
only in terms of the development of logical structures based on these doctrines
and ideas. We shall briefly discuss the major points of difference characterizing
each of these schools. The schools of Madhyamika and Yogacara (Vijnanavada)
are idealistic in their thrust and are associated with the Mahay ana tradition. The
other two schools have a realistic tendency and are put under Hlnayana tradition.
However, these four schools constitute significant facets of later Buddhist thought.
Introduction
VAIBHAIKA SCHOOL
The Vaibhasika school seems to have acquired this name because it relies
upon a commentary on the Tripitaka known as Vibhasa. This school upholds a
dualism of mental and physical elements. All that is real is momentary, and it is
either physical ([bhuta) or mental (citta). The objects of the world are a
conglomeration of either physical elements or mental elements or both. No object
is permanent or abiding, but since it is in the form of an incessant series, it gives
the impression of permanence. These objects are directly known in perceptual
cognition. When there is simultaneity of appearance of the cognizing consciousness
and the cognized object at a particular time, perceptual cognition of that object
takes place. Thus, all three have simultaneous origin at one and the same time.
Though the object depends on the cognizing consciousness in order to be known,
the dependence is not necessary for mere existence. An object may exist without
being known and may thus be independent of the cognizing consciousness.
Likewise, a cognizing consciousness may also exist independently of the cognized
object. In this way, the Vaibhasika school advocates dualism in its metaphysics
and realism in its epistemology. The Vaibhasika school concentrates more on the
analysis of mental phenomena, and we fmd an elaborate psychological analysis
in the literature belonging to this school.
SAUTRANTIKA SCHOOL
The Sautrantika school derives its name from a commentary called Sutranta.
It is also a realistic school, sharing its metaphysics with Vaibhasikas. Sautrantikas
believe in the momentary existence of the real and classify them into mental and
physical. The mental and the physical are basically independent of each other,
though subsequently they may interact. Sautrantikas regard the object to be
existing independently of the noetic process. The object, the cognizer, and the
cognition are all distinct. The object may be known or may not be known. If an
object is known, it cannot be known in direct perception. In this respect they
differ from Vaibhasikas. According to Sautrantikas, the moment of existence of
the object and the moment of the cognition of the object camiot be the same
because cognition follows and presupposes existence, and every existence precedes
its cognition. There cannot be simultaneity of existence and its cognition. The
Sautrantika thinkers examine and refute the Vaibhasika position in this respect.
In fact, this is the major point of difference between the two schools. The
Sautrantikas argue that the object of knowledge exists independently of the
cognizing consciousness, and it ceases to exist in the next moment. So, when it
comes into existence at that very moment, it is not cognized, and it cannot be
cognized. It does not exist in the next moment to be perceptually cognized, so
there is never any perceptual cognition of an object. However, it does not mean
that an object can never be cognized. There is another mode of cognizing an
object. Before an object ceases to exist, it leaves out its impression. This impression
is the exact copy of its original and has semblance (sarupya) with it. The cognizing
consciousness perceptually apprehends only this impression, and through
Introduction
this perceptual apprehension of the impression it infers the original object. Thus,
Sautrantikas introduce the concept of object impression and through this advocate
the representative theory of perception. For them all cognitions are represented
cognitions of the object. An object-qua-object is not directly perceived. Only its
impression is perceived, and because of the resemblance of the two and cognitive
nonavailability of the object the impression is taken to be the original object.
MADHYAMIKA SCHOOL
The third school is Madhyamika, which is philosophically very significant.
Nagarjuna has been the first known exponent of this school. He argues that
Buddhas teachings consist in the madlTyamapratipad (middle path) to be followed
for the realization of nirvana, which is cessation of all suffering. According to
Nagarjuna, Buddha advocated sunyata (essencelessness) of all existence. All
existences are sunya (essenceless) in the sense that they do not have self-existence
(,svabhava). Every existence has a borrowed existence or a dependent existence
(pratltyasamutpanna); svabhava sunyata (lack of independent existence)
characterizes all reals. The same position holds good in respect of all thought and
language. Just as all real is self-negating, all thought and all language are also
self-negating. Nagarjuna exposes the hollowness and self-contradictory nature of
the important concepts and doctrines prevalent in his time in Buddhist and nonBuddhist philosophies. He successfully employs the weapons of sunyata and
pratityasamutpada to demolish all systems of metaphysics. He advocates a twofold
approach to reality in terms of samvrti sat (empirical real) and paramartha sat
(trancendental real). Both are characterized by sunyutd in different ways. Empirical
is svabhava sunya (devoid of intrinsic existence), and transcendental is prapahca
sunya. By prapahca he means display of thought and language. Nagarjuna
emphasizes the antimetaphysical, practical, and pragmatic nature of Buddhas
teachings and lays stress on the attainment of prajha (wisdom) leading to s'ila
(noble conduct) and samadhi (state of equipoise). This school is known as
Madhyamika because of its emphasis on madhyama pratipada, which is a practical
middle path, avoiding all extremes. It is known as 3unyavada because of its
exposition of essencelessness of all real on account of its dependent character.
YOGACARA SCHOOL
The pluralistic and realistic philosophy of the Sarvastivada culminates in a
monistic and idealistic philosophy of Vijnanavada (Yogacara) by way of a critique
and rejection of Sunyavada. The representative theory of perception of the
Sautrantikas implies that all that is cognized is the content of cognition, and the
content of cognition has a form of its own, which has sameness of form (sdrupya)
with the form of the object. It resulted in the theory of sdkdrajhanavada, a
theory according to which every cognition has a form of its own apart from the
form given to it by its object. From the theory of sdkdrajhanavada there was a
natural transition to the theory that only contents of cognition or vijhanas (ideas)
Introduction
are real and that they alone are cognized. The external objects are only
hypostatizations. They are presumed to be there, but, in fact, they are only
projections of the consciousness. Consciousness alone is real. Thus, in Vijnavda
we find a repudiation of the theory that the object of cognition exists externally
and independently of the cognizing consciousness (bhyrthavda). The
consciousness that alone is primarily real is momentary and is in the form of a
continuous flow (pravka). The Vijnavada advocates three levels of reality,
namely, parikalpita (imaginary), pratntrika (dependent or empirical reality),
andpramrthika (transcendental reality). Transcendental reality is conceived to
be unitary stream of consciousness, technically known as laya vijna. It is a
storehouse of consciousness in the sense that it is the foundation of all streams of
consciousness that are responsible for the appearance of the world of external
objects. It is a repository of the old impressions (saiiiskras) and a depository of
new impressions. In this way laya vijna is the only ultimate reality. In itself
it is pure and cannot be characterized. It can be experienced only in the state of
nirvna. The other level of reality is empirical, which consists of finite stream of
consciousness and objects of consciousness. It is the level of the empirical world
that we experience in our ordinary life. It is a reality that is amenable to empirical
knowledge and linguistic expression. It is empirical reality (samvrti sat), as different
from transcendental reality (pramrthika sat).
DEVELOPMENT OF YOGCRA EPISTEMOLOGY

Maitreya and Asanga
In the Yogcra tradition prior to Maitreya, saga and Vasubandhu initiated
systematic philosophical reflections. It seems Maitreya reached Yogcra position
via nyavda, whereas Asanga and Vasubandhu were initially Sautrntika and
Vaibhsika, respectively, before coming to Yogcra. Maitreya was the author of
several works such as Bodhisattvacary Nirdes'a, Saptadasa Bhumi stra
Yogacary, and Abhisamaylakra Krik. He discussed in detail the nature of
reality and the modes of knowing. In fact he is the forerunner of the art of debate
(vda-vidhi) in the Buddhist tradition. Asanga followed Maitreya and expounded
Yogcra philosophy. He composed two works entitled Prakaranrya Vcstra
and Mahyna Abhidharma Samyukta Sangiti stra. By and large he followed
Maitreya but differed in respect of the theory of proof (sdhana).
Vasubandhu
Vasubandhu carried forward and systematized the Yogcra philosophy. He
was an author of several important works on ontology and epistemology. Some
of the works associated with him are Vda Vidhi, Vda Mrga, Vda Kaus'ala,
Tarka stra, and Abhidhanna Kos'a.
Dinga
Among the post-Ngrjuna Buddhist philosophers Diiinga has been the
Introduction
most notable thinker who has carried ahead the tradition of Maitreya, Asanga,
and Vasubandhu by successfully repudiating the negativistic dialectics of Nagarjuna
and by replacing it with a philosophical positivism that was a synthesis of the
Sautrantika and Vijnanavada schools. It goes to the credit of Dinnaga that he
reconciled the Sautrantika ontology with the rubric of Vijnanavada ontology,
formulated an epistemology and logic suited to this new ontology, and propagated
a distinct philosophical methodology based on the technique of apoha (double
negation). He introduces a new mode of philosophizing by interspersing
ontological discussion in an epistemological setting, a style that later on fascinated
the Navya Nyaya thinker Ganges'a and his followers. Dinnaga employs the technique
of double negation {apoha) for clarity and precision in thought and language. He
is an abstruse logician. In his logic he advocates a dichotomous classification.
This dichotomy is reflected in the advocacy of two types of real, two modes of
their cognition, and two shades of meaning. He applies the idea of svatovyavartana
(mutual exclusion) in the fields of reality, knowledge, and language. In other
words, every real is a class in itself, and everything else constitutes its
complementary class. Thus, there is an exclusive ordering in the realm of reality
such that there are two and only two types of real, namely, svalaksana (unique
particular) and samanyalaksana (its generalized image). Whatever is unique
particular cannot be its generalized image, and vice versa. The same rigid
dichotomy is extended to the field of epistemology. It was innovative of Dinnaga
to point out that every epistemology has to be structured keeping in view the
requirement of ontology. Following this ontological commitment in Dinnagas
epistemology, there are two and only two valid modes of knowing, namely,
pratyaksa (perception) and aniunana (inference), and only two types of knowledge,
perceptual and inferential. The perceptual cognizes the unique particular alone
and can never cognize its generalized image. The inferential, on the other hand,
cognizes the generalized image alone and cannot cognize the unique particular.
So, just as there are rigid dichotomy and strict ordering at the level of reality,
there are also a rigid dichotomy and strict ordering at the level of knowledge.
Dinnaga carries forward this dichotomous distinction to the field of language and
meaning. Every concept is expressible in language in terms of its meaning. Meaning
is conveyed by a word that represents a particular concept.The meaning of a
word is the negative of its negative. Thus, there cannot be any overlapping or
cross-division in the meanings of any two words. Another great contribution of
Dinnaga is in the form of propagation of the theories of:
1.
2.
3.
4.
Meyadhinamanasiddhih : epistemology is to be constructed to support ontology.

Pramana vyavastha: the separation of the two types of mode of knowing (pramdnas).
Hetu cakra : the theory that provides a schema of formal logic.
Anyapoha the theory of double negation, applied to the fields of ontology,
epistemology, and theory of language.
The m agnum opus of D innaga is Pram ana Sam uccaya w ith its
Introduction
auto-commentary (Svavrtti) , Nyaya Pravesa, Nyaya Mukha, Alambana Pariksd,

and Hetu Cakra Damaru are some of his major works. Though Pramana
Samuccaya is lost in its Sanskrit original, it has been partly restored from its two
Tibetan versions and Sanskrit fragments.
Dharmaklrti
Dharmaklrti not only mastered the systems of Vasubandhu and Dinnaga but
also excelled in them. Seven works of Dharmaklrti are known and available.
Among them Pramana Vdrtika is most notable. Pramana Vdrtika is an advancement
of the view of Dinnaga expounded in Pramana Samuccaya, and it supersedes the
latter. It consists of four chapters. The first deals with the analysis of the pramanas
in general, the second with pratyaksa as pramana, the third with inference
(svarthdnumana), and the fourth with syllogism (pardrthdnumana). The next
work of Dharmaklrti is Pramana Viniscaya. It is an abridgment of Pramana
Vdrtika. The third work is Nyaya Bindu, which is a further abridgment. The
remaining four works are small tracts devoted to specific topics. Hetu Bindu is a
short classification of logical reasons. Sambandha Pariksd is an examination of
the problem of relations. Codana Prakarana is a treatise on the act of carrying
on disputation. Santdndntara Siddhih is a treatise on the reality of other minds. It
attempts to refute solipsism.
Chapter 1
The Buddhist Theory of

Knowledge
Every school of philosophy in India has attempted a theory of knowledge (pramana
sastra) on which its metaphysical structure is built. Though the ultimate aim of
philosophizing is generally recognized as knowledge of reality (tattva-jhana) , it
is believed that a theory of knowledge is a necessary prerequisite to a theory of
reality. This belief is grounded in the fact that to philosophize is to reflect on the
nature of reality given in experience. But since every experience is a cognitive
reference to an object, there is always the possibility of going astray in this
reference. Though every experience has a built-in transphenomenality or self
transcendence, it is not always guaranteed that it would adequately and faithfully
reveal its object. This possibility of error in experience necessitates an inquiry
into its veracity. In fact, the entire epistemological pursuit begins with, and
centers around, this task. Thinkers belonging to the Buddhist tradition also,
therefore, attempt to provide a firm epistemological basis for their theory of
reality.
ANALYSIS OF KNOWLEDGE1
All successful human action is necessarily preceded by knowledge. 2 With
this prefatory remark Dharmaklrti defmes the scope and aim of epistemology
and logic in the Nyaya Bindu. Human action may be either purposive or
instinctive. Human purpose is, again, something either desirable or undesirable.
A purposive action based on knowledge consists in attaining the desirable and
avoiding the undesirable. Knowledge is efficacious in causing successful action
in the sense that it results in the attainment of the desirable aim and avoidance of
the undesirable one. A cause may be productive (karaka) or informative (jhdpaka).
Knowledge is a cause of successful action in the latter sense only. It enables us
to reach the real, which alone has practical efficiency.
12
Buddhist Epistemology
Different from knowledge is false cognition. Cognition that makes us reach

an object different from the one revealed in cognition is false. Objects differ on
account of their form and spatiotemporal locations. Thus, cognition representing
one form of the object is not to be considered as true when the real object has a
different form. Likewise, a cognition is not true if it wrongly represents the place
and tune of the object.
In the Praniana Vartika Dharmaklrti defines knowledge as a cognition that
is not in discordance with its object (Pramanam avisamvadi jnanam ).3 He further
maintains that a cognition that is perfectly in accord with its object will also be
characterized by novelty (Ajhdta artha prakaso vd) . 4 It is revelatory of an object
not yet known because the object is momentary in nature and only that knowledge
will accord with the object which arises at that very moment when the object is
also in existence. It is the first moment of cognition, the moment of the first
awareness. Continuous cognition is not valid or true, according to the Buddhists,
because it is not a new cognition but a recognition. Of these two characteristics,
the first, nondiscordance, is basic and can be regarded as the differential character
of knowledge.
Knowledge thus stands for cognition that is a faithful representation of the
real. What it means is that in knowledge the object must be known as it is and not
other than what it is. Since a nondeviating reference is an essential condition of
knowledge, the truth of knowledge consists in its accord with the cognized object.
Dharmottara puts it as follows: In common life when we say that truth is being
spoken what we mean is that it makes us reach an object. Similarly, that cognition
is true which makes us reach an object it points to. In fact, knowledge does not
create an object and does not offer it to us, but just makes us reach at it. By
making us reach an object nothing else is meant than attending to it . 5 Here
Dharmottara points out three distinct, successive stages involved in the process
of apprehension of an object, each succeeding one resulting from the preceding.
They are cognizing (adhigati), attending (pravartana), and reaching (prapana).
He makes it clear that the first stage alone is knowledge.
Knowledge is of two types. It is intuitive when it springs from inside. It is
discursive when it is acquired by directing our attention toward an object with the
help of the senses and the cognizing consciousness. Only discursive knowledge
is analyzed in epistemology.
THE PROBLEM OF PRAMANA

As stated earlier, knowledge is a nondiscordant cognition. This means that
not all cognitions are knowledge. Only those cognitions whose nondiscordance
is evidenced can claim the status of knowledge. The problem of pramana that has
given rise to much stimulating debate in the epistemological treatises of Indian
origin is basically a problem of evidencing the truth of a cognition. The question
of evidencing a cognition arises because all cognitions are unequal in their epistemic
status. Some appear to be true and reveal their corresponding objects as they are,
whereas others seem to be erroneous and misrepresent their objects. Had all
The Buddhist Theory of Knowledge
13
cognitions been true, there would have been no need of evidencing them, and
the entire epistemological inquiry would not have arisen. The very possibility of
error in a cognition necessitates its subjection to a critical examination with a
view to establishing its truth or falsity. If the truth or falsity of a cognition needs
to be established, the question arises what sort of criterion is to be resorted to.
The problem of pramana has been discussed and raised precisely against this
background.
PRAM ANAPHALA
Indian thinkers generally adopt a causal approach to knowledge. Knowledge
is taken to be an outcome of a particular causal complex in which the most
efficient instrumental cause (karana) is technically known as pramana. In the
Buddhist tradition, the word pramana refers to both the process of knowing and
the knowledge acquired on that basis. Buddhists do not entertain the distinction
b etw een the p ro c ess of know ing {pram ana) and its o utco m e
(pramanaphalaprama). Whether or not pramana and pramanaphala are to be
sharply distinguished has been a hotly debated issue between Nyaya and Buddhist
thinkers. Nyaya thinkers insist that pramana as a process leading to prama should
be distinguished from the latter, which is its phala (result). For them prama is
the pramanaphala, and pramana is the karana of prama. Buddhist thinkers,
however, maintain that no distinction can be possible between the noetic process
and its outcome. The act of cognizing completely coincides with the cognition of
an object. In fact, Naiyayikas have to accept the distinction because for them
pramana is the evidencing condition for the truth of knowledge, whereas
prama is the evidenced knowledge. For Buddhists, knowledge is self-evidencing,
and therefore there is no need to distinguish between pramana and its phala.
Thus, the difference between Naiyayikas and Buddhists is due to the difference
in their understanding of the nature and role of pramana. Naiyayikas understand
pramana as that which is the most efficient causal condition giving rise to, and
evidencing, the knowledge (pramdyah karanam iti pramanam), whereas for
Buddhists, it means that by which an object is known (pramlyate artho aneneti).
Dinnaga, however, does not refuse to draw this distinction if it is needed
from a functional point of view. He writes, We call the cognition itself pramana
because it is generally conceived to include the act of cognising although primarily
it is a result. Commenting on it, he writes, Here we do not admit, as the
Realists do, that the resulting cognition differs from the means of cognition. The
resulting cognition arises bearing in itself the form of the cognised object and is
understood to include the act of cognizing. For this reason it is metaphorically
called pramana although it is ultimately devoid of activity. 6
Nature of Pramanaphala
In the Dinnaga-Dharmaklrti tradition two different views are available about
the nature of pramanaphala. According to one, pramanaphala consists in the
14
cognition of an object (visayadhigama). According to the other, it consists in

self-cognition {sva-samvitti). Both these views are complementary and not
conflicting and are available in the works of Dinnaga . 7 They are explicitly restated
by Dharmaklrti and Dharmottara . 8 Santaraksita gathers them together and brings
out their distinction. He maintains that according to the Sautrantika tradition,
which believes in bahyarthavdda (realism), sarupya (similarity in form) obtaining
between a cognition and its object is to be treated as pramana, while cognition of
an object (visayadhigati) is to be treated as pramanaphala. According to
Vijhanavada, sarupya is, of course, the pramana, but sva-samvedana or svasamvitti (self-cognition) is the pramanaphala. In the ultimate analysis these
views are not different because visayadhigati and sva-samvedana are not two
different phenomena as they are two facets of the same knowledge.
Sarupya as Pramana
It has been one of the perennial problems of philosophy to put forth a criterion
of truth that is cogent and convincing. Since knowledge consists in a cognitions
being free from discordance with its object, the criterion of truth has to be
formulated in terms of knowledges being in accordance with its object. Buddhist
thinkers therefore put forth sarupya as a pramana, in the absence of which no
cognition can be taken to be knowledge. The doctrine of sarupya has been
formulated keeping in view the self-evidential character of knowledge and also
the view that since every knowledge is an awareness of an object, the conditions
of its truth are to be determined in terms of its reference to the object.
The Concept of Sarupya in Early Buddhist Philosophy

The doctrine of sarupya advocated by Dinnaga and Dharmaklrti has its roots
in the Sarvastivada tradition , 9 though it can further be traced back to the early
Buddhist literature in Pali . 1 0 In the Sarvastivada tradition independent and objective
existence of the external object was admitted. Similarity {sarupya) of the form
represented in a cognition to that of the object is held to be the pramana of the
resulting cognition of that object {visayadhigati). Accordingly, a cognition that
is produced along with its object is true with reference to that object. The
object, the cognitive sense, and the cognizing consciousness are all simultaneous
and momentary. All three exist at the same time {sahabhu hetu) and constitute
the collocation of causes {kdrana-sdmagri) that gives rise to the cognition. This
Abhidharma account of the genesis of perceptual cognition has been represented
by Stcherbatsky in the form demonstrated in Figure 1.1.
15
Figure 1.1
Sahabhu hetu
visaya
indrlya
vijna = manas
--------------------meeting point of the three
(tmyaiiam sannipatah = perceptual cognition).
There the perceptual cognition is regarded to be a resultant of three types of

causal factors, namely,
1.
2.
3.
sainanantarapratyaya (i.e., perceiving consciousness),

adhipatipratyaya (i.e., cognitive sense), and
dlambatia pratyaya (i.e., object).11
Here a question naturally arises as to why a particular cognition should refer

to the object only for its determination and not to the cognitive sense or the
cognizing consciousness, which are equally simultaneous with it. This is explained
by putting forth the doctrine of sarupya, according to which, though all three
causal factors are simultaneously present, the object alone provides a form to the
cognition and thus determines it.
The preceding view is put forth by the Vaibhasika school but it is not acceptable
to Sautrantikas, who reject the notion of sahabhu hetu, that is, the simultaneity
of object, cognitive sense, and cognizing consciousness. The basic objection
raised by them against this position is that in the background of momentariness it
poses a serious problem. When the cognition arises, the object is no longer
present because, being momentary, it must have by then been destroyed. In such
a situation how can it be called the perception of that object alone, and, further,
how can that object be the determinant of the truth of the cognition? The
Sautrantikas therefore solve this problem by putting forth the doctrine of sarupya,
according to which the object no doubt is momentary but leaves its impression
upon consciousness, and through this impression, which has sarupya with the
object, the object is cognized . 1 2
Though both the Vaibhasikas and Sautrantikas accept the doctrine of sarupya,
they use it differently. The former use it to explain why the cognition is determined
by the object and not by the cognitive consciousness, though both are the causal
factors giving rise to the cognition; while the latter use it to explain how the
object that is already destroyed is cognized in perception.
The Doctrine of Sarupya in the Dihnaga-Dharmaklrti Tradition

In the Dihnaga-Dharmaklrti tradition the doctrine of sarupya has been
primarily put forth as a pramana for perceptual cognition, and in this sense it
16
marks a departure from the Sautrantika use of this concept. In fact, Stcherbatsky1 3
has pointed out three different uses of the term sarupya, namely:
1.
2.
3.
to refer to the relation between a sensation and a conception,

to refer to the relation between svalaksana and its pratibhdsa, and
to refer to the relation between a svalaksana and its corresponding sdmdnya laksana.
In the Dinnaga-Dharmaklrti tradition it has been used in the second sense.
THE DOCTRINE OF SVA-PRAKASA (SELF-REVELATION)

The doctrine of sarupya has been put forth in the context of the more basic
doctrine of dvairupya, which implies that every cognition is necessarily in the
form of a twofold appearance, namely, that of the object and that of itself. This
doctrine of dvairupya has been an inevitable corollary of the doctrine of svaprakasa (self-revelation of cognition), which results in the obliteration of the
distinction between pramana and pramanaphala, insofar as the same cognition is
at.once both the evidence and the evidenced.
The doctrine of sva-prakasa has been the basic tenet of the Buddhist
epistemology put forth in the context of the theory of momentariness. If a cognition
is just a momentary state of existence ceasing to exist the next moment, then
either we can have a cognition of that cognition in the very moment of its origin,
or we shall have to deny the very possibility of the cognition of that cognition
because the next moment that cognition will no longer be there to be cognized by
the subsequent cognition. Since the cognition of a cognition is a fact given in our
experience, it can be understood only in the context of the doctrine of svaprakasa. Consistent with the theory of momentariness, Buddhists talk of the
cognition of cognition only within the framework of simultaneity and never that
of succession. Thus, the only position available would be to advocate the theory
of sva-prakasa, which would mean that at the very moment of the cognitions
cognizing an object, it also cognizes itself.
Dirinaga and Dharmaklrti use the expression svasaihvitti to express this
fact. 1 4 Thus, when a man has the cognition of something blue, he has at the same
time the awareness of the cognition of something blue. This awareness is caused
by nothing other than the cognition itself. Thus, the cognition, while cognizing
an object, cognizes itself just as a lamp illuminates itself while illuminating an
object.
The Doctrine of Dvairupya

The doctrines of sva-prakdsa and svataJi-prdmdnya (self-evidentiality of
cognition) go together. Not only is every cognition a cognition cognizing itself
but it also evidences itself. Now the question is, How is it that a cognition cognizes
itself and thus establishes itself as true? To answer this, as stated earlier, the
doctrine of dvairupya has been put forth . 1 5 Every cognition is produced with a
twofold appearance, namely, that of itself (svdbhasa) and that of the object
17
(yisaydbhasa). In being visayabhasa it establishes its truth because of its being in

the form of the object . 1 6 When a cognition possesses the form of an object, it is
a sufficient condition for its being true. Thus, Dinnaga writes, The pramana is
simply the cognition having the form of the object . 1 7
Hattori 1 8 has made an attempt to represent the doctrine of dvairupya using
the following symbols:
Visayajnana = C {
Svabhasa in C ] =
Arthabhasa in Cj = Oj
Visayajnana-jhana = C 2
Svabhasa in C2 = S2
Arthabhasa in C2 = 0 2
He writes that, according to Dinnaga, C { = (S{ - Oj), C 2 = (S2 -0 2).
'
indicates relation). Since C 2 takes C x for its object, 0 2 = (S{ - 0 {).Therefore,
c2 = {s2 - (Sj - Oj)}. Thus, c2is distinguishable from C r
Now, in case the cognition had only arthakara ( = abhasa), then Cj = O p
and C 2 = 0 2. Since C 2 takes C x for its object, 0 2 = O r Therefore, C 2 = C r
Thus, visayajhana-jhana would be indistinguishable from visayajnana. If, on the
other hand, the cognition had only svakdra (= dbhasa), then C x = Sp and C 2 =
S2. However, since the cognition, which does not possess the form of an object
within itself, remains the same at all times, S2 = S r Therefore, C 2 = C r
In fact, Hattori goes beyond C 2 to postulate C 3 and C4 and so on ad infinitum.
He writes, In the same manner, the third and the succeeding cognition C3, C4
Cn are distinguishable from the preceding ones only when they are
acknowledged to possess dvi-rupa. " The formulas are
as follows:
C 3 = (S3 - 0 3) = {S3 - (S2
- o 2)}.
c n = (S
- O i)r = (S
- (S
, - On -,))
v n
v n
v 11-I
Fy
(S3
Sn and 0 3 .... On,respectively, stand for svabhasa and arthabhasa
in C3 ... Cn), C2, C3 ... Cnare constituted by adding another dkdra to the preceding C},
This symbolic representation and its explication given by Hattori do not
seem to be very appealing, mainly because they are based on the presumption
that in the self-cognition of the cognition, which involves two cognitions, namely,
Cj and C2, Cj is the preceding, and C 2 is the succeeding one. Hattori proposes
to go beyond C2 to C3, C4 ad infinitum. In this venture he seems to be working
under the succession-model. But as we have stated earlier, Dinnagas theory of
sva-prakasa cannot adequately be understood like that. Dinnaga is quite explicit
in advocating the simultaneity model which would preclude any overstepping
from Cj to C2. If C { is granted the dual form of svdkara and arthdkdra, which
18
Figure 1.2
Dvairupya Model
Object (visaya)
cognition (jnna )
svkra (pramna-phala)
arthdhigati
arthdkdra (pramdna)
= (artha-srpya) = srupya
svasamvitti
sva-prakdfa theory pronouncedly intends to do, there is no need to bring in C2,

and if C 2 is needless, we also have, ipso facto, not to go beyond C 2 to Cn. Thus,
a distinction between Cl (= visayajndna) and C 2 (= visayajhana-jhana) would
violate the very spirit of Dinnagas theory of sva-prakds'a. In fact, within Cx
itself we have svabhdsa and arthabhasa, which are inextricably so interspersed
that they can be distinguished only for the sake of conceptual clarity but can
never be separated. However, this distinction does not in any way imply that
svdbdsa (visayajhana-jhana) and arthabhasa (visayajndna) are two different
occurrences. In the very act of knowing an object there is an awareness of the
knowing because had there been no awareness of the knowing at the initial moment,
it could not be possible to have it subsequently, as neither the object nor the
cognition of the object would last for the next moment.
Hattori seems to understand the Buddhist theory of dvairupya as implying
that at the first moment there is a rise of the first rupa, namely, that of
visayakdra, and then at the succeeding moment there will be the rise of the
second rupa, namely, that of svakdra, but such an interpretation doesnt do
justice to Dinnagas position, which explicitly maintains that a cognition has
svakdra along with arthdkdra (= visayakdra).
The Buddhist theory of dvairupya understood in the context of simultaneity
model is represented in Figure 1.2.
THE CONCEPT O F VI$AYAK ARA
The Buddhist theory of dvairupya as represented in Figure 1.2 states clearly
that arthakaritdy also known as artha-sarupya or just sarupya, is the pramdna of
which arthadhigati (apprehension of the object) and svasamvitti (self-cognition)
are the pramana-phala. There has been a controversy, among Buddhist logicians
preceding Dinnaga as to whether arthddhigati is the pramdna-phala or svasamvitti.
Of course, this controversy presupposes the distinction between pramdna and
19
pramanaphala for pragmatic purposes only. Granting this distinction, Dinnaga

writes that, strictly speaking, arthadhigati alone is the pramanaphala, but
svasamvitti can also be regarded as pramanaphala , 1 9
Every cognition is a cognition of something and thus inevitably refers to an
object. The object gives rise to, and thus determines, the cognition. The object
is regarded as the dlambana pratyaya, that is, the very ground upon which the
cognition is based. In fact, the object not only serves to give rise to the cognition
but also differentiates it from other cognitions. Without assigning this task of
differentiation to the object, one cognition cannot be differentiated from another
cognition. Though from the transcendental point of view every phenomenon is
vijhaptimdtra (pure consciousness), at the empirical level a triple division of
vijhdna (consciousness) is drawn into grahyakara (the form that is cognized),
grahaka (the cognition), and svasamvitti (self-cognition).The grahyakara serves
as a differentiating factor between one cognition and another. 2 0
Since every cognition is determined by the object, this determination should
be understood as the cognitions having the form of the object. Thus, if the
object is a pen, the corresponding cognition should have the form of pen. Then
only will it be said to be determined by the object pen and be a true presentation
(abhdsa) of that object. If the cognition is at variance with the object, it will not
then be determined by the object, and this will amount to its falsity. In order that
a cognition should be true, it has to reflect or represent the object in its real form.
This will be possible only when the cognition is arising in the form of the object.
The truth of a cognition, therefore, consists in this sameness of form with the
object. It is not that knowledge is form less, as is m aintained by the
nirdkarajhanavadins. If the cognition were formless while the object had a form,
then the cognition itself as distinguished from the object would remain the same
whether it cognizes something blue or yellow or anything else. Therefore, the
cognition as the apprehension of the object must be admitted to be sakdra. To say
that cognition is sakdra is the same thing as to say that it has the form of the
object. The sakdra cognition is thus understood to possess the function of assuming
the form of the object. For this reason Dinnaga considers it as pramana, although
primarily it is a phala in its aspect as apprehension of an object. 2 1
N IYATA AND AN IYATA PRATIBH A SA
According to Buddhist thinkers since every true cognition (and, for that
matter, every cognition) is necessarily caused by an object, and since there are
only two types of objects, namely, the grahya (given) and the adhyavaseya
(construed), there are two types of cognition, the perceptual and the conceptual.
Corresponding to these are two types ofpratibhasa (mental reflex). The perceptual
cognition consists in a pratibhasa that is niyata, that is, definite and not vague,
because it is caused by an object that is independent of the perceiving consciousness
and therefore objectively real. In case of conceptual cognition there is no such
objectively existing real object, and hence the pratibhasa here is aniyata, that is,
indefinite and vague. The apprehended object giving rise to an awareness generates
20
a regulated mental reflex (i.e., a reflex limited to that very object). It is just like
a patch of color that, giving rise to visual awareness, generates a definite mental
reflex limited to that patch. The conceptual awareness, on the other hand, is not
generated by the object. Thus, in the absence of the causal factor to regulate the
mental reflex, there is no fixed (definite) mental reflex. However, it should be
made clear that from the empirical point of view this aniyatatva (indefiniteness
of pratibhdsa) in no way affects the epistemic status of inferential cognition
because the validity (prdmdnya) of a cognition depends not on the vagueness or
definiteness of pratibhdsa but on its sarupya (conformity with the object), and in the
inferential cognition it is very much present.
Dinnagas Analysis of Pratibhdsa

Since the object gives rise to its pratibhdsa, the pratibhdsa has to be in
coordination with its respective object. According to Dinnaga, every pratibhdsa
has to be in coordination with its object because it is produced by that object
only. An object cannot produce any such pratibhdsa that cannot accord with it.
Logically, therefore, he rules out any possibility of deviation from its object in a
pratibhdsa.
Dharmaklrtis Analysis of Pratibhdsa

Dharmaklrti, however, maintains that sometimes an object may fail to give
rise to its genuine pratibhdsa. This may be due to several factors like the locus of
the object, the circumstances of the presentation of the object, the disturbed
state of cognizing consciousness, and so on. If a pratibhdsa fails to accord with
its corresponding object, it will lack coordination with it, and to that extent it
cannot be said to be genuine. Thus, when one has the pratibhdsa of a moving tree
while traveling in a boat, the pratibhdsa cannot be said to be genuine because it
is not in accord with its object. Of course, such an analysis of the epistemic
situation would not be acceptable to Dinnaga, who would insist that every
pratibhdsa has to be in accord with its object because it is produced by that
object only.
Irrespective of whether a pratibhdsa may or may not deviate from its object,
the fact remains that every pratibhdsa in a true cognition must be in accord with
its object. That is why Buddhist thinkers insist on avisam vadakatva
(nondiscordance) as a necessary condition of a true cognition.
Is There Arthasarupya in Inferential Pratibhdsa?

While commenting on the Nyaya Bindu of Dharmaklrti, Dharmottara seems
to maintain that there can be only one type of real object, namely, the svalaksana
(unique particular) . 2 2 There is no real object corresponding to the conceptual
cognition insofar as the samdnyalaksana (generalized image or concept) is not
objectively real. This will then mean that in a conceptual cognition there will not
be any possibility of arthasarupya (coordination) with the really existing object.
But Dharmottaras contention can be sustained only if we overlook the fact that
21
for Buddhist thinkers s&m&nyalaksana is also real, although, of course, it is real

only from the empirical point of view (samvrtti sat).
Justification for Accepting Sarupya

It seems that the only reason for the Buddhist thinkers to advocate the theory
of sakara jnana is to provide for the determination of the cognition by its respective
object. Every cognition refers to an object insofar as it is produced by the object.
There is no cognition that is not produced by the object and that therefore is not
having some form given by the object. Thus, there is no formless cognition,
because in the very process of its being produced by the object, it gets, so to say,
the form of the object. It may be that the form of a cognition does not accord with
the specific object that is given in the epistemic situation and may accord with
some other object that is not given but only hypostatized. Such is the case in
illusion. Here, there is no arthasarupya, and hence it is not a true cognition. The
cognition here has a form but not of the given object. Thus, the doctrine of
sarupya serves the purpose of distinguishing between a true cognition and an
erroneous one. Buddhist thinkers understand truth in terms of avisamvadakatvamy
that is, nondiscordance with the object of cognition. The necessary as also the
sufficient condition for the availability of nondiscordance is arthasarupya, which
means the cognition should be determined by that very object and not by any
other object. If it is determined by some object other than its own, it will be a
case of vairupya (discordance) rather than that of sarupya, because in that case
some other object will be the determinant rather than the legitimate one.
Having analyzed the doctrine of sarupya, we may proceed to see the grounds
for its acceptance. Though this doctrine is deduced as a corollary of the doctrine
of dvairupya, two grounds one positive and the other negative have been put
forth to account for its acceptance. The first ground is the fact of recollection,
which provides the basis for saying that the cognition has two forms and that it is
in accord with its object. As Dinnaga puts it, If the cognition has only one
form, either that of the object or of itself, then the object which was cognized in
the preceding cognition could not appear in the succeeding cognition, because
that object of the preceding cognition would not exist when a succeeding cognition
arises. But we do have facts of recollection when some time after there occurs to
our mind the recollection of our cognition as well as that of the object. We
express the fact of the recollection of a past cognition in the form I remember
that I cognized the object. The recollection of a past cognition is explainable
only by admitting that the cognition is cognized by itself . 2 3
The second ground for admitting sarupya as a pramana is that if a cognition
were not self-cognizing and self-evidencing, this would have resulted in infinite
regress, because it would have required another cognition for its cognition and
validation, and the second one would have required a third one, and so forth.
The doctrine of sarupya is fully consistent with the idealistic position of
Vijhanavada Buddhism, for which in the ultimate analysis all objects that appear
to be objective and external are nothing but projections of the consciousness.
22
Because of this the Buddhist can talk of the cognition appearing in the form of
object. As has been pointed out earlier, the idea of cognition assuming the form
of the object should not be mistaken as sameness of form between the object and
the cognition. It stands only for the determination of the cognition by the object.
However, the term sariipya is slightly misleading insofar as it gives the impression
as if cognition has the same or similar form possessed by the object. It is meaningful
to talk of the fonn of an object, but it doesnt make much sense to talk of the
form of a cognition unless it is understood in a figurative sense only. All that it
should be understood to mean is that every cognition necessarily refers to an
object, and every true cognition has to refer to the object as it is. To refer to the
object as it is means to be of the form of the object. Understood in this way the
contention of the Buddhist seems to be plausible, but to express this with the help
of the term sarupya is beset with the difficulty referred to before. In fact, the
Buddhist logicians should have used another word that would have better expressed
the idea of the cognitions being determined by its corresponding object.
THEORY OF MEYADHINAMANASIDDHIH
The idea that the truth of a cognition is to be determined in terms of its
reference to its object leads Buddhist thinkers to the theory of Meyadhina mana
siddhi. According to Dinnaga, knowledge is no doubt revelatory of its object,
and therefore object depends on knowledge for its revelation; the truth of
knowledge, however, depends on its exact reference to its object. So far as epistemic
dependence is concerned, the object depends upon knowledge, whereas with
regard to ontic dependence, knowledge depends on the object. In the context of
truth ontic dependence is taken into consideration by Buddhists. However,
Naiyayikas sharply differ from Buddhists and insist that though knowledge is a
faithful awareness of its object, the truth of knowledge is not determined and
guaranteed by the object but by the most efficient causal condition, which is
technically known as karana. In fact, this is a natural corollary of the Nyaya
distinction between praniana and pramanaphala. Thus, for Naiyayikas all that
is real is knowable, and the truth of knowledge is generated (utpatti) and vouchsafed
(jnapti) by praniana only. This is known as the theory of Mdnddhlnameyasiddhih.
In other words, for Naiyayikas epistemology determines ontology, but for
Buddhists the reverse is the case.
OBJECTS OF KNOWLEDGE
According to Buddhists, there are only two kinds of objects of knowledge,
namely, the real, objective, unique particular (svalaksana) and the generalized
concept or image {samdnyalaksand). This is because the thing to be cognized has
the preceding two aspects. The objective real in the form of unique particular has
no extension in space and no duration in time. It is devoid of all form, attributes,
determinations, and relations. It is just a point instant or a moment in the incessant
moments of series of reals. It is unique particular in the sense that it is neither
identical with, nor similar to, any other object. It is a distinct existence dissimilar
23
to, and noncomparable with, any other real. It is instantaneous because it never
endures for the next moment. It is discrete in the sense that it is an isolated
existence not at all related to any other existence. So no relation exists between
any two unique particulars, all relations being subjective mental constructions.
Such an object alone is objectively real. This is a very distinct and unique view
held by Buddhists with regard to the nature of reality. Reality is essentially
momentary and dynamic. It is a process in which each moment depends for its
existence on a previous moment. Each moment is in itself unique but causally
determined by the previous moment. Being momentary, we cannot assign any
name to this reality because the act of giving a name implies that ( 1 ) the real has
to exist for more than one moment in order that a name could be recalled and
associated with it and that (2 ) since the function of naming requires the possibility
of identifying a thing whenever its name is uttered, a momentary real cannot be
named, and whatever is named is not the reality proper. Therefore, there is one
aspect of reality-in-itself, and there is another aspect of reality that is conceptualized
and talked about in general terms.
Thus, distinct from the unique particular is another type of object of
knowledge, known as sdmanyalaksana, which is a construction of our mind and
which is in the form of a generalized image. The generalized image is a form
imposed by our mind on the objective reality. A generalized image, also known
as concept (vikalpa), can be, broadly speaking, of five types, namely, pertaining
to substantiality (<dravya), adjectivality (guna), relations and spatiotemporal
locations {karma), class-character (jati), and linguistic determination (nama). A
generalized image is a mental construction {kalpand) having no objective existence.
Comprehension of objects as having extension in space and duration in time is
nothing but generalization, which is only subjective or intersubjective and has no
counterpart in the objective world. Similarly, all attributes, relations, and so on
are nothing but generalizations.
KINDS OF KNOWLEDGE
On the basis of the preceding ontological analysis Dihnaga enunciates the
theory that since there are only two kinds of objects of knowledge, there are only
two kinds of knowledge. Corresponding to the unique particular {svalaksana)
we have perceptual knowledge {pratyaksa), and corresponding to the generalized
image we have inferential knowledge {anumdna). A knowledge is either perceptual
or inferential, and there is no knowledge beyond the purview of these two. Thus,
the entire Buddhist epistemology is based on the foundations of the theory of
twofold knowledge. Perception {pratyaksa) is pure sensation, a direct senseapprehension of the unique particular. Inference {anumdna) is a mental construction
in the form of generalized images. Of course, perceptual knowledge is immediately
followed by the inferential one; the former is not at all judgmental or determinate.
Buddhist thinkers emphatically maintain that the unique particular is knowable
in perception only and that the generalized image is known only through inference.
24
By implication the unique particular can never be known in inference, and likewise
the generalized image can never be known in perception. What is known in
perception cannot be known in inference, and viceversa. Such a position of
radical dichotomy of mutually exclusive modes of knowing is known as
pramnavyavastha, which means that each of the two modes of knowing has its
own separate and distinct sphere of operation.
There is no intermingling in the respective objects of the two. As the unique
particular alone is objectively real, while the generalized image is a mental
construct, and the one is radically different from the other, there cannot be any
cognition that comprehends both at the same time.
Chapter 2
The Buddhist Theory of Perception

In the Buddhist theory of knowledge perception (pratyaksa) is regarded as
the foundational pramana insofar as inference (anumana) depends on it.
Inference presupposes perception, and, therefore, only in this respect does
perception acquire primacy over inference. Though all Buddhist thinkers
from Dinnaga onward agree on this point, their understanding of the nature of
perception is not the same, and hence they define it in different ways.
DEFINITION OF PRATYAK&i
To give a logically concise and comprehensive definition seems to be a very
difficult task. Some thinkers may maintain an extreme position that such a definition
can never be given. If the thing is known, they may argue, its definition is
useless, and if it is not known, it is still more useless because it is impossible.
This, of course, has not been the view of the Buddhist thinkers we are concerned
with. Among these thinkers Dinnaga not only puts forth definitions of
philosophical terms in as sharp and clear-cut way as possible but also gives a
specific method of defining with the help of double negatives (atadvyavrtti).
Nyaya-Mlmamsa thinkers attempt to define things in terms of their essence,
that is, their characterizations and relations. Dinnaga, on the contrary, contends
that such definitions are useless because the essence doesnt exist. Thus, thingsqua-things (,svalaksatias) are indefinable. However, our conception of a thing
(vikalpo) is definable. According to him, the characteristic feature of all our
conceptual knowledge (and of language) is that it is dialectical. Every conception
is a negative corelate of its counterpart and while defining a concept this alone
can be stated. So, a definition is only a negative characterization (vydvrtti). For
example, what the color blue is we cannot tell, but we may divide all colors
26
into blue and non-blue. The non-blue may mean any color other than
blue. The defmition of blue will be that which is not non-blue, and conversely,
the definition of non-blue will be that which is not blue. For Buddhists all
knowledge can be dichotomously classified into direct and indirect. The direct is
not indirect, and indirect is not direct. The direct cognition is technically known
as pratyaksa, and the indirect as kalpana or paroksa. Pratyaksa can therefore be
defined in terms of its distinction from kalpana or paroksa. From this it follows
that pratyaksa can be understood as the negative of kalpana.
THREE WAYS OF DEFINING PRATYAKSA

In the later Buddhist epistemology three distinct positions are discernible in
an attempt to define pratyaksa. Though there seems to be unanimity among
Vasubandhu, Dinnaga and Dharmaklrti that the defmition of pratyaksa should be
in terms of negative of kalpana, they sharply differ with regard to the
phraseology that is to be used to express this point. Vasubandhu does it by using
positive phraseology. Thus, he falls on one side, while Dinnaga and Dharmaklrti
on the other. The latter, though they use negative phraseology, differ between
themselves not only about the full rendering of the phraseology but also about
the epistemic status of pratyaksa. We first state the three positions in detail and
then undertake their comparative analysis, particularly of the positions of Dinnaga
and Dharmaklrti.
VASUBANDHUS DEFINITION OF PRATYAKSA

On the basis of the information available to us Vasubandhu can be regarded
as the first systematic epistemological thinker pertaining to the tradition followed
by Dinnaga and Dharmaklrti. In the Vada-Vidhi pratyaksa is defined as tatorthad
vijndnam pratyaksam1 that is, perception is a cognition produced from that
object. In this defmition Vasubandhu maintains that pratyaksa is a cognition
that is determined by its object. Here the word tato points out the exclusive
role of the object (dlambanapratyaya) in contradistinction to the role of the
cognitive sense (<adhipatipratyaya) or the cognizing consciousness {samanantarapratyaya).2 For example, if the object is fire, which is an existing real
(svalaksana), and if it is cognized, then cognition of fire is a case of perceptual
cognition. Such a cognition has a real object, which is fire, as distinct from the
conceptual object, which is the idea of fire. Bare experience of the object without
any conceptual element is regarded as perceptual cognition. This differential
character of pratyaksa, which consists in being negative of kalpana, has been
expressed by Vasubandhu with the help of the phrase tatorthad. The idea to
be expressed by the phrase tatorthad is by implication the same as without
any conceptualization. Therefore, Vasubandhu can be interpreted as defining
perception as bare experience that is solely and wholly caused by the object
without any intermingling of conceptual elements. Though Vasubandhu does not
27
specifically say that a perceptual cognition has no element of conceptualization

and verbalization, in fact, he means it when he says that it is exclusively coming
from the object.
DINNAGAS DEFINITION OF PRATYAKSA
Instead of defining pratyaksa in terms of tatorthdd vijhanam, Dinnaga
defines it in terms of kalpanapodham, perhaps because the idea of pratyaksa
as negative of kalpana can be better expressed by the latter phrase rather than
by the former. After having stated that there are only two kinds of knowledge, 3
which he conventionally calls pratyaksa and anum ana, Dinnaga turns to
pratyaksa and says that this knowledge is kalpanapodham* (nonconceptual), which
is another way of stating that it is negative of kalpana. Earlier, he argued that
there are only two types of cognition and that there is no need to postulate three
or more types; otherwise, it may lead to infinite regress . 5 Thus, the object can be
cognized either in pratyaksa directly or in anumana indirectly; there is no other
way of cognizing it.
Dinnaga seems to have two objectives in mind when he proceeds to define
pratyaksa, namely,
1.
2.
to distinguish it from anumana and so on (anyavyavrttyartham) and

to distinguish the Buddhist conception from the views of other schools
(vipratipattinirdkarandrtham).
Rejection of Nyaya-M imamsa Definition

The usual definition of pratyaksa given by Nyaya-Mimamsa and other
non-Buddhist traditions in terms of sense-object contact (indriyartha-sannikarsd)
has been rejected by Dinnaga mainly because it takes no notice of the basic
feature of pratyaksa, which is always a new cognition, that is, cognition of
something new and not recognition. Such a cognition can be only in the form of
sense perception, which is the first moment of every cognition. In the following
moments when the attention is aroused and the process of mental construction
begins, it is no more that pure sense perception that it was at the first moment.
Moreover, that definition contains a concealed confusion between the proper
function of sense perception and the function of the mind. Sense perception has
its own function, its own object, and its own cause. Its function is to make the
object present to the senses (sdksatkaritva vyapara), not, of course, forcibly (na
hathdt). Its object is svalaksana (unique particular) since this alone, being real
and efficient, can produce a sense impression, and the svalaksana (unique
particular) again is its cause. Thus, pratyaksa consists in an awareness (pratibhdsa)
of the presence of an object, its mere presence and nothing more. To construct an
image of an object (pratibhdsapratiti) the presence of which has thus been reported
is another function, a subsequent operation that follows in the track of the
first.
28
Rejection of Vasubandhus Definition

Dinga disagrees with Vasubandhus way of expressing pratyaksa in terms
of tato'rthd mainly because it suffers from ambiguity. Dinga, being an
abstruse logician, does not want to leave any lacuna in his definition that he
detects in that of Vasubandhu. In saying that a perceptual cognition is that which
is exclusively caused by the object, it is not clearly specified whether or not this
forbids the involvement of mental construction. Dinga states this point quite
explicitly by defining perception as kalpapodham (non-conceptual).
Comparison of the Definitions of Vasubandhu and Dinga

In fact, there does not seem to be any fundamental difference between
Vasubandhus definition and that of Dinga. The same fact has been positively
stated by Vasubandhu and negatively by Dinga. Both agree that what we normally
take to be perceptual cognition is, in fact, a complex of perceptual and conceptual,
a synthesis of the contribution of the object and of the knowing mind (citta). If
we represent this complex as K , the contribution of the object as S , and the
contribution of the knowing mind as C and synthesis as + , then K can
also be represented as S + C (i.e., K = S + C). According to both thinkers,
the total K is not perceptual; it is a complex of perceptual and conceptual. Out
of this complex only S is perceptual, not C . This fact has been stated by
Vasubandhu in saying that S is perceptual and by Dinga in saying that K C is perceptual. But, in fact, the two expressions, S and K - C are equivalent.
The linguistic expression corresponding to S is a little ambiguous, whereas the
linguistic expression corresponding to K - C does not contain any ambiguity.
Perhaps, Vasubandhus definition could have been improved upon by the addition
of the word eva, which would have meant that a perceptual cognition is that
which is determined by the object solely and exclusively. But Dinga thinks it
better to put the definition negatively so as to avoid any scope for ambiguity.
However, it must be made clear that Dinga does not reject Vasubandhus
definition but only brings out its implication in clearer terms. A perceptual
cognition is solely determined by its object; it must be wholly given by the object
and not in any way constructed by the mind. Thus, Dinga specifies that it is a
cognition that is not at all subjectively determined and conceived of in terms of
the vikalpas (concepts and words) of the type of dravya (substance), g u m (quality),
karma (action), jdti (class), and naina (words). What is perceived by us is unique
individual, which is bare existence, devoid of all characterizations. It is just what
is immediately given to us in experience. Concepts and words are common
(smnyalaksana) to several objects, and they are not unique (svalaksana). From
this it follows that, according to Dinga, perceptual cognition is the immediately
given sensum in complete isolation from all conceptual determinations.
29
PERCEPTION AS DISTINCT FROM ERRONEOUS COGNITION,

INFERENCE, AND SO ON
One of the objectives of Dinnaga, as stated before, in defining perception
has been to distinguish it in clear terms from erroneous cognition, cognition
of apparent reality, inference, its result, recollection, and desire, which are not
perception because they are not immediate on account of being vitiated by
obscurity . 6 Explaining this, Dinnaga writes in the auto-commentary (sva-vrtti)
that erroneous cognition is not perception because it arises due to conceptual
construction, for example, the cognition of water in a mirage. Cognition of apparent
reality is not a true perception, which is only empirically true. Inference and its
resultant cognition and so on are not perception because they superimpose
something extraneous upon things because they arise through the conceptualization
of what formerly has been perceived . 7
WHY THE NAME PRATYAKSA AND NOT PRATIVISAYA1

Perceptual cognition arises when an object gives rise to its reflex
(p ra tib hasa) in the cognizing consciousness through the senses. Here
Dinnaga poses a problem: For what reason then is it called pratyaksa and not
prativisaya, despite the fact that it is dependent upon both . 8 To this he replies
that it is named after the senseorgans, because they are its specific cause. The
object is only a common cause because it is common to many cases insofar as it
is a cause of similar perceptions in ones own self as well as in other persons. In
fact, this problem is earlier posed by Vasubandhu, 9 who gives two reasons, of
which Dinnaga mentions only one. The other reason is that as the cognitive sense
is strong or weak, perception becomes clear or dim, and because of this, sense
organs should be regarded as the specific cause of perception.
From this account it is quite evident that Dinnaga is the first systematic
exponent of the theory that perception is strictly indeterminate (nirvikalpaka)
and excludes all conceptual constructions and verbalizations (vikalpas).
However, for him, every perception has to be nonerroneous (abhrdntam)
because all errors are consequences of mental construction. At the level of
pure sense data there is no question of error because the sense data are wholly
given by the object, and there can be no error here. Error arises only when the
mental faculty comes to work upon the sense data. That is why he does not
include the term abhrdntam in his definition of perception, as his successor,
Dharmaklrti, has done. In the Nydyasutra of Gautama also, perception has been
characterized as avyabhicari (nonerroneous), but for Dinnaga vyabhicara (error)
just cannot be there at the level of sense data.
DEFINITION OF PRATYAKSA BY DHARMAKiRTI

After having stated that, there being two types of objects, there are two
kinds of knowledge, Dharmaklrti, following Dinnaga, defines pratyaksa as
kalpanapodham (nonconceptual) but, differing from Dinnaga, adds another
30
term, abhrantam (nonerroneous) to it. He defines it in terms of a cognition that is

free from conceptual constructions and errors. 1 0
Object of Pratyaka
Perception, according to Dharmaklrti, consists in the apprehension of an
object in its own specific character (,svalaksana), which has nothing in common
with other objects similar or dissimilar and is completely free from association
with names and verbal expressions, which are conceptual constructions. The
object of perception is thus the real, which is immediately revealed to the
consciousness and not such objects that are in the form of concepts and words
(vikalpas), which are not a part of the given sense data but are conceived in the
mind.
The object of perception is different not only from the objects that are in
the form of concepts and words but also from a bare figment of imagination.
The unique particular (svalaksana) alone is the real object, and, being the
real and efficient, it alone can produce a stimulus upon the senses. A figment
of imagination, on the other hand, is unreal and, therefore, cannot exercise
any such stimulus. Commenting on Dharm aklrtis opening remark in the
Nydya Bindu that all successful human action is preceded by right knowledge,
Dharmottara in the context of perception writes that when an object is apprehended
by direct experience, it gets converted into an object of purposive action through
sense perception. In fact, this characteristic feature of the real object distinguishes
it from all objects that are absolutely unreal and that have no practical efficiency
(arthakriydkdritva).11
We may now analyze the two terms, namely, kalpanapodham and
abhrantam, that constitute D harm aklrtis definition. By using the term
kalpanapodham, Dharmaklrti attempts to distinguish a perceptual cognition
from all such cognitions that are in the form of conceptual construction. He
defines kalpana as abhildpasciriisargayogyapratibhdsapratiti, 1 2 that is, a
determinate cognition that is capable of verbalization. In this definition there
are two aspects of kalpana that m ust be ex p licitly stated , nam ely,
pratibhasapratiti and "abhildpasamsargayogyata. Every kalpana is a
pratibhdsapratiti; that is, it is not just bare cognition (pratibhasa) but a determinate
cognition (pratibhasapratiti). To be aware of the bare existence of an object is
pratibhasa but to recognize that object as this object, a particular object, is
pratibhdsapratiti. The object is capable of giving rise to mental reflex (pratibhasa)
only. It cannot produce determination in the form of recognition that it is such
and such, because corresponding to the determination (pratiti) there is no object
present. The determination cannot be regarded as a part of perceptual cognition.
Thus, Dharmaklrti draws a clear-cut distinction between pratibhasa and pratibhasa
pratiti. The pratibhasa alone is genuine perception and not pratibhasa pratiti,
which follows pratibhasa. The pratibhdsapratiti is kalpana, which is paroksa
jhana or anum anaP The other apect of kalpana is abhildpasansargayogyata.
31
D harm aklrti points out that a pratibhasa is incapable of verbalization

(ianabhilapya ) , 14 whereas only a pratibhasapratiti can be expressed in language.
In other words, perception, which is pure sensation, is only to be experienced. It
cannot be designated. It is interesting to point out here that Dharmaklrti not only
draws a clear distinction between perceiving and designating but also regards
designating as absolutely incompatible with perceiving. His argument is that no
verbalization can take place in the absence of conceptualization and that there is
no conceptualization in perception. In the expression abhilapasarhsargayogya
the word yogya (capable) is quite significant. It clearly states that though it is
necessary that there cannot be verbalization without conceptualization, the reverse
is not the case. That is, it is not necessary that where there is conceptualization,
there must be verbalization. As Dharmottara writes, We may also have
conceptualization, which although not accompanied by corresponding words, is
capable of being accompanied, as for example, the conceptualization of a baby
which has not been verbalized . 1 5 Wherever there is verbalization, there has to
be conceptualization, but whether the reverse is also the case can be a debatable
point. It would, therefore, be in order if we reflect on the relation between
conceptualization and verbalization in the context of Dharmaklrtis position.
Following Dharmottara, it can be maintained that by inserting the word
"yogyaT Dharmaklrti wants to point out that it is not necessary .that every case of
conceptualization should be accompanied by verbalization. Every concept is
capable of being verbalized, but, in fact, it may or may not be verbalized. This
means only that verbalization is not incompatible with conceptualization in the
way in which it is incompatible with perception, but it is not its necessary
accompaniment. However, if we keep in view a verse generally ascribed to Dirinaga
in which concept is regarded as having its yoni (source or place of origin) in
words, 1 6 then Dharmaklrtis position can also be understood as signifying that
there are two modes of verbalization, namely, actual and potential. Though all
conceptualizations may not be associated with actual verbalization, potential
verbalization is necessarily present therein. Such a distinction between surface
language and depth language might have been intended by Dharmaklrti.
Accordingly, in every conceptualization there must be necessarily depth language,
which means that there can be no thinking without the use of language. The use
of language may not be overt but covert.
Besides kalpandpodham, the other constituent of Dharmaklrtis definition is
"abhrdntam . 1 7 Perceptual knowledge is that which is free from kalpana and at
the same time is abhrdntam. While explaining the term abhrdntam, he mentions
different instances of error caused by color blindness, rapid motion, traveling in
a boat, mental sickness, and so on. Commenting on it, Dharmottara writes that
absence of kalpana and absence of bhranti (error) taken together, not separately,
constitute the definition of perception. Dharmottara points out that these four
different illustrations represent four different types of illusion. The cause of
color blindness is located in the sense organ (indriyagata). The cause of rapid
32
motion resulting in the cognition of a fiery circle is located in the object

(visayagcita). The cause of illusion of moving trees is located in the external
circumstances that condition the perceiver (bhysrayasthita). Lastly, the cause
of hallucinatory illusions is located in the internal circumstances (adhytmagata)
like the mental state of the perceiver. All these causes, whether located in the
organ or in the object, whether external or internal, affect the cognitive sense 1 8
and result in illusory sensation. So, perception should be a sense cognition that
is distinct from these illusory sensations . 1 9 If we undertake a comparative analysis
of the definition of pratyaksa given by Dinga and Dharmaklrti, three basic
problems come up for our consideration. They are:
1.
2.
3.
Is pratyaksa a promana or samyag jna (knowledge)?

What is meant by kalpanl and
Is the adjective abhrntam necessary?
IS PRATYAKSA A PRAM NA ?
Both Dinga and Dharmaklrti, before giving a definition of pratyaksa,
point out that it is one of the two pramnas. Of course, in Dharmaklrti we find an
explicit and detailed analysis as to what is meant by prmnya or samyakatva
(truth), and no such detailed analysis is available in Dinga as far as our
information goes. It is, however, incontrovertible that both of them regard pratyaksa
as pram ana. However, in the context of their insistence on kalpanpodhatvam
(nonconceptuality of pratyaksa), it can really be asked whether they can justifiably
regard pratyaksa as a pramna. Sntaraksita 2 0 defines perception exactly on the
pattern of Dharmaklrti without using the word jnarn or pramnam, and there
Kamalaslla, his commentator, raises a point as to why the word jnarn is not
used in this definition. Does it in any way mean that Sntaraksita intends to
exclude pratyaksa from the sphere of jnarn? To this Kamalaslla responds by
saying that the word jnarn is not used in the definition because it is implied and
therefore not needed. However, it can certainly be inquired as to whether pratyaksa,
as it is defined by these Buddhist thinkers, can be a pramna, and if it can be,
then in what sense? An answer to this question depends on our understanding of
pramna. If by pramna we mean just the presence of avisamvdakatvam without
there being any necessary awareness or confirmation of it (<asamdigdhatvam),
pratyaksa can be regarded as pramna because it is having avisamvdakatva
with its object insofar as it is exclusively determined by the object (arthaniyata)
and is of the same form as the form of the object (arthasrpya). But if pramna
is understood in terms of avisariivdakatvam and asairidigdhatvam, that is, a
cognition that is true and also indubitable, then, certainly, pratyaksa cannot be
regarded as a pramna because indubitability or certainty is something that is
dependent on confirmation or on the production of some invincible grounds.
This would mean that only a vyavasytmaka (judgmental) or savikalpaka jna
(conceptual) can be a pramna, and since pratyaksa by its very definition is
33
nonconceptual, it cannot be put under the rubric of pramana. But as we have

said, if indubitability is not to be regarded as an essential element of pramana,
then the pramanatva of pratyaksa becomes a matter of analytic consequence.
WHAT IS KALPANA?
The other point that arises for consideration is understanding the word
kalpana by Dinnaga and Dharmaklrti. Since Dinnaga uses the expression
ndmajdtyadiyojand to define kalpana, whereas Dharmaklrti uses the expression
abhildpasarrisargayogyapratibhdsapratiti for this purpose, it has to be examined
whether both of them are using the word kalpana in the same sense or in two
different senses. In other words, what needs to be explained is the meaning of
kalpana according to Dinnaga and Dharmaklrti. When Dinnaga defmes kalpana
as ndmajdtyadiyojand, the question arises whether it is to be understood as
yojana (association) of nama, ja ti, and so on with things or association of nama
with jati, and so on. If it is understood in the former sense, then it goes against
Dirinagas basic position that the thing (svalaksana) is beyond all associations.
Evidently, therefore, it is to be understood only in the latter sense, 2 1 as has been
explicitly stated by Santaraksita. 2 2 Understood in this sense, there does not seem
to be any difference of opinion between D innagas and D harm ak lrtis
understanding of kalpana. Santaraksita defmes kalpana as abhilapinipratlti on
the pattern of Dharmaklrti but takes elaborate pains to point out that it does not
go against Dinnagas definition given in the Nydya M ukhaP
IS THE ADJECTIVE ABHRANTAM NECESSARY?

The necessity of mentioning the characteristic of abhrantam has been
controversial right from the time of Dinnaga. It is first mentioned by Asanga, is
dropped by Dinnaga, but is reintroduced by Dharmaklrti. It is again dropped by
some of his followers like Vinltadeva but finally reestablished by Dharmottara.
However, it must be noted that Dinnaga is not alone in not using the adjective
abhrantam. As Santaraksita points out, several Buddhist thinkers regard illusions
as purely mental facts having nothing to do with sense perception. These thinkers
object to the inclusion of the adjective abhrantam in the definition of
pratyaksa .24
Why Dinnaga dropped the characteristic abhrantam is not known for
certain, but Stcherbatsky 2 5 has pointed out three considerations that seem
to be quite plausible. First of all, every illusory cognition has to be judgmental,
but no judgm entalization belongs to the sensuous part of the cognition.
Every judgment is the construct of the intellect and not the reflex of the
senses. D innaga m aintains that pure sensation does not contain any
judgment, neither the right one nor the wrong one, because it is nonconceptual.
It cannot contain any illusion at all, and hence there is no need to add the adjective
abhrantam. However, this doesnt mean that perceptual cognition is not a
pram ana because for him pram ana consists only in arthasdrupya or
avisaihvadakatva and not in asamdigdhatva.
34
Second, Dinnaga rejects Vasubandhus definition of pratyaksa because it

could be given a realistic interpretation. For the same reason he resolves to drop
the characteristic of abhrdntam because it could be interpreted as maintaining a
position that all conceptual knowledge is erroneous and that perceptual knowledge
alone is nonerroneous.
Third, Dinnaga is aware of the ambiguity of the word abhrdntam, and
to avoid confusion, he must have dropped it. Dinnaga, of course, doesnt deny
that there are illusions, but they must be treated separately. Just as there are
inferential fallacies, hetvabhasas, similarly there can be pratyaksdbhdsas, but
these pratyaksdbhdsas are due not to the senses but to the intellect only.
Dharmaklrti disagrees with Dinnaga on this point and reintroduces the
characteristic of abhrdntam in the definition. His main argument is that we
must distinguish between sense illusion and mental illusion. For example,
when we mistake a rope for a snake, the illusion is purely mental and ceases
when it is dispelled. But when we see the moving moon in the clouds, this
illusion continues even if we are convinced that it is the clouds that are
moving.
While explaining Dharmaklrtis contention, Dharmottara points out that
the purpose of using the two characteristics is not just to distinguish pratyaksa
from anumana but also to clear away wrong cognition . 2 6 The characteristic of
kalpandpodham would alone have been quite sufficient for that but if abhrdntam
were not added, erroneous cognitions, like that of a moving tree, that are not
faulty mental constructs but are due to sensual aberrations would not be
distinguished from genuine perception. Therefore, Dharmottara insists that the
introduction of abhrdntam is perfectly in order.
In this context Dharmottara writes that the term abhrdntam should not
be understood in the sense of avisamvadakam because this would imply that
perception alone is avisamvadaka and not anumana because anumana doesnt
represent svalaksana. Had it been Dharmaklrtis intention to maintain that pratyaksa
alone is avisamvadaka and not anumana, the term kalpandpodham would
have been sufficient for that because all kalpana would be visamvadaka. But that
doesnt seem to be the case. For Dharmaklrti both pratyaksa. and anumana are
avisamvadaka in the sense that both are consistent with their respective objects,
namely, svalaksana and samdnyalaksana.
Santaraksita and Kamalaslla defend Dharmaklrti and argue at length to
establish that illusions occur due to sensual aberrations also, and they are
not just to be explained as mental distortions. Ultimately, all illusions can be
traced to a defect in the sense organ concerned, and if the illusions were
not due to this defect and were due to mental aberrations, they would have
disappeared when the mental distortion is rectified. Not only this, but the vivid
presentation of false objects in illusions cannot be satisfactorily explained unless
they are regarded as sensual presentations. 2 7
Dharmottara explicitly mentions that there were some thinkers among
Buddhists themselves who maintain that even these abnormal experiences are to
35
be regarded as valid knowledge inasmuch as they satisfy the pragmatic tests. He

writes, There are some who maintain that the vision of a moving tree by an
observer traveling by ship and similar perceptions are right perceptions because
there is in this case an underlying reality which is not a construction. Indeed a
man acting upon such a perception reaches something which is a tree; hence it is
supposed that experience supports his perception . 2 8
Similarly, Santaraksita also writes that because of a successful outcome even
in erroneous cognition some people maintained that erroneous cognition should
also be regarded as valid . 2 9 While commenting on this, Kamalaslla explains that
some people, in fact, means some Buddhist thinkers themselves. 3 0
Both Dharmottara and Santaraksita point out that what constitutes validity is
not pragmatic fitness alone but that plus consistency (iavisamvadakam) with reality.
So such presentations, as the light of the jewel for the jewel itself or of yellow
conch shell for a really white conch shell or of moving trees for trees that are
really stationary are not valid perceptions, though there is actual verification.
Mere verification and pragmatic satisfaction cannot, however, be accepted as the
test of validity; but consistency of presentation with reality is the criterion. What
is presented is the light of the jewel or the yellow conch shell and what is actually
attained is not the light of the jewel or yellow conch shell but something different.
In the mirage, too, the refracted light of the sun and the determinate experience
of water are presented.
Having discussed the divergent views of the Buddhist logicians from Dinnaga
onward, we can while concluding restate our problem. Is not Dinnagas defmition
of perception as kalpanapodham complete and sufficient by itself? It seems that
addition of the adjective abhrantam is not logically necessary. Probably,
Dharmaklrti thought that the term kalpanapodham is competent only to
distinguish pratyaksa from anumana but not from bhranta jiidna. But here we
can question and perhaps reject Dharmaklrtis contention and uphold Dinnagas
position on the following grounds.
Indeed, sense perception can be reckoned as a source of knowledge
(pram ana) only under the condition that the knowledge produced by a
sensation does not represent the sensory illusion. However, it seems quite
superfluous to m ention abhrantam as characteristic of valid sense
perception, because, according to the classification of the system, sense
perception is a variety of valid, that is, nonillusive, cognition.
The term abhrantam is almost a synonym of kalpanapodham since
construction represents illusion when compared with pure sensation, the
genuine source of knowledge. So it becomes useless to use the synonym
in the defmition.
A question may arise, How can we have erroneous cognition at the level of
perception? Perception being nirvikalpaka, we have just the sensations of the
object, and no judgment is formed at that stage. Only judgment can be right or
wrong. For example, A enters a room with a friend of his, and there is a rope
lying in the room. Mistaking this rope for a snake, A cries, Snake
36
The friend says, No, it is merely a rope. Thus, the perception of the same
object, rope, has resulted in two different mental constructs. The rope must have
given the same kind of sensation to both of them, but the first one thought it was
a snake, and the second one thought it rightly to be a rope. So, mental construct
results in illusion, not bare perception. For distinguishing mental construct from
perception Dinnagas definition is competent enough, and there is no need to add
the adjective abhrdntam to it.
Dharmaklrti, on one hand, believes in sensual aberrations and, with a view
to exclude these from the category of perception, includes the term abhrdntam,
but, on the other hand, he strongly advocates the theory of svataJi-pramanyavdda,
according to which all cognitions qua cognitions must be true. This fact cannot
be overlooked. At the level of sensation there is no error. From this it follows that
errors are due to noncognitive factors, that is, factors extraneous to sensation.
Hence, the addition of the adjective abhrdntam seems to be useless.
NATURE OF PRATYAKSA
All the epistemological thinkers in India are unanimous in regardingpratyaksa
as a reliable and valid cognition, but there exists a wide difference of opinion
with regard to its precise nature. Ordinarily granting a basic distinction between
two types of cognition, nirvikalpaka (indeterminate) and savikalpaka (determinate),
it has been debated as to whether pratyaksa is to be regarded as nirvikalpaka
only or savikalpaka only or both nirvikalpaka and savikalpaka. The Grammarian
philosophers and the Jaina thinkers take one extreme view that all cognitions,
including perceptual ones, are savikalpaka since they are predicative in character
and also necessarily embodied in verbal propositions overt or covert. The Buddhist
position lies on the other extreme, that pratyaksa is always nirvikalpaka and can
never be savikalpaka. Amimana alone is savikalpaka. Before we discuss the
Buddhist position in detail, it would be worthwhile if we briefly outline the
conflicting non Buddhist positions on this issue.
Advaita Vedantic View

In the Advaita-Vedanta, particularly in its earlier phase, we seem to have a
position akin to the Buddhist one, which is arrived at on a slightly different basis.
According to it, the reality being of the nature of pure existence bereft of all
characterizations (s'uddha or nirvisesa sanmatram), the perceptual cognition that
is in the form of presentation of an object must be nirvikalpaka. It is a cognition
of this or the existent but not as determined by anything. To determine a
thing is to characterize it by this or that quality and is thus to distinguish it from
other things having different qualities. All this is the work of buddhi. When we
have a determinate cognition of an object on the basis of discrimination, the
object is determined by certain qualities and relations. Such a cognition, which is
ordinarily called savikalpaka pratyaksa, is not valid (mithya) because it is no
longer representative of the object, which in the ultimate analysis is one
undifferentiated consciousness (caitanya). The Neo-Advaita Vedanta, however,
37
accepts a distinction between nirvikalpaka and savikalpaka pratyaksa from the

vydvahdrika or practical standpoint, though from the pdramdrthika standpoint
such a distinction is untenable. According to it, savikalpaka pratyaksa is the
knowledge of a thing as qualified by an attribute. The essence of savikalpaka
pratyaksa is the determination of its object by way of predication. On the other
hand, nirvikalpaka pratyaksa is knowledge of the bare existence of a thing without
any predication. Strictly speaking, propositions like Tattvamasi alone can be
regarded as genuine nirvikalpaka pratyaksa. Through "'jahat-ajahat-laksana
such propositions are to be understood as conveying the simple identity between
tat and tvam. Such propositions, technically known as akhandartha vakya,
are nonpredicative in character. For example, when we say This is that m an,
we do not predicate that man to this. It is not a case that we relate this
m an with that man but simply assert the identity between the two . 3 1
Grammarians View
Grammarians go to the other extreme, and in this Jainas join them in
maintaining that all perceptions are savikalpaka because they are necessarily
predicative in character and verbalized in form. Not only perception but every
cognition, perceptual or nonperceptual, has to be both propositional as well as
sentential. In other words, they maintain that the epistemic content and the linguistic
form are always inseparable, and all propositions are invariably linguistic in
form. There is no pure thinking, but speech thinking. In the words of Bhartrhari,
a Grammarian philosopher, There is no thought-content without a language
form and always thought-content is inextricably interspersed with language form.
If the unfailing form of language had been lost to the thought-content, thought
itself would have been lost in oblivion. Thought has a form because it is formed
in language. 3 2
From this it follows that all cognitions, including perceptual ones, are at
once both judgmental and verbal. A corollary of this would be that perception
can never be nirvikalpaka but should always be savikalpaka.
Nyaya-Mmiamsa-Samkhya-Visistadvaita Vedanta Views

In the schools of Nyaya, Mimamsa, Samkhya, and Visistadvaita Vedanta,
the preceding two extreme views are reconciled, and a middle position is put
forth. It is held in these schools that any perception, nirvikalpaka or savikalpaka,
is a direct cognition of a real individual that is a unity of universal and particular.
The distinction between nirvikalpaka and savikalpaka is due not to any difference
in the contents of perception but to the way in which the same contents of experience
may be ordered and arranged.
The Samkhya thinkers perhaps initially advocated a distinction between two
stages in perceptual cognition, namely, nirvikalpaka and savikalpaka, and used
the term alocana (Gestalt view) for nirvikalpaka pratyaksa. The first
apprehension of an object is in the form of undifferentiated sensum, and the
manas is samkalpaka, that is, differentiates the undifferentiated sensum presented
by the senses. While commenting on the Samkhya Karika Vacaspatimisra, in his
38
Sathkhya Tattva Kaumudi, introduces a full-fledged distinction between the two

kinds of perception . 3 3
Kumarila of the Purva-Mlmamsa school seems to follow the Samkhya line.
For him the nirvikalpaka pratyaksa is the first moment of cognition in which
there is an undifferentiated apprehension of the object as one individual whole of
generic and specific attributes (sammugdhavastumdtra). Here there is no definite
cognition of it as this or that object (vastu visesa). Nirvikalpaka pratyaksa thus
resembles childrens and dumb persons perceptions . 3 4 It is nonverbal in nature
because they lack the capacity to communicate. However, Kumarilas position
can also be understood in a different manner, if we take into consideration the
following verse and Parthasarathis commentary thereon.
Na vis'eso na sdmdtxyam tadanim anubhuyate
Tayoradhdrabhiitastn vyaktirevavasisyate.
(In that apprehension neither the particular nor the universal is experienced.
What is experienced is only the individual object that underlies the two) . 3 5
That is, he regards nirvikalpaka pratyaksa as a sort of inchoate cognition in
which neither the particular nor the generalized aspect is cognized; nor are they
distinguished. Whatever is the interpretation of Kumarilas position, for him it is
indeterminate or nonconceptual and therefore nonverbal. The second stage is
that of savikalpaka pratyaksa, which is a determinate cognition in which the
object is cognized by the mind along with its characterizations.
Like the Samkhya and Mlmamsa thinkers, Nyaya-Vaisesika thinkers also
accept both stages of perception, and most of them regard them as equally valid.
From Vacaspati onward we find a clear-cut distinction between the two stages of
pratyaksa. On the distinction between nirvikalpaka and savikalpaka Jayanta writes,
A universal, a substance, a relation or a quality whatever essence of an object is
grasped by savikalpaka is equally grasped by nirvikalpaka. The remembrance of
a meaning-relation of the object with a certain word is the only relation that
marks out savikalpaka from nirvikalpaka. So far as the object is concerned there
is not the least difference between the two. 3 6 From this statement the only thing
we can distinctly make out is that for some Naiyayikas, the distinction between
nirvikalpaka and savikalpaka is only in verbality. The savikalpaka is verbalized
and predicational, whereas nirvikalpaka is nonverbalized and nonpredicational.
So in the nirvikalpaka we apprehend the object along with all its relations and
characterizations, but we do not interrelate them (vaisistyanavagahi), and in
savikalpaka we do so. In the Navya-Nyaya, the distinction between the two is
more sharply drawn as compared to Jayanta. However, the consequence of such
a sharpness has been some sort of rethinking on the nature of pratyaksa in the
Navya-Nyaya. Visvanatha, in the Bhasd-Pariccheda and Siddhdnta-Muktdvali, is
unwilling to accept nirvikalpaka within the fold of pratyaksa since it is a kind of
prejudgmental cognition . 3 7
In the Visistadvaita Vedanta, even though the distinction between nirvikalpaka
and savikalpaka is accepted, the two are regarded as different quantitatively.
Both are predicative and relational in character, but whereas the first one is vague
39
and indefinite, the second one is vivid and definite. The first is the initial awareness
(prathama pindagrahand) of the object. It is about the total object in which the
individual as well as the universal aspects of the object are apprehended in their
interrelationship, but there is no complete certainty. In the second or successive
apprehensions the judgm ent becomes decisive and is therefore known as
savikalpaka. Ramanuja understands savikalpaka not in terms of judgmentalization
but in terms of more decisiveness or certainty.
Buddhist View
As against Grammarians, on one hand, and Naiyayika, Mlmamsaka, and
Samkhya thinkers, on the other, Buddhist thinkers insist on perception being
nirvikalpaka. A clear-cut distinction between nirvikalpaka jnana and savikalpaka
jnana seems to have been introduced for the first time by Dinnaga. According to
him, the difference between nirvikalpaka and savikalpaka is not just quantitative,
a difference in vividness and sequence, but is fundamental and qualitative. The
nirvikalpaka jnana is a cognition of an object-qua-object that can be only in the
form of pure awareness and that can never be in the form of awareness in terms of
thought. The reason is that our thought can never grasp the object-qua-object
that is in the form of svalaksana because our thought is always restricted to
samanya laksana. It is thus clear that the two types of knowledge are quite different
not only in their nature but also in the spheres of their operation.
While defining pratyaksa, thinkers from Dinnaga onward always insist on its
being kalpanapodha. Kalpana stands for both thought and speech, and, therefore,
the phrase ttkalpandpodham,>implies two things: ( 1 ) it is nonconceptual, and
(2 ) it is nonverbal.
Buddhists start with a dichotomous distinction between a knowledge that is
perceptual and a knowledge that is nonperceptual, that is, conceptual. From this
it follows that perceptual cognition cannot be conceptual cognition, and conceptual
cognition cannot be perceptual cognition. The nonconceptuality of perception
means its freedom from all mental conceptions. In other words, all conceptual
contents are mind-given, and mental impositions, whereas perception is given by
the object and not at all by the mind. Dinnaga3 8 quotes an Abhidhammz treatise
in his support where it is stated that one who has ability to perceive, perceives
something blue (Nilam vijdnati), but it is not conceived that this is blue (Nllamiti
vijdnati). The expression Nllam vijanatr implies that one has an immediate
awareness of the object itself. On the other hand, Nilamiti vijanatr implies that
one forms a judgment based on perception by associating a name with the object
perceived. Thus,, the preceding passage expresses the idea that perception is free
from conceptual construction. In other words, in respect of an object the perceiver
has a sensation of the object but does not possess any conceptual awareness of it.
There are two things we mean when we say that perception is nirvikalpaka:
1. (a)
In all perceptions we never perceive the universal or the universal qualifying the
40
(b)
2.
individual. Thus, we always perceive an individual, the svalaksana, and nothing

more than that because individual is absolutely bereft of all universals. At the level
of svalaksana there are no qualifications, and Buddhists are quite vehement in
their rejection of dharma-dharmi bheda (substance-attribute relationship) because
in perception there is no apprehension of qualities and thus there is no determination
and so on. For example, X is an object, and if X is indeterminate then P as
the knowledge of X should also be indeterminate because only then can
knowledge be in agreement with its object. If P is determinate, then it would
mean that it is not given by the object alone because the object has no determination
and cannot cause any determination. Consequently, it will be in discrepancy with
the object. If the perceived object is indeterminate, its knowledge has also to be
indeterminate.
Every svalaksana that alone is the object of perceptual cognition is instantaneous
and does not endure for the next moment. Every svalaksana, being momentary,
cannot be perceived twice, and therefore every perception is different from another
perception. Like svalaksana, every perception is unique (svatovydvartaka).
There is another sense in which perception is nonconceptual. The conceptual
cognition (savikalpaka jndna) is always vaisistydvagdlii jndna (predicative cognition)
and samsargdvagdhi jndna (relational cognition). In other words, it has to be
propositional. Every proposition is a mental construct, and without mental
construction there cannot be any formulation of a proposition. Thus, a perceptual
cognition is nonpropositional. Though in itself it is nonpropositional, on the basis
of it one can formulate a proposition. In this sense it can be regarded as
prepropositional. But the moment prepropositional perceptual cognition is
transformed into a proposition, that is, conceptualized, it ceases to be perception.
To be conceptual is to be nonperceptual.
There has been a broad agreement among Indian epistemological thinkers that no
determinate knowledge is possible without a language. Buddhists also fall in line
with this. Though all determinate knowledge is linguistic, not all knowledge is
linguistic. Perceptual knowledge that is indeterminate is nonlinguistic because it
does not require the help of language and also because it is beyond the reach of
language. The nonverbality of nirvikalpaka pratyaksa is put forth by NyayaMlmamsa thinkers, perhaps on the first ground rather than on the second, but for
Buddhists the second ground is more significant than the first one. Pratyaksa is
anabhildpya (inexpressible in language) not only because it does not require the
help of language but mainly because it is determined by the object (svalaksana),
which is beyond the reach of language.
Buddhists put forth vigorous effort to defend their position vis-a-vis the nonBuddhist ones. We may here present in brief the Buddhist arguments for the
rejection of the non-Buddhist positions, which can be broadly represented into
three, namely, the Nyaya-Vais'esika, the Jaina, and the Mlmamsaka.
Refutation of Nyaya Position

In the Nyaya tradition from Vacaspatimis'ra onward we have a clear-cut
distinction between two stages of perception and hence of two types of perceptual
cognition. The Buddhists accept nirvikalpaka alone as pratyaksa, and therefore
they would deny that there are two stages or types of pratyaksa in the form of
41
nirvikalpaka and savikalpaka. The main argument put forth by the Buddhists for
nonacceptance of pratyaksa as savikalpaka is that all determinate perception is
capable of being verbalized, and if perception is to be defined in terms of
kalpanapodha or in terms of artha-pradatta (being caused by the object), then it
can never be associated with verbal expression. A cognition that is in the form of
apprehension of an object (pratibhasa) can never be associated with verbal
expression because neither are there words present in the object, nor are the
words identical with the object . 3 9 If it were so, a person ignorant of the meaning
of the words would also be capable of communicating through words like the
person who knows their meaning. In other words, to cognize is one thing, and to
designate is another. The cognizing function is not identical with the designating
function, nor is the designating function inseparably associated with the cognizing
function. Therefore, a cognition produced by the object should present only the
object and not the word, which is wrongly supposed to be denotative of the
object. From this it follows that a determinate knowledge that is a mental
construction is erroneously held to be a true perception. Determinate knowledge
presents an object as associated with a word (abhilapa), although in reality the
object is independent of any association with a word. Determinate knowledge is
caused by the past mental impression (vikalpa-vasana), and it grasps an uncertain
(.aniyata) object, not a fixed one. It differs with every individual because it is not
a real object and is caused by the past mental impression. The function of mental
impression is always concealed in a determinate knowledge, but since that
knowledge follows in the wake of perception, it usurps the function of the latter,
and because of this determinate knowledge is mistakenly supposed to be perceptual.
The other argument put forth by Buddhists is that the determinate knowledge
is always in predicative form in which something is predicated to something
(vis'istavais'istydvagahi jnana). Thus, it is always predicative of a qualifier-qualified
relationship. According to Buddhists, first, there is no qualifier-qualified
relationship existing between the objects (svalaksanas), and second, even if such
a relation is objective, one single perceptual cognition cannot apprehend two
objects with their interrelation because it is essentially simple in character and
cannot be complex.
Refutation of Rumanias Position

Santaraksita4 0 undertakes an elaborate examination of Kumarilas view that
there are two stages, namely, nirvikalpaka and savikalpaka, necessarily involved
in perceptual cognition. His main objection is regarding perception as determinate
cognition. If in a perceptual knowledge both the qualifier and the qualified, the
individual and the universal, are apprehended, then the question is, How can this
be possible in a single act of perception? Even granting that universal is
perceptually apprehended, when universal is apprehended, individual is not
apprehended, and when individual is apprehended, universal is not apprehended.
One and the same cognition cannot apprehend both. Then how can a determinate
42
perceptual knowledge be possible? Further, if it is maintained that in the

indeterminate cognition itself both the individual and universal are apprehended,
then what is left to be apprehended at the determinate level? As a matter of fact,
universals and so on do not exist either as different or nondifferent from the
individuals. Nor can they be both different and identical.
Refutation of the Jaina Position:

The position that every cognition, let alone a perceptual one, has to be
determinate is based on the argument that every object is twofold in character,
namely, the individual and the universal, and one cannot know an object without
at the same time cognizing both its aspects. If an object is not apprehended along
with its differential character, then there will be no difference between one
cognition and another cognition, and the cognition of pen will be the same as the
cognition of paper. The assertion that a cognition apprehends a qualified thing
and yet is not conceptual will be self-contradiction. Thus, the Jaina argument is
that to cognize is to cognize a thing with its differential character, which means
it has to be a determinate cognition.
To this Santaraksitas4 1 reply is that it is one thing to apprehend a qualified
thing, and it is an altogether different thing to say that a thing is associated with
qualifications. A thing can never be associated with qualifications because by its
very nature everything is a unique particular, but every particular thing is different
from another thing, and this fact of being different from enables us to distinguish
one perception from the other perception. Every perception is a negation of all
things other than itself, and this accounts for the differentiation from the rest. In
fact, all perceptual cognitions are unique and distinct just as their objects are
unique and distinct, but the awareness of their distinction is conceptual, and this
awareness, which is conceptual, is certainly not perceptual. The perceptual leads
to conceptual, but perceptual itself is not conceptual. From the preceding analysis
Buddhists conclude that all cognitions concerning svalaksanas have to be
compatible with the nature of the svalaksanas. The svalaksanas are devoid of all
characterizations, and therefore their perceptual cognition also has to be devoid
of all characterizations.
On the basis of the foregoing analysis of the Buddhist and non-Buddhist
positions on the nature of pratyaksa, we can restate the Buddhist position
consistently and unambiguously put forth by Vasubandhu, Dirinaga, Dharmaklrti,
and so on as follows:
1.
2.
Pratyaksa can never be conceptual or determinate (savikalpaka) mainly because it is

exclusively determined by the object, which is free from all determinations and
characterizations.
Nor can perceptual cognition be both indeterminate as well as determinate or perceptual
as well as conceptual, mainly because perceptual and conceptual are mutually exclusive.
A perceptual can never be conceptual, and a conceptual can never be perceptual.
This does not mean that a perceptual cognition has nothing to do with a conceptual
43
one. Though in itself it is nonconceptual, it may give rise to conceptual cognition and
thus may becom e preconceptual. But a cognition remains perceptual only insofar as
it is nonconceptual and ceases to be so the moment it gives rise to conceptualization.
TYPES O F PRATYAK SA
All Buddhist thinkers of the Vijnanavada tradition from Vasubandhu onward
are unanimous in insisting that pratyaksa is nirvikalpaka and hence kalpanapodha.
Thus, the differential character of every perceptual cognition is to be free from
all conceptual constructions. In this respect they are all alike, and they are not to
be classified under different heads. However, as Dinnaga4 2 points out, they can
be classified if such a classification is asked for. Though we have a rough
classification of different types of pratyaksa in the Pramana Samuccaya, a precise
and clear classification is available only in Dharmaklrtis works. Perhaps, Dinnaga
is more concerned about giving a precise definition of pratyaksa rather than
about the different types of pratyaksa. For him classification of pratyaksa is
logically not significant. However, there was a prevalent practice in philosophical
circles to discuss types of pratyaksa. Dinnaga refers to it, but Dharmaklrti feels
a need to expound the Buddhist position on the classification of pratyaksa in
clear-cut terms.
D innagas Classification of Pratyaksa
Having stated that all perceptual cognitions are alike so far as they are free
from conceptual constructions, Dinnaga points out that they can be classified
into indriyapratyaksa (sense perception), manasapratyaksa (mental perception),
svasamvedana pratyaksa (selfcognition), and yogi pratyaksa (mystic perception).
1. Indriya pratyakya. So far as the indriya pratyaksa is concerned, it is in
the form of sensations caused by an external object. Since there are five kinds of
cognitive senses, we can talk of five types of indriya pratyaksa.
2. M anasa pratyaksa . 4 3 Besides indriya pratyaksa there is also manasa
pratyaksa, which consists of the awareness of indriya pratyaksa.
3. Svasamvedana pratyaksa. The third type of pratyaksa is the immediate
experience of both indriya pratyaksa and manasa pratyaksa.
The concept of svasamvedana has been one of the most significant
contributions of Dinnaga, and its implications in the context of prdmanyavada
have been worked out while discussing sdrupya. The scope of svasamvedana has
been enlarged by Dinnaga to include the awareness of conceptual constructions
also. In his own words, Even conceptual construction when it is brought to
internal awareness is to be regarded as a type of pratyaksa (kalpandpi
svasamvittavistd ) . > 4 4 It is interesting to note here that, according to Dinnaga,
each cognition has a twofold appearance: the appearance of an object (arthabhasa)
and that of itself (svabhdsa). As such, cognition cognizes itself while cognizing
an object. The cognizing of an object through kalpand is ammana, not pratyaksa.
44
But whether it is anumana or pratyaksa, the essential nature of cognition is the

same; that is, it is self-cognized (sva-prakas'aka).
4.
Yogipratyaksa. Besides the previous three, the fourth type of pratyaksa
accepted by Dinnaga is yogi pratyaksa. The intuitions apprehended by a yogi are
also nonconceptual and hence are to be placed under pratyaksa. Here Dinnaga
draws a distinction between a yogi jnana and agama jnana. The cognition derived
from the agama (scripture) is kalpana, but the yogi jnana is not so . 4 5
D harm aklrtis Classification of Pratyaksa
When we come to Dharmaklrti, we find that the problem of types of pratyaksa
seems to have been crystallized. Both in the Nyaya Bindu and in the Pramana
Vdrtika we have clear statements that pratyaksa is of four types, namely, indriya
pratyaksa, tndnasa pratyaksa, svasamvedana pratyaksa, and yogi pratyaksa.
1. Indriya pratyaksa. So far as the indriya pratyaksa is concerned, it is the
most primary and at the same time the most pervasive type of pratyaksa. Such a
knowledge consists in presentation of an object to consciousness through the
medium of senses. The cognitive senses being five in number, it can further be
classified under five heads. This fivefold classification is based on the different
cognitive senses, which serve as a medium. The cognitive senses are only a
medium, not an agent. Their function consists only in creating a sort of link
between the subjective consciousness and the objective reality lying outside. This
function is over when the object is presented to consciousness and does not
continue thereafter. Since in the Buddhist tradition perception has been defmed
as nonverbal, a question arises as to whether there can be anything like auditory
perception. The question is based on an assumption that an auditory perception
that cognizes word cannot be free from word association, and if wordassociation
is kalpana and not pratyaksa, how can auditory perception be a genuine perception?
Moreover, like light and consciousness, a word has a dual function of revealing
itself and revealing its object. Because of this also an auditory perception must be
associated with verbal expression. The answer given by Dharmottara 4 6 and
Santaraksita4 7 is that when a word is cognized, it is not the same word that is
expressive of some concept. It is cognized only as a sound, which is svalaksana
and which does not have the previously referred- to double character. Even if no
distinction is drawn between a sound and a word, the object of auditory perception
is said to be having the twofold character. In auditory perception we are concerned
only with its first character, namely, sound, and only in a conceptual cognition
are we concerned with its second character, namely, meaning . 4 8
2. M anasa pratyaksa (M ano vijnana). The second type of pratyaksa
accepted by Dharmaklrti is manasa pratyaksa. It is a pratyaksa that immediately
follows the indriya pratyaksa. It is, in fact, the element of attention when an
indriya pratyaksa arises. That is why Dharmaklrti in the Nyaya Bindu 4 9 defmes it
as mental sensation which follows sense perception, which is its immediately
preceding homogeneous cause. The manaspratyaksa is generated by the indriya
pratyaksa, which acts as its immediately preceding homogeneous cause . 5 0 If
45
manasapratyaksa is to be regarded as different from, and as an effect of, indriya

pratyaksa, then a question arises as to what its object is. Does it grasp the same
object that is already grasped by the concerned indriya pratyaksa? If it does, then
it will not be a valid cognition because it will no longer be ajnatarthaprakdsa
(awareness of an object not hitherto known). On the other hand, if it grasps what
is altogether ungrasped by the concerned indriya pratyaksa, then any manasa
pratyaksa can be related to any indriya pratyaksa, or even the blind would perceive
color. 5 1 To this the reply given by Dharmaklrti and Dharmottara is that the objects
of the two are different, and yet the two perceptions are interconnected insofar as
the indriya pratyaksa along with its object gives rise to the manasa pratyaksa and
its corresponding object at the immediately succeeding moment . 5 2 This complex
phenomenon can be explained with the help of the diagram shown in Figure 2.1.
Figure 2.1
Process of M anasa Pratyaksa
Note: O t is indriya pratyaksa visaya; C ] is indriya pratyaksa;

0 2 is manasa pratyaksa visaya; C2 is manasa pratyaksa;
C ] is samanantara pratyaya of C2; 0 2 is alambana pratyaya of C 2
The need for the acceptance of manasa pratyaksa over and above indriya
pratyaksa can be questioned, and justification of its acceptance can be asked for.
To this Dharmottara replies that it is a necessary postulate of the system, and no
proof need be adduced for its postulation . 5 3 Stcherbatsky, 5 4 however, gives some
justification, which is not very unconvincing. He opines that after having made a
radical distinction between the role of indriya and kalpand, Buddhist thinkers are
in need of some connecting link between the two insofar as pratyaksa has to lead
to kalpand. This connecting link is established by postulating manasa pratyaksa.
There is some basis in Dharmottara for the suggestion given by Stcherbatsky.
Dharmottara argues that manasa pratyaksa has to be postulated as a link between
indriya pratyaksa and kalpand because indriya pratyaksa, being momentary, cannot
directly give rise to conceptualization unless and until it is first attended to in
consciousness, and if manasa pratyaksa is not accepted, not only will there be a
difficulty in accounting for a transition from indriya. pratyaksa to kalpand, but
there will also be a flaw of indriya pratyaksa being invalid because it will then
not have generative efficiency (<arthakriyakaritva). The manasa pratyaksa, which
is sensory on one side and mental on die other, has die psychological necessity in
46
order to link two heterogeneous types of knowledge, namely, perception and

conception.
In fact, the acceptance of manasa pratyaksa in the Dinnaga-Dharmakirtis
tradition can be traced back to the Abhidhamma literature, where we have a clear
acceptance of manovijndna and manovijndna dhatu in the list of seventy-five
categories into which the whole sphere of knowledge and reality is reduced. In
the Nyaya Bindu Tika Tippani55 it is stated that the conception o f manovijndna as
a type of pratyaksa was a necessary deduction from the import of a scriptural text
that declares, Color is cognised, O monks, by twofold cognition, the sense
perception and the mental perception induced by it. Another question may demand
our attention concerning the temporal location of indriya pratyaksa and manasa
pratyaksa. It can be asked whether some other indriya pratyaksa can operate
even at the time when we are having manasa pratyaksa in the second moment.
Both Dharmaklrti and Dharmottara reply to this view in the negative. They are of
the opinion that if the sense organ were to operate even at a time when we are
having manasa pratyaksa, there would be no indriya pratyaksa at all . 5 6 This
point has been further explained and elaborated in the Tippani like this: If we
assume that in the second moment the outer sense-organ is engaged just as it is
engaged in the first moment, then its function will also be the same, i.e., it will
make the object present in our ken. Why indeed should then sense-perception
not arise in the second moment also; why should not both the moments receive
the same name of sense-perception ? 5 7 Durvekas5 8 explanation of Dharmottaras
statement is as follows: The first moment of the cognition series is regarded as
dependent upon the sense organ because it is invariably concomitant with the
presence and absence of the sense organ. If even mental perception were to have
invariable concomitance with the presence and absence of the sense organ, this
could not be given as a reason to establish a cognition as sense perception, that
is, it cannot be called as sense perception on the ground that it depends on the
sense organ. So, even the first moment could not be established as sense perception
on the ground that it has invariable concomitance with the presence and absence
of the sense organ.
It is significant here to point out that the concept of manasa pratyaksa
advocated by Dinnaga and Dharmaklrti is altogether different from the concept
of manasa pratyaksa advocated by Nyaya-Vaisesika thinkers. In the Nyaya-Vaisesika
philosophy manasa pratyaksa stands for the perception of the qualities of the
self, but in the Buddhist tradition it stands for the mental perception caused by
the preceding sense perception. Though the object of manasa pratyaksa in the
Buddhist tradition is an internal one, nevertheless, it is caused jointly by the
external object and its sense perception. Nyaya-Vaisesika thinkers regard mind
as an antarendriya (internal sense), but for Buddhists of the Dinnaga-Dharmakirti
tradition mind is not an indriya; mind here stands for the consciousness (citta)
or, strictly speaking, a specific moment of consciousness.
3.
Svasamvedana. The third type of pratyaksa distinguished by Dharmaklr
is svasamvedana or dtmasamvedana. He defines it as Sarvam cittacaittdndm
47
atmasaihvedanam; that is, all consciousness, cognition (citta), and mental states
(caitta) are self-cognizing. Like Dinnaga, Dharmaklrti insists that differential
character of consciousness as opposed to matter is its self-awareness. Matter is
always to be known through consciousness, but consciousness can be known by
itself only. This theory is known as svayamprakdsavada, the self-luminosity theory
of consciousness, which is a distinct contribution of Dinnaga to epistemology.
The doctrine that every consciousness is also self-consciousness has been a
fundamental tenet of the Dinnaga-Dharmaklrti tradition. Every cognition of the
object-external or internal is at the same time a cognition of that cognition. Thus,
a cognition can also be understood as an awareness of awareness. To explain the
theory of svayam-prakasatva of consciousness, the analogy of a lamp is often put
forth. As a lamp illumines the objects in its surrounding and its own self at the
same time, not being dependent on any extraneous factor for its own illumination,
just so is consciousness self-luminous. Commenting on Dharmaklrtis definition
of svasaiiivedana, Dharmottara writes, There is no mental phenomenon
whatsoever which would be unconscious of its own existence. Further, he writes
that such a self-awareness is not a construction nor an illusion, and hence it is a
type of pratyaksa.59
Dharmaklrti6 0 proves the self-luminosity of consciousness as follows. First,
he points out that pleasure, pain, and so on are mental states, but they are of the
nature of consciousness and they cannot be cognized by other cognitions. From
this it naturally follows that all cognitions and mental states are self-cognized.
Dharmottara explains this point with the help of the following example. When a
patch of color is apprehended, we at the same time feel something internally in
the shape of some emotions. It is not possible to maintain that a patch of color is
felt as being itself the pleasure it affords us, because we do not say, This patch
of blue color has itself the form of pleasure. We do not regard blue and pleasure
as identical, nor do we feel them as the same. Therefore, we really are experiencing
pleasure as something quite different from the object blue, as something that is
not equivalent to blue, and this is no doubt knowledge. Therefore, we do experience
our own knowledge. Self-consciousness is essentially a case of knowledge; it
makes present to us our own-self.
The self-luminosity of consciousness does not in any way mean bifurcation
of consciousness into a subject and an object, which would be absurd.
Consciousness and selfconsciousness are, therefore, interchangeable terms. In
Buddhist writings the word citta stands for consciousness in general, but the
word caitta stands for feelings and so on, which are classed apart from cognition
on the ground that feelings do not contain intentionality, insofar as they are
purely inward in reference. Barring this difference, they are all conscious states,
the conscient character being common to cognition and feeling alike.
How one and the same cognition can be both the subject as well as the object
has been answered by Dharmaklrti by saying that the cognition directly experiences
the form of the external object reflected in it and not the external object itself; so
48
only metaphorically is it said that cognition grasps the external object, which, in
fact, simply causes the reflection . 6 1
4.
Yogijna. Besides these preceding three types of perception Dharmakirti
following Dinnaga, accepts yogi jdna as the fourth kind of perception.
Dharmakirti defines yogi jdna as intuition of a mystic that is produced from
the subculminational state of deep meditation on transcendental reality. Buddhists,
like other mystics, believe in the fact of intuitive realizations, which are available
to some gifted persons like saints. In fact, the acceptance of yogi pratyaksa is a
necessary prerequisite of the acceptance of the sarvajnatd (omniscience) of the
Buddha. The Buddhistic way of noble life consists of three broad stages, namely,
prajfid, ila, and samddhi. The experiences acquired in the state of samddhi are
perceptual ones because they are vivid, presentational, and direct. Knowledge of
the four Noble Truths and so on is an example of such a type of pratyaksa. It is
nonerroneous and nonconceptual contemplation on the real.
In order to explain the phrase bhutdrthabhdvand prakarsaparyantajam,
Dharmakirti describes the three stages of contemplation as follows.
First, he states that yogi pratyaksa is generated by deep contemplation, and
it is vivid and free from conceptual construction; afterward, he explains each of
these qualifying terms in anticipation of the possible objections that might be
urged against them. It might be asked how the cognition generated by contemplation
can be vivid. Dharmakirti proves this point by drawing our attention to the fact
that the persons possessed of fear, sorrow, and passion vividly see nonexistent
things as real because of the repeated thought of those things. Again, someone
might ask, It is conceded that the cognition generated by contemplation is vivid,
but how can one accept it to be free from conception? Dharmakirti answers that
the cognition in question has, indeed, vividness, and just for this reason it ceases
to be a conceptual construction. Conceptual constructions are never vivid.
Dharmakirti again observes that all cognitions born of a deep contemplation on
either reality or unreality are vivid and nonconceptual; but the cognition born of
a contemplation on reality is valid, while the cognition born of a contemplation
on unreality is invalid because the former alone is in harmony with successful
activity or is efficient to lead to the attainment of the object pointed out by it.
This, in short, is how the cognition born of a deep contemplation on reality is
vivid, nonconceptual, and efficient to generate the purposive action, and hence it
is a case of perception . 6 2
Chapter 3
The Buddhist Theory of Inference

INFERENCE (ANUMANA) AS PRAMANA
In different systems of epistemology different numbers of pramdnas are accepted,
and with the exception of the Carvaka system, the acceptance of anumana as a
pramana has been unanimous. Apart from pratyaksa Buddhists regard anumana
as pramana. Generally, a distinction is drawn between two kinds of knowledge,
namely, pratyaksa (immediate) and paroksa (mediate). Anumana, as opposed to
pratyaksa, is a mode that can provide only mediate (paroksa) knowledge.
Anumana, it is important to note, is at once a mode of knowing and a way of
reasoning. Thus, it has an epistemic as well as logical aspect, both of which are
inseparably coalesced into one. In fact, the former aspect is the basis for the
latter, and that is why anumana is generally known as a mode of knowing.
Development of the Theory of Anumana in the Buddhist TVadition

Among the different systems of logic that developed in India, the Buddhist
system is of significance comparable to that of the Nyaya. Though systematic,
logical analysis seems to have begun with Vasubandhu, Dinnaga and Dharmaklrti
developed a fullfledged theory of anumana as also that of pratyaksa and apoha.
The development of logic in the Buddhist system and, for that matter, in the
entire Indian thoughthas been within the epistemological context and therefore
began with the theory of pratyaksa . Some people are of the opinion that the
science of logic (Nyaya sastra) developed in India out of a science of dialectics
and debate (Vada sastra), but it seems more probable that it was not so much the
dialectics as the art of conducting philosophical debates in public (Vada vidhi)
that was the ground for the subsequent rise of the science of logic, a theory of
anumana, more specifically, the pardrthdnumdna. Since the technique of anumana
50
was employed as one of the modes of acquiring knowledge and providing proofs
or grounds for the truth of that knowledge, the science of logic was also known as
the science of reason (hem vidya or pramdna sastra).
The Buddhist theory of anumana has been developed in the context of the
theory of twofold pramdnas, namely, pratyaksci and anumana, which, in turn, is
based on the view that there are two types of object of knowledge (prameyas). As
stated earlier, the Buddhists put forth a process view of reality as opposed to the
substantival view of reality advocated by the other schools of thought in India.
Such a real being in the form of discrete and momentary existence is given only
in our sense-experience, which is pure sensation devoid of all conceptualizations.
But for empirical purposes they accept another view of reality (though, of a
lower order) in which different thought categories in the form of substance,
qualities, motion, class character, etc. and so on are hypostatized and imposed
upon the reality. The entire system of logic is interwoven around such mental
constructions and their interrelations. However, it also aims at explaining the
relation between the dynamic reality and the static construction of thought.
Though the word anumana occurs in the Pitakas, it does not seem to
occur in the sense of a science of logic. In th e Anumana Sutta1 a principle is laid
down that one should not do unto others what one doesnt wish others to do unto
oneself. This is said to be based on the generalization that what is disliked by
oneself is disliked by others as well. This knowledge is said to be inferential.
Here one should infer (svdrthdnumdna) as follows: An evil person who is swayed
by evil thoughts is disagreeable and disliked by me; now if I were to be evil and
swayed by evil thoughts I, too, will be disagreeable and disliked by others. If we
analyze this anumana, it, in fact, consists of two anumanas, namely:
1.
2.
I dislike an evil person, X is like me (as a person), Therefore, X (probably) dislikes

an evil person.
X dislikes an evil person (conclusion o f (1), I am an evil person, Therefore, X
dislikes me.
This apart, we also meet with the expression anvaya jhdnam, 2 meaning
inductive knowledge in all the Nikayas as well as in the Abidhamma. By this is
meant the inferential knowledge of the inductive pattern, which is based on a
belief in the uniformity of nature and universality of causal relationships. In the
Sutta Nikaya we come across several statements expressing causal relations such
as with the arising of birth there is arising of decay and death, and with the
cessation of birth there is cessation of decay and death and so on . 3 Knowing
such causal relations is called the knowledge of phenomena (dhamma jhdnam).
It is further stated, This constitutes the knowledge of phenomena; by seeing,
experiencing, acquiring knowledge before long and delving into these phenomena,
he draws an inference (nayam neti) with regard to the past and future as follows:
All those recluses and brdhmanas who thoroughly understood the nature of decay
and death, its cause, its cessation and path leading to the cessation of decay and
51
death did so in the same way as I do at present; all those recluses and brahmanas
who in the future will thoroughly understand the nature of decay and death will
do so in the same way as I do at presentthis constitutes the inductive knowledge. 4
In the Abhidhamma and Prakaranas we find a more favorable attitude toward
the science of debate and logic. Of course, argumentation was always kept
subservient to scriptures . 5
As we remarked earlier, the science of logic was developed in India for the
sake of sophistication in debate. Most of the terms and techniques of the science
of debate were retained in the science of logic. In Kathdvatthu we come across
several such terms, like anicyogci, ddhdraiia, patijna, upanaya, niggaha, anuloma,
pcitikcimma, and nigamana.
Yogacaryabhumisdstra, a later work dealing with the science of debate,
contains a section pertaining to the doctrine of anumana and other pramanas.
Tucci is of the opinion that it is, in fact, there that we find the earliest elaboration
of the doctrine of syllogism and pram am s. 6 Another work by the name Tarkasastra
deals more exhaustively with the theory of anumana and thus forms a link between
the science of debate and science of logic. This Tarkasastra points out unmistakably
the existence of trairupya theory before Diiinaga. 7 Tucci observes: Whether the
work is Vadavidhi or a different one, there is no doubt that it contains ideas and
doctrines which Dinnaga found before him and which in many places he refuted
in his treatises, and in other places he followed. It is still a vivdda text, but it
shows an enormous progress upon the first attempts and mere catalogues of the
older treatises, as we can see quite well when we compare it with the vivdda
sections contained in Maitreya and Asanga . 8
ANUMANA IN THE WORKS OF PRE-DINNAGA THINKERS

The systematic study of logic and epistemology that began in the Nyaya
circle was introduced in the Buddhist tradition by Asanga and Vasubandhu, who
tried to counter Nagarjunas nihilistic dialectics. Nagarjuna was an absolutist
who argued for the futility of all logic for the experience of the Absolute. With
the advent of Asanga and Vasubandhu the realistic Nyaya logic was introduced in
the Buddhist circle with suitable adaptations to their idealistic framework.
Asanga was perhaps the first Buddhist writer who talked of the theory of the
pardrthdnumdna (pancavayavi vakya). However, we dont find any innovation or
significant contribution in the works of Asanga. A short summary of the exposition
of logic by Asanga is found in Prakaranarya Vdcasastra and volumes 7 and 16 of
M ahaydnabhidharm asam yuktasangiti sdstra. Asanga was preceded by
M aitreya, who com posed a treatise on the art of debate by the name
Saptadasabhumisdstrayogacaryd. In logical views Asanga followed Maitreya
except in respect of the theory of proof. Proof (sadhaka) was understood by
Asanga in a comprehensive sense of pramana and was subdivided as follows:
(1) pratijha, (2) hetn, (3) udhaharatia, (4) upanaya, (5) nigamana, (6 ) pratyaksa,
(7) anumana, and (8 ) agama. The first five subdivisions constitute anumana.
Asanga differed from Maitreya in differentiating anumana from pratyaksa,
52
upamana, and agama and in regarding anumdna as consisting of the first five
divisions only. But in all this he seems to be just imitative of the Nyaya view.
Asariga was followed by Vasubandhu, who was a renowned teacher of logic.
Vidyabhushana9 has presented a summary of Tarka s'astra authored by Vasubandhu.
He points out that Vasubandhu seems to have used two forms of anumdna, namely,
that of five parts at the time of debate and a syllogism of two parts, namely,
pratijha and hetu, on an ordinary occasion . 1 0 Stcherbastsky, however, mentions
that mostly he was operating with pahcavayavi vakya, but sometimes he was also
making use of the abridged trayavayavi.11 He further points out that there are
only two other significant points on which Vasubandhu differed from the
Naiyayikas: first, the doctrines of trairupya and avinabhava appeared first in the
works of Vasubandhu, and second, the classification of hetus and hetvabhasas is
different from the one accepted in the Nyaya school and agrees in principle with
the one introduced by Dinnaga and developed by Dharmaklrti.
ANUMANA IN THE WORKS OF DINNAGA

Dinnaga gave a new direction and impetus to the study of logic and
epistemology in the Buddhist tradition. It goes to his credit that he treated the
theory of pramanas separately from the theory of prameyas. In him and perhaps
in Vasubandhu prior to him we find an attempt to write independent works on
pramanas without bringing in explicit analysis of prameyas. According to him,
there are only two pramanas, namely, pratyaksa and anumdna. The other
pramanas, like s'abda, were reduced to anumdna. Dinnagas analysis of anumdna
was so strikingly original that even in the Nyaya circle it was taken cognizance
of. Uddyotakara, for example, writes, Apare tu bruvate, ndntanyakarthadarsanam
tad vido anumdnam. 1 2 Here the expression apare probably refers to Dinnaga.
The basic point of difference between Dinnaga and the Nyaya logicians is
that for Dinnaga anumdna may consist of a pure thought process, that is, purely
propositional, or it may be sentential. 1 3 A purely propositional anumdna is a
thought process that has not been verbally expressed. It is named by him as
svarthdnumana. When the propositions of an anumdna are expressed in language
(prakasana or akhydna), then they are sentential (s'abda) in nature, and that form
of anumdna is named pardrthdnumdna. Keith1 4 opines that the distinction between
the two kinds of anumdna was first introduced by Dinnaga in Indian logic. Probably
this two-fold classification of anumdna was already prevalent in the Nyaya tradition,
but there it was used in a slightly different sense, svarthdnumana meaning anumdna
for ones own sake and pardrthdnumdna meaning for the sake of others. Dinnaga
borrowed the same phraseology to name his twofold classification of anumdna.
So far as pardrthdnumdna is concerned, it is sentential, according to Dinnaga,
and normally we resort to sentential expression only when we communicate with
others. But communication with others is not the necessary condition of using
language. Thus, Dinnaga would not agree with the Naiyayikas in regarding
pardrthdnumdna as inference for the sake of others but would insist that this is
one of the motives for undertaking pardrthdnumdna. His basic difference with
the Naiyayikas is with regard to the understanding of svarthdnumana. For the
53
Naiyayikas svarthdnumdna is also sentential because for them no conceptual

knowledge can be nonverbal. For Dinnaga, on the other hand, there can be a
nonverbalized conceptual cognition, and in svarthdnumdna we have only such
cognitions.
The other point of departure of Diiinaga is the advocacy of svabhdvdnumdna,
which stands for a sort of analytical entailment. In the Nyaya tradition, because
of its predominant realistic attitude there was no such possibility of the acceptance
of one concept being subsumed under another concept such that the former could
be deduced from the latter. In the Buddhist tradition the entire process of anumdna
operates at the conceptual level only, and therefore the Buddhist logicians could
conceive of one concept being connected with another by the relation of analyticity.
Another innovation of Dinnaga, which is a corollary of the earlier mentioned
point, is that he made explicitly clear the distinction between the objects of
perceptual cognition and the objects of inferential cognition. In anumdna we are
concerned not with the real object (svalaksana, grahya) but with the conceived
object (sdmdnyalaksana, adhyavaseya). So a thought process from one conceived
object to another conceived object is necessarily connected with it.
Lastly, in Dinnaga we fmd a new understanding of the concept of anumeya.
According to the Nyaya logicians sadhya is anumeya, but for Dinnaga it is paksa
characterized by sadhya, which is the anumeya. So in the example of the inference
of fire on the basis of the perception of smoke Dinnaga would maintain that the
thought process is from smoky hill to fiery hill and not from smoke to fire. The
latter Naiyayikas emphasize the colocushood (ekadhikaranya) of hetu and sadhya
in paksa, whereas Dinnaga talked of hetu and sadhya being the coproperties of
paksa (dharrna).
Anumdna in the Works of Dharmaklrti

Dinnagas formulation of the theory of anumdna was further explicated by
Dharmaklrti in his Pramana Vartika and Nyaya Bindu. In the latter work, the
basic concepts and terms involved in the theory of anumdna have been clearly
analyzed and defined. Dharmakirtis main contribution lies in his elaboration of
the doctrine of trairupya, a detailed account of which is presented later. The
doctrine of trairupya regards hetu or lihga as the starting point of the process of
anumdna and grounds its validity on three conditions that a valid hetu has to
fulfill. In short, they are as follows:
1.
2.
3.
There should be a necessary presence of hetu in paksa (anumeye sattvarri). This

corresponds to the idea o f paksadharmatva available in the Nyaya position.
There should be presence o f hetu only in such cases that are similar to paksa
(sapakseva sattvam ) .
Lastly, there should be necessary absence o f hetu in such cases that are dissimilar to
paksa (asapkse casattvameva niscitam).
The second and the third conditions correspond to the two types of vyapti,
Buddhist Epistemoiogy
namely, affirmative (<anvaya) and negative (vyatireki), accepted in the Nyaya

tradition. Though these three conditions of hetu or linga have been introduced by
Dinnaga, Dharmaklrti put forth their systematic formulations. In fact, here it is
given such a central position that the entire subsequent discussion on anumana
pivoted around it.
Further, it goes to the credit of Dharmaklrti to have analyzed anupalabdhi
into eleven varieties. Such a classification of negative relation is of great significance
in die analysis of causal relation. It seems that the later Buddhist theory of
pancakarani1 5 was formulated as a consequence of the analysis of the negative
aspect of causal relation, as it was put forth in the analysis of the different varieties
of anupalabdhi.
After Dharmaklrti we dont come across any notable thinker in Buddhist
logic. Dhannottara, Moksakaragupta, Prajnakaragupta, Santaraksita, Kamalaslla,
Ratnaklrti, Jnanasrl Mitra, and others explained, elaborated, and defended the
Buddhist doctrines of logic, but none of them made any new contributions. In the
analysis of the theory of apoha Ratnaklrti introduced some significant innovations,
but he didnt take much interest in the field of knowledge. However, he brought
about greater sophistication and cohesion in the Buddhist system. Thus, it appears
that Buddhist logic of a serious sort began with Vasubandhu, was developed by
Dinnaga and Dharmaklrti, was defended by Santaraksita and Kamalaslla, and
was later refined by Ratnaklrti and Jnanasrl Mitra.
ANUMANA PRAMANYA
Svatah-Paratah Controversy
The problem concerning the pramdnya of prama can be posed in two different
ways. It can be discussed as to whether anumana is a pramana or not, or, in
other words, whether anumiti jhana has pramanya or not. On this point, with the
exception of Carvakas, all other schools of philosophical thought accord pramanya
to anumiti jhana, but in what way anumiti jhana has pramanya there is a difference
of opinion. Vedantins and Bhartrhari circumscribe the independent operation of
anumana pramana by making it subservient to some other pramana. The rest of
the schools and thinkers grant its independent operation. The Buddhists with
whom we are presently concerned accept anumana as an independent pramana.
However, in Dinnaga we meet with another position that assigns a status to
anumana that is on a par with illusions, hallucinations, and so on. But such a
stand is to be understood in its proper metaphysical perspective, which talks of
two levels of reality, namely, paramdrthika and samvrtika. The validity of inference
is denied only from the paramdrthika point of view, but at the level of samvrtika
it is very much valid, as valid as perceptual cognition . 1 6
Whether anumana is an independent pramana or not is a question that has a
methodological significance, but a question philosophically more significant is
the mode of knowing pramdnya of anumiti jhana. On this issue Indian
epistemological thinkers are generally divided into two camps. Some thinkers
55
adhering to svatahprdmdnyavada regard the relation between jnana and, for that
matter, anumiti jnana andpramdnya as svatah (intrinsic). Some others view this
relation to be paratah (extrinsic). Buddhist thinkers, particularly Dinnaga and
Dharmaklrti, advocate the theory of svatahpramanya.
The question about pramdnya of prama is inseparably bound with the question
of the nature of prama. As stated earlier, Buddhists refuse to draw a distinction
between pramdna and pramdnaphala, saying that every cognition-qua-cognition
is ab initio valid insofar as it is caused by the object itself. The sarupya of the
cognition with its object is a sufficient guarantee for the truth of the cognition,
though this sarupya is not something extraneous to that cognition. For Buddhists
every cognition has twofold aspects (dvairupya), namely, svakdrata and
visaydkdrata. Visaydkdrata is the ground for the pramdnya of a prama since
visaydkdrata is the very nature of a cognition. Every cognition has to be inherently
true. This consideration led these Buddhist thinkers to advocate the theory of
svatahpramanya.
The intrinsic truth of a perceptual cognition is prima facie itself a very
plausible position, but the intrinsic truth of inferential cognition may not be that
apparent. This is because of the complicated structure of the inferential process.
In every inferential process there is a possibility of going astray at every step,
giving rise to what is technically known as hetvabhasa. Further, there is a greater
need for adducing evidence in an inferential cognition compared to the perceptual
one, and this may make the pramdnya of the inferential cognition contingent
upon the adequacy and conclusiveness of the adduced cognition. We may therefore
state and examine the grounds on the basis of which Buddhists insist on the
svatahpramanya of anumiti jnana. In order to appreciate the sharpness of the
Buddhist position it would be very much helpful to refer to Vacaspati , 1 7 the
Naiyayika, who accepts the svatahpramanya of anumiti jnana even in the context
of the Nyaya tradition. His argument of the ab initio apprehension of pramdnya
of anumiti jnana is that among its originating conditions there is certainty about
the vyapti jnana. There is no room left, therefore, for having any subsequent
doubt in the validity of inference. It should be pointed out that Udayana is not so
very confident, but he, too, hesitatingly concedes that truth is there apprehended
ab initio. However, he also makes a desperate attempt to reconcile this with the
paratah theory of the Nyaya tradition by suggesting that there it may be both.
Gangesa is not oblivious of this inconsistency with the Nyaya standpoint and
therefore proceeds to explicate what in his view is the true intention of Vacaspati.
The general point that he makes is that in all these cases there is no scope for
doubt, though truth is apprehended extrinsically. In this he is following Udayanas
comment on Vacaspati in his Parisuddhi,18 The crux of his argument is that it
would be too much to claim that since there is no scope for doubt, the truth of an
inference is apprehended ab initio. Truth is always to be known subsequently in
anuvyavasaya.
Dinnaga and Dharmaklrti seem to be uncompromising in their advocacy of
the theory of svatahpramanya. In Pramana Samuccaya Dinnaga explicitly maintains
56
that the guarantee for the truth of a cognition lies in its being of the form of its
object. He writes that, the means of cognising is simply the cognition having
the form of the object . 1 9 For him every true cognition necessarily refers to an
object, and since it is caused by an object, it possesses the form of that object.
Dinnaga is a sdkdrajndnavddin and, therefore, insists on the knowledge being of
the form of its object. If every true cognition has to be of the nature of its object,
it is a sufficient condition for its truth and therefore leaves no scope for any
doubt. The question of doubt will arise only when there is a possibility of the
intermingling of such elements that are not caused by the object and that are due
to subjective factors. For Dinnaga, therefore, there is no distinction between
knowledge and such factors that evidence its truth insofar as the latter is not
something extraneous to knowledge. The question of evidence arises only when
falsity is suspected, that is when something that is taken to be a pramdna
(knowledge) is suspected to be a pramdndbhdsa (pseudo knowledge). If, on the
basis of any evidence, a particular cognition stands falsified, it does not mean
that what was knowledge is now falsified. In fact, knowledge by definition is
true, and truth follows from the very definition of knowledge as a matter of
analytic necessity. Therefore, it is impossible to falsify knowledge. So when on
the basis of some evidence or set of evidences a particular cognition is falsified,
all it means is that a pseudoknowledge that was masquerading as a genuine
knowledge is now exposed.
In order to appreciate the strength of Dirinagas position, it is necessary to
first see his metaphysical position. Being an advocate of Vijnanavada, Dinnaga
maintains that in the ultimate analysis the entire empirical reality is nothing but
different manifestations of the series of vijndna, and as a consequence of this he
maintains that the means of cognition, the cognition that is its result and the
object of cognition, are not separate from one another, and though in an
epistemological analysis we may analyze these three factors of cognition as
pramdna, pramdnaphala, and prameya, in reality they are not three separate
things . 2 0
Following Dinnaga, Dharmaklrti also subscribes to the svatahprdmdnya
theory, though he talks of a true cognition necessarily leading to a successful
activity. 2 1 Knowledge leading to successful activity is only a test and not its
criterion. A distinction, therefore, has to be drawn between test of truth and
criterion of truth. The truth of a cognition can be tested on the basis of extraneous
considerations, like being a means to successful activity. It should not be mistaken
as a criterion of truth. The purpose of a test is to verify or ascertain the presence
or absence of a particular phenomenon. This can be done on the basis of the
possible effect that a particular phenomenon gives rise to; for example, in
Dharmaklrtis system successful activity is an outcome of true cognition, and,
therefore, the former can be taken as a test of the latter. A criterion, on the other
hand, serves a different purpose. Its function is to distinguish a particular
phenomenon from its opposite. In the case of knowledge, according to Dharmaklrti,
arthasdrupya is a criterion of knowledge and is not something extraneous to
57
knowledge. It is rather the very nature or essence of knowledge. Thus,

avisamvddakam is a criterion of knowledge, whereas sarvapurusdrtha siddhi
hetii is the test of knowledge.
From this analysis it follows that the criterion of truth of an inferential cognition
is intrinsic to it, and this provides a sufficient ground for maintaining that Dinnaga
and Dharmaklrti subscribe to the theory of svatahprdmanya.
NATURE OF ANUMANA
The term anumana literally means a knowledge that follows (ianu+manci,
i.e., pascdnmanamiti anumandm). This means that the inferential knowledge is
necessarily preceded by some other knowledge. In other words, anumdna as a
pramana is a complex knowledge consisting of two elements, one antecedent
knowledge and the other consequent knowledge. The antecedent and the consequent
have a particular type of relation that is technically known as garnya-gamakabhava (entailment). The antecedent leads to, or gives rise to, the consequent and
is, therefore, a gamaka (that which entails). The consequent results from the
antecedent and is, therefore, a gamya (that which is entailed).
However, it is not the case that any knowledge will lead to, or entail, any
other knowledge. The antecedent knowledge has to be in the form of liriga
(necessary mark), of which the consequent knowledge is lingin (marked). Liriga
means that which is a necessary mark of something other than itself {Unamartham
gamayati sah lihgam). Likewise, lingin stands for that which is necessarily marked
by a liriga.
Between liriga and lingin there is always a gamya-garnaka-bhava22 which
can roughly be regarded as the relation of entailment such that every case of the
presence of liriga is necessarily a case of the presence of lingin, and, on the
contrary, every case of the absence of lingin is the case of the absence of liriga .
The necessary connection between liriga and lingin on the basis of which gamyagarnaka-bhava is established between the two is technically known in the Buddhist
tradition as avinabhava or vyapti (necessary concomitance). The presence of
avinabhava provides the basis of the transition from gamaka to the garnya.
Avinabhava, therefore, constitutes the logical ground for the process of anumdna.
It is significant to note here that unlike the Nyaya tradition in the Buddhist tradition
liriga and lingin are in the form of concepts (vikalpas) rather than things or
metaphysical reals, a point discussed later.
Nonpresentative Character of Anumana

The inferential knowledge, as we have stated, stands for the knowledge of
the lingin on the basis of the knowledge of the liriga. This implies that the inferential
knowledge of the lingin is necessarily nonpresentative. By nonpresentative is
meant that the object of cognition, which is the lingin, is not directly given to, or
apprehended by, the cognitive senses. The object here is not directly present but
is conceived to be so on the ground of the presence of its necessary mark. However,
it should not be understood that the conceived object is essentially a nonexistent
58
one. It is an existing object whose presence or absence is indirectly cognized at

a particular place on the basis of the presence or absence of its mark. Thus,
anumana as a pramana offers a mediated knowledge of an object that is not
directly given. We know an indirectly given object through a direct one to which
it is related.
In saying that anumana is nonpresentative it is to be contrasted with
pratyaksa, which is essentially preservative. Presentativeness of perceptual
cognition consists in its apprehension of an object that is directly given to the
senses (aksam akasamiti pratyaksam). Such an object is named as grahya (sensed)
in contrast to the object of inferential cognition named as adhyavaseya (conceived).
The grahya, svalaksana, is an objective reality, which is just a point instant, a
unique particular, according to Buddhist ontology. The adhyavaseya, samanya
laksana, on the contrary, is a mental construction (kalpana), a conceived entity,
conceived in terms of either its substantiality or objectivity or relation or generic
character. This conceived object is neither purely objective nor purely subjective
but intersubjective. It is not objectively real but hypostatized to be so. However,
its hypostatized character does not make it illusory or purely imaginary. It is a
construction out of sense data and thus has empirical reality.
Judgmental Character of Anumana

According to the Buddhist epistemology as stated earlier, there are only two
types of knowledge because there are only two types of objects of knowledge
(mdnam dvividham meya dvaividhyat). Pratyaksa is knowledge in the form of
pure sensation devoid of all conceptualization and judgm entalization
(pratyaksam kalpanapodham). In contrast, anumana is necessarily a kalpana,
that is, conceptual, and hence judgmental in nature. Thus, in the Buddhist tradition
a knowledge can be either nonjudgmental or judgmental. If the former, it is a
case of pratyaksa, and if die latter, it is a case of anumana. Of course, every
judgmental cognition is ultimately grounded in a nonjudgmental cognition, and
that is why anumana is characterized as pratyaksa prstha bhdvi.
In the Buddhist tradition anumana is not the only type of judgmental cognition.
An illusory cognition (bhranta jhana) can also be judgmental, but it is not a
pramana, diat is, true cognition. So the only judgmental cognition that is a
pramana is in the form of anumana.
Relational Character of Anumana

Unlike the perceptual cognition, inferential cognition is relational in nature.
The object of the inferential cognition is always a characterized entity (dharmi)
that is cognized on the basis of the perceptual cognition of one of its dharmas. As
we pointed out earlier, there are two distinct types of cognition involved in an
anumana, namely, the antecedent and the consequent. Both these cognitions are
relational in nature. The antecedent cognition is again twofold, technically known
as paksadharmatva and vyapti or avindbhdva. The former is in the form of
59
contingent relation, but the latter is a necessary relation. There is an involvement

of relation not only in the structure of the premises and the conclusion, so to say,
of the anumana, but also in the transition from premises to conclusion. This
relation makes possible an extension of our knowledge from premises to
conclusion. Thus, anumana operates within a relational framework through and
through.
According to Buddhist metaphysics, all relations are mental constructions,
as there are no relations in reality. So relations are not apprehended in pratyaksa.
That is why perceptual cognition is nonrelational in nature. Thus, only in anumana
are relations apprehended. The objects of anumana are relational, and anumana
in itself is also a relational cognition.
Verbalizable Character of Anumana

There has always been a difference of opinion regarding the relation between
knowledge and language. Bhartrhari, for example, regards every knowledge to
be necessarily embodied in language. Buddhist thinkers, on the other hand, insist
that there can be thought even without being associated with language. They talk
of two types of knowledge; that which can be verbalized and that which cannot
be v erb alized . P erceptual knowledge is nonverbalizable. In fact, its
nonverbalizability follows from its being nonjudgmental or nonconceptual.
Inferential knowledge, on the other hand, is verbalizable. It is controversial whether
it is always verbalized or whether it is so only in parrthnumna. However, one
thing is certain, that whether actually verbalized or not, it alone is verbalizable.
In fact, only when the inferential cognition is verbalized can its fallacious or
nonfallacious character be exposed.
Generalized Character of the Object of Anumna

The perceptual cognition has the unique particular as its object. But the
object of inferential cognition is a generalized concept that results from the process
of mental construction. The constructing activity of intellect is dichotomous. It
always begins by conceiving the object in two aspects, the similar and the dissimilar.
It operates with the method of agreement with the similar (anmya) and difference
with the dissimilar (vyatireka). If the aspect of agreement is expressed, then the
aspect of disagreement is understood, and viceversa. Thus, according to
Dharmakirti, the object of inference is the exclusion of the opposite (atadvyvnti).
Anumana does not cognize the positive nature of a thing but only its negative
nature, which consists in a things exclusion from all types of dissimilar things.
What is meant by saying this is only that the object of anumana is a mental
concept, a universal and not a real existence. However, this universal is not
merely a creation of mental impressions (vsan). It is generated by real things.
According to Dharmaklrti, it is in the nature of real things to generate a mental
concept. So, a mental concept is invariably related to those things. Because of
this, though an inference cognizes a mental concept, yet it enables us to attain a
real tiling. Insofar as it does not help attaining a real thing, it is bhrnta jna.
60
But so far as it enables us to attain an efficient real thing, it is apramana. Dharmakirti

again proves that an inferential judgment is ultimately grounded in a real thing.
The real fire that is the cause of real smoke is the remote object of the inferential
judgment There is fire on the hill. The real fire generates the real smoke, the
real smoke generates its own sensation, and this sensation generates the judgment
based on conception that there is smoke on the hill. This judgment with the help
of memory of the concomitance between smoke-in-general and fire-in-general
generates the inferential judgment that there is fire on the hill. The actual
object of inferential judgment, is the fire-in-general, which is necessarily related
to real, unique fires.
RELATION BETWEEN PRATYAKijA AND ANUMANA IN THE

CONTEXT OF THE THEORY OF PRAMANA-VYAVASTHA
Dinnaga in the beginning of the Pramdna-Samuccaya draws a radical and
essential distinction between pure sensation and a conception. The latter, in his
system, includes judgment and inference. This distinction is grounded in a more
basic distinction between two types of objects of cognition, namely, svalaksana,
the unique particular, and sdmdnyalaksana the universal. The former is a particular
individual that can never be generalized or conceptualized, and the latter is the
universal that is conceptually constructed by the mind through generalizing from
many individuals without any regard to the peculiarity or individuality. The former
is real, while the latter lacks reality. As one is incompatible with the other, there
cannot be anything that possesses both svalaksana and samdnyalaksana at the
same time. Corresponding to this essential distinction between the two kinds of
premeyas is a radical distinction between the two pramanas. Dinnaga was
uncompromising in arguing for the distinct spheres of operation of these two
pramanas, and his theory is known as pramana vyavasthdvdda.
It is in contrast with the theory of pramana sampalava advocated by the
thinkers of the Nyaya and Mlmamsa schools. According to them, the same object
can be cognized in many ways by different pramanas . There are no strict, distinct
limits for each of the pramanas. The basic contention underlying the theory of
pramana vyavastha is denied by the Naiyayikas, who admit neither that there are
only two quite distinct types of pramana nor that there are only two quite distinct
types of prameya. According to them, pramanas are four in number, namely,
pratyaksa, anumdna, sabda, and upamdna, and the objects can also be of three
kinds, the particular, the universal, and the individual thing as possessor of
universal.
The main Buddhist argument against the theory of pramana samplava is that
if pratyaksa and anumdna are admitted to have one and the same thing for their
object, the cognition produced should also be of the same nature; but that is
simply absurd. The sensations of burning as apprehended in pratyaksa and as
known through words in anumdna are quite different. The Buddhist thinkers
maintain that the cooperation or mixture (samplava ekasmin visaye sarvesdm
pramdndndm pravrttih) of the different sources of our knowledge in the cognition
61
of one and the same object is impossible, since each one has its own special field
of operation.
Thus, Dinnaga and his followers draw a clear-cut difference between a
perceptual knowledge and a conceptual knowledge. Even the perceptual judgment
of the form This is blue is treated as conceptual and therefore inferential. In
the strict sense, therefore, all perceptual judgments are actually inferential.
Dinnaga insists that an object of knowledge must be either a svalaksana or
sdmanyalaksana, for there is no third kind. If it is a svalaksana, it would be an
object of perception, and if it is sdmanyalaksana, it would be an object of atuunana.
J\}st aspratyaksa cannot cognize a sdmanyalaksana, so also anumana cannot cognize
a svalaksana.
Pratyaksa is capable of cognizing an object only because it is produced
through the efficiency (samarthya) of an object. Such a thing alone can be an
object of pratyaksa, which is able to attribute its definite form (niyata pratibhasa)
to the cognition. It can be done only by unique particular, which alone is cognized
in pratyaksa. On the other hand, the unique particular can never be cognized in
anumana, which results from the ascertainment of invariable relation between
two entities. Such a relation cannot be established between two unique particulars,
and therefore the latter cannot be the object of anumana. Moreover, pratyaksa,
which is in the form of stimulus coming from an object, can be produced only by
such an object that is present. A universal cannot produce such a result because
it can neither cause a stimulus nor call forth its pratibhasa, since it is altogether
devoid of any kind of direct causal efficiency. According to Buddhists, pratyaksa
can apprehend only such an object that is objectively real. This alone is pure
reality in the ultimate sense, the thing-in-itself, because the essence of reality,
according to Buddhists, is just the property of being causally efficient.
That a unique particular of this kind should also be cognized by the conceiving
faculty of our mind or by anumana is impossible. The sphere of unique particulars
is not the sphere of anumana. The latter cognizes relations (grahita pratibanda
hetukam). In a unique particular no relations can be found. Relations are always
conceived between two (or more) universals. The universals are not realities;
they are logical constructions produced by our constructing mind, and, therefore,
their objective existence in the external world belongs only to the domain of our
inferential knowledge, which is either a dialectical superstructure upon reality or
an objectivized image. Their source, indeed, is not positive, since they always
contain a corelative negation (anya-vyavrtti or anyapoha).
A universal is, therefore, internal (abahyam) mental construction but related
to external reality, since in our behavior we dont notice the differences; that is,
we dont think that a cow (conceived cow) is not an external object. It is
deemed to be external (bahyatvena avasiyamanam) and thus gives reality to
inferential knowledge. Being thus indirectly related to external reality, it has
efficiency. Thereby it becomes a consistent experience and hence a pramdna.
There is no other pramdna except these two. Whatsoever has a claim to be a
pramdna is included in these two, or, if it is not included in them, it is not a
62
pramana. Since there is neither any other source of valid knowledge nor any
other object to be cognized, one has got to admit the theory of pramana vyavastha.
ANALYSIS OF THE NATURE OF INFERENTIAL JUDGMENT

Buddhist thinkers sometimes draw a distinction between a perceptual judgment
and an inferential judgment. All cognitions naturally lead to judgments, that is,
to interpretation of sensations in concepts. Since a cognition can be distinguished
as direct and indirect, the judgment can also be divided into a direct one and an
indirect one. The direct one is a synthesis between a sensation and a conception,
and the indirect one is a synthesis between a sensation and two concepts. The
direct one has two terms; the indirect one has three terms. The direct one is of the
form, This is blue or This is smoke, and the indirect one is of the form,
There is fire because there is smoke.
There is a basic difference between a perceptual judgment and an inferential
one. The perceptual judgment is a direct cognition in the sense that its object is.
directly known. This is smoke is a perceptual judgment because smoke is
directly perceived. The inferential judgment is indirect insofar as its object is not
directly perceived. It is a cognition of a nonperceived object through a perceived
object that is its mark. The unperceived object has a mark, and this mark, in its
turn, is the mark, of a svalaksana. Thus, fire is the unperceived object whose
mark is smoke, and this smoke is, in turn, a mark of some svalaksana, the real
smoke. The cognition of a svalaksana as possessing the mark of its mark is
anumana. In a perceptual judgment we cognize the object X through its mark,
which is the concept B. In an inferential judgment we cognize the object through
the mark of its mark, that is, through A, which is a mark of B. A and B
are related as reason and consequent. When the reason is cognized, the cognition
of the consequent necessarily follows. No doubt A and B have a common
substratum Y (paksa); its presence will be necessarily understood without any
formal expression. In that case the two interrelated elements A and B will
represent the whole inferential judgment. This judgment will then apparently
consist of two concepts only but related as reason and consequent, one being the
necessary ground for inferring the other.
Strictly speaking, there cannot be anything like perceptual judgment because
the theory of twofold pramanas is based on a dichotomous distinction between
the perceptual, which is nonjudgmental, and the conceptual, which is judgmental.
In perceptual cognition there is no involvement of judgment, and hence there
cannot be anything like perceptual judgment. However, in a loose sense we can
talk of perceptual judgment insofar as every perceptual cognition is capable of
leading to a judgment. But then two questions arise, namely:
1.
2.
Is this perceptual judgment the same as, or different from, anumanal

If it is different from anumana, can it be a pramana ?
Areata , 2 3 commenting upon Dharmaklrti, writes that Buddhist logicians, in
63
fact, dont consider perceptual judgment to be a case of anumana and don't

regard it to be a pramana. The perceptual judgment is not a pramana because it
is a cognition of what is already cognized .(grahltagrahi). Every perceptual
judgment immediately follows in the wake of perception, and, therefore, it
apprehends that very object that is apprehended in perception. Anumana, on the
other hand, cognizes an object hitherto uncognized (agrahltagrahi).
There is another reason that perceptual judgment as distinct from inferential
judgment is not a pramana. Though the perceptual judgment has the same object
that is already sensed (perceived) in pratyaksa, while determining it, perceptual
judgment distorts it, that is, finds it as something general though, in fact, it is
something unique. Every judgment consists in superimposition of character(s)
on a thing that it doesn't, in fact, possess. The inferential cognition, on the other
hand, is conceived only with that object that is a concept. Since every concept is
a mental construction, there is no question of its being distorted by mind.
It then becomes a judgment of concomitance or a judgment based on
concomitance. Inference or the object cognized in the inference, says Dharmottara,
is a complex idea of the substratum together with its inferred property, or, when
the invariable concomitance between the reason and the inferred property is
considered abstractly, then the inferred fact appears as this property taken in its
concomitance with the reason . 2 4 In the first case, we have just an inferential
judgment, and in the second case a judgment of concomitance. The form of the
former will be, There is fire there because there is smoke, and that of the
latter, Wherever there is smoke, there is fire. The term there is expressive of
the substratum (paksa) where the two attributes, namely, smoke and fire, are
necessarily interrelated such that the latter is deducible from the former. Thus, in
every inferential cognition there are three terms involved. However, not every
cognition containing three terms of which one is the substratum of the other two
will be an inference. Only such a combination of them, where two attributes are
necessarily interrelated, the one deducible from the other, represents an inference.
DEFINITION OF ANUMANA
Before attempting to give a definition of anumana, Dinnaga, Dharmaklrti,
and their followers begin by drawing a distinction between two kinds of anumana,
namely, svartha, which is a mere mental process, and parartha, which is a
verbalized form of that mental process. Since the first one is nonverbalized, and
the second one is necessarily verbalized, the two cannot be comprehended under
one single definition, and, therefore, before attempting to a give definition of
anumana, it has to be specified whether it is a definition of svdrthanumana or
that of pararthanumdna. This point is clearly stated by Dharmottara in his
commentary on the Nyaya Bindu. He writes , 2 5 Pardrthanumanam sabddtmakam
svarthdnumanam tu jndnatmakam. Tayoratyantabhedannaikam laksanamasti.
Tatastayoh pratiniyatam laksanamaklxyatum prakaranabhedah kathyate.
Though two separate definitions for each type are given, we find that the
64
differential property of anumana remains the same in both cases. Different types
of definition of anumana are available in the Buddhist tradition. The earliest
attempt to define anumana seems to have been made by Vasubandhu, who in the
Vada Vidhi defines it as Ndntarlyakdrtha darsanam tadvido anumdnam. A similar
definition is put forth by Dinnaga. This definition lays stress upon the inseparable
connection that unites the hetu with the sadhya and defines anumana as a
knowledge arrived at on the basis of that inseparable connection by a person who
is acquainted with that connection. The term nantarlyaka or anantarlyaka means
necessary nonexistence of one object in the absence of another object. The
Buddhists use another expression, namely, avinabhdva, which also means the
same. The doctrine of trairupyalinga is nothing but an explication of the concept
of nantarlyaka. It implies the presence of hetu in the paksa, its presence in the
sapaksa, and absence in the asapaksa because in the absence of such a situation
there cannot be inseparable connection between hetu and sadhya leading to
inferential knowledge.
Keeping the concept of trairupyalinga as the focal point, Dinnaga2 6 puts
forth another definition that has been given prominence by Dharmaklrti and that
finds greater acceptance in the tradition. In the Nyaya BinduP Dharmaklrti
expresses it as "Trirupallingad yad anumeye jhdnam tad svarthdnumanam," that
is, this definition is based on the actual process that originates inferential cognition.
It is a functional definition on a par with a similar functional definition put forth
by the Naiyayikas, namely, Vydptivitista paksadharmatdjhanajanyamjhdnam
anumiti. Concerning the Buddhist definition of anumana, which is on the basis
of trairupyalinga, Dharmottara2 8 remarks that it is put forth keeping in mind the
origin of anumana. The inferential cognition arises out of the cognition of the
threefold mark. Thus, the cognition of fire (which is not perceived) arises out of
the cognition of smoke.
Stcherbatsky2 9 refers to another definition given by Buddhists based on the
nature of object apprehended in anumana. Anumana is the cognition of an object
that is not revealed to the senses. All objects can be divided into present and
absent. The present are cognized by perception and the absent by inference.
In D harm ottara 3 0 we also meet with the etym ological definition of
anumana. He defines anumana as alihgagrahana sambandhasmaranasya
pascdnmdnamanumdnam. Here anumana is taken to be that cognition that is
implied by the perception of the lihga that characterizes the paksa and the
remembering of the necessary concomitance between the hetu and the sadhya.
Definition of Pararthanumana
The only fu n d am en tal d iffe re n c e betw een svd rth d n u m d n a and
pardrthdnumdna is that the latter consists in linguistic expression of the former. 3 1
Since the expression aspect is the basic point of distinction in the definition of
pardrthdnumdna, this aspect has been highlighted. Thus Dinnaga defines it as
Pardrthdnumdnam tu svadrstdrtha prakdsakanr32 that is, pardrthdnumdna sets
65
forth an object that has been apprehended by oneself. Dharmaklrti also defines it
as trirpaliga khynam parrthnumna . 3 3 khynam is the same as
prakanam, and every khyna or praksana is through vacana. That is why
Dharmottara writes, Vacanena hi trirupam ligamkhyyate. 3 4 Keeping this in
mind, he describes parrthnumna as abdtmaka and svrthnumna as
jntmaka,35
To conclude, in the Buddhist tradition we have a variety of definitions of
anumna put forth on the basis of different considerations. Here we find some
definitions based on etymology and some based on the actual process of anumna.
These definitions are substantially different from the ones given in the other
schools. Whatever differences are there are due to their divergent ontological
positions. All agree that in every inference there are two basic elements, namely,
paksadharmatva and vypti, which must feature in any functional definition of
anumna. Similarly, if any definition is put forth that keep the object in view,
then it has to take into account the paroksa (concealed) nature of the object
whose necessary mark alone is a perceived object. Likewise, in any definition of
the etymological type the implicative nature of the perceptual cognition has to be
brought to the fore. However, the basic feature of the Buddhist definition from
the functional point of view is the concept of trairpyaliga, which is insisted
upon as a necessary prerequisite of every valid anumna.
CONSTITUENTS OF ANUMNA
According to the Buddhist system of logic, like other systems of Indian logic,
the process of anumna involves three basic terms and their interrelations. This
is quite evident from the analysis of the following definition of anumna given by
Dharmaklrti:
Triruplligd yadanumeye jnam tad svrthnumnam36
These three terms are paksa (logical subject), sdhya (logical predicate),
and hetu (reason) or lihga (mark), which logically connects paksa and sdhya.
An analysis of these constituents of anumna and their interrelations follows.
Paksa
Paksa stands for the subject under consideration in the inferential reasoning.
Every inferential reasoning pertains to some individual or class of individuals3 7
about which we want to infer or establish something. It is technically known as
paksa. Etymologically, paksa (pacyate iti paksah) means that to which hetu and
sdhya belong as its properties. In this sense it is also referred to as dharmin, the
underlying substratum, to which hetu and sdhya are ascribed as dharmas. It is
also named as anumeya because it is an object of inferential inquiry. It is not a
mere reference to the bare paksa but to that paksa that is a dharmin and to which
hetu and sdhya are the dharmas. That is why Dharmaklrti defines paksa or
66
cinumeya as jijhasita viseso dhartni.38 Though at the level of objective reality

(paramdrtha sat) Buddhists dont entertain the distinction between dhanna and
dharml, at the conceptual level, which underlies all our worldly behavior, such a
distinction is very much necessary because no conceptualization can take place
without bringing in distinctions in terms of dravya, guna, karma, and jdti.
With regard to the ontological status of paksa Buddhists fundamentally differ
from Naiyayikas. For Naiyayikas, paksa and so on, stand for the objects that are
objectively real. They dont grant any distinction between objectively real and
conceptually real. But in the Buddhist system, there being a clear-cut distinction
between the objectively real and the conceptually real, anumdna is said to pertain
to the latter only. Thus, for example, in the anumdna This mountain possesses
fire because it possesses smoke, the expression this mountain is paksa insofar
as it possesses smoke and fire as its dharmas. When we use the expression
this, it should not be understood as referring to some svalaksana. It refers
only to the conceptualized experience of some svalaksana. Since paksa may
stand for an individual or a class of individuals, a distinction can be drawn
between two types of concept corresponding to a paksa, namely, a concept having
universal denotation and a concept having individual or particular denotation. If
the concept of all men is the paksa in an anumdna like All human beings are
mortal, and therefore they are living beings, then the term all men is the
paksa, which has a universal denotation (sakaladesavrttitva). But in an anumdna
like, This hill possesses fire because it possesses smoke the expression the
h ill is paksa, whose denotation is confined to an individual object
(iekadesavrttitva). Thus, a paksa may have a generalized denotation or a
particularized one.
From another point of view, we can draw a distinction between time-bound
and time-free paksa. A paksa in svabhdvanumana is time-free in the sense
that the dharmita (property possessiveness) of paksa in respect of hetu and sadhya
is not restricted to any particular time. For example, when we say, It is a flower
because it is a rose, the properties of roseness and flowerness as they are
ascribed to the object stand in a relation that is a matter of analytical entailment.
The concept of flower is deduced from the concept of rose as a matter of
analytical entailment, irrespective of any consideration of time. But the relationship
of tadutpatti (causality) stands on a different footing. It is not a matter of analyticity
to arrive at the concept of fire from the concept of smoke. Whatsoever
analysis we may give of the concept of smoke, it will not entail die concept of
fire. It is because the establishment of this relationship is not a matter of linguistic
stipulation but something that is grounded in our experience. It is not that the hill
always has smoke and fire as its (dharmas) properties so that only at those moments
when the hill possesses smoke, can it be inferred that the hill possesses fire.
Thus, the relationship of smoke and fire vis-a-vis hill is time-bound, whereas the
relationship of the object that is the referent of the word it vis-a-vis rose and
flower is time-free.
67
The epistemic status of paksa in the Buddhist analysis is quite different from
that of the Nyya analysis. In the early Nyya tradition paksa is understood as
sandigdha sdhyavn, that is, that in which the presence of sdhya is suspected.
Thus, paksa has the status of being doubtful. In the latter Nyya tradition paksa
may have any of the following three statuses:
1.
2.
3.
Having an assured existence of sdhya and yet there being an inquisitiveness to prove
this.
H a v in g no a ssu r ed n e ss abou t the e x is te n c e o f sdhya and there b e in g no
inquisitiveness to prove this.
Having no assuredness but there being some inquisitiveness to prove it.
The difference between the early Nyya position and the Navya-Nyya position
is that whereas in the former the inferential inquiry begins without doubt, in the
latter three different possibilities are accepted in which assuredness and
inquisitiveness in their different combinations in terms of their positive and negative
relations are viewed.
In Buddhist logic, however, instead of doubt (sandeha) being the starting
point of inferential inquiry, inquisitiveness (jijs) is put forth as the chief motive.
This inquisitiveness leads to a desire to prove. It seems that the idea of
inquisitiveness of Buddhists enabled the Navya-Nyya logicians to put forth the
idea of will to prove (sisdhayis). In the course of development in the theory of
anumana we find a logical transition from sandeha to jijs and from jijs to
sisdhayis.
Role of Paksa
Paksa performs a role that is equally significant with the role performed by
hetu or linga. It is the perceptual cognition of the object whose conceptualization
is paksa, which provides the starting point of the inferential inquiry. Possession
of hetu by paksa, technically known as paksadharmatva, is thus the necessary
condition for an anumana to take place. The significance of the role of paksa can
best be understood when we talk of it as a dhannl. If there were no paksa at the
back of which there is a perceptual cognition of some object, the entire process
of inference would have been reduced to an abstract intellectual exercise having
no relevance to the empirical realities. Therefore, the existence of paksa having
some objective reality at its back provides the ground or basis for the inference of
sdhya. If the paksa were such a concept that is barren or empty, having no
reality to fall back upon, it would not provide an sraya (basis) to hem and
sdhya, and it would then be a case of fallacious inference. Not only should the
paksa not be a barren or empty concept, but it should also be such with which
the concepts of hetu and sdhya should not be incompatible. Thus, for example,
lake cannot be a paksa in that case where smoke is the hetu, and fire is sdhya.
Though the Buddhists dont insist on describing the paksa as being the common
substratum (ekdhikaranya or samndhikaranya) of hetu and sdhya, this idea
68
of being the substratum and having paksa and sadhya as its dhamias is not absent
in the Buddhist tradition.
H etu
The other term involved in the process of anumana is hetu or lihga.
Etymologically, hetu means that which takes to an object that is not directly
given (Hinotiti gamayati paroksarthamiti hetuh). Similarly, lihga means that which
leads to the object not directly given (ParoJcsartho lihgayate gamyate*neneti
lihgam). It is also known as sadhana because it is a means for the knowledge of
sadhya (sadhyate aneneti sddhanam).
Hetu is the pivotal element in the process of anumana. It is a necessary mark
that leads to the inference of the marked object. In order to do so, a hetu has to
satisfy three formal characteristics; only then it is known as sadhetu, and it acts
as a sufficient reason for the inference of its marked object.
Hetu is simultaneously related to both paksa and sadhya. It is a dharma of
the paksa and a lihga (mark) or vyapya (pervaded object) of the sadhya. In this
respect it corresponds to the middle term of Aristotelian logic, the role of which
is to connect the minor and the major terms. Here also the dharmata of sadhya in
respect of paksa is established on the basis of hetus, being a dharma of paksa.
Dirinaga, as quoted in the Nyaya Vartika Tika ,39 defines hetu as that property
of paksa that is pervaded by the sadhya, which also is a property of the paksa
(sadhyadharma samanyena vyapto hetuh). In this definition three things are pointed
out:
1.
2.
3.
Hetu is a paksadharma ; that is, hetu is a property o f paksa and must be present in
paksa.
Hetu is the grahyadharma; that is, the dharmata of hetu is directly apprehended.
Hetu is one o f the dharmas of the paksa (paksasya arhsena dharma) because the
paksa also has sadhya as another dharma.
On the basis of these three qualities, the three rupas of hetu have been
formulated, which are discussed subsequently.
T^pes of Hetu
According to Buddhist logicians, there are three types of hetu, namely,
svabhdva (identity), karya (effect), and anupalabdhi (noncognition). Svabhdva
and karya are affirmative, whereas anupalabdhi is a negative kind of hetu. Now,
let us turn to their analysis one by one.
Svabhava H etu (Reason as Identity)

Svabhdva hetu is defmed as the one whose mere existence is sufficient for
the establishment of sadhya .40 For example, in the judgment It is a flower because
it is a rose, the hetu, namely, rose, is sufficient for proving the sadhya, namely,
69
flower. Here the terms rose and flower have one and the same object for
their reference, though they may have different meanings. This sameness of
reference is known as tddatmya (identity) and is responsible for the existential tie
{svabhdva pratibandha) between rose and flower. The term flower contains
the extension of the term rose, and the term rose is a subaltern (vydpya), of
which the term flower is a superaltem (vyapaka). Both are then said to be
existentially identical and become subject and predicate of an analytical judgment.
Karya H etu (Reason as Effect)

The second type of hetu is kdrya hetu or karya lihga, which is in the form of
an effect. It necessarily presupposes its cause. Thus, kdrya as lihga necessarily
leads to its kdrana, which is the lihginA1 The relation between seed and sprout,
fire and smoke, and so on is a relation of causality. This relation is given to us in
our experience. We always find that whenever there is smoke, there is fire, and
whenever there is no fire, there is no smoke. The causal relation is a relation of
succession in contrast to the relation of identity, which consists in simultaneity or
coexistence.
The apprehension of necessary connection between a cause and an effect is
based on perceptual experience, but the relation as such is a matter of mental
construction. In the Nyaya tradition it is accepted that the process of anumdna
may proceed from cause to effect and effect to cause, both ways. That is why
they draw a distinction between purvavat anumdna and sesavat anumdna, the
former based on the kdrya hetu and the latter on the kdrana hetu. The Buddhists,
however, regard the kdrya hetu alone as sad-hetu and not the kdrana hetu because
wherever there is an effect, there must be a cause, but it is not necessary that
wherever there is a cause, there must be an effect.
Anupalabdhi H etu (Reason as Noncognition)

The svabhdva hetu and karya hetu are positive, as stated earlier, insofar as
they help in proving the existence of a thing. The third kind of hetu, known as
anupalabdhi hetu, is negative in nature. It helps in proving the nonexistence of
a thing. Anupalabdhi has been defined as the noncognition of such an object that
otherwise fulfills the conditions of cognizability; for example, a jar is an object
that fulfills the conditions of cognizability. If in a particular place there is
noncognition of a jar, this enables us to infer its nonexistence. So, here
noncognition of the jar is the lihga, and the nonexistence of the jar is the ling in.
The noncognition (of a thing) is to be regarded as the lihga for the nonexistence
(of that thing) as a lihgin, on the ground that if the thing were present, it would
have necessarily been perceived when all other conditions of perceptibility are
fulfilled. Since in spite of the conditions of the perceptibility being present, if the
thing is not perceived, we can legitimately infer its non existence . 4 2 For example:
Thesis: On some particular place there is no jar.
Reason: Because it is not perceived, although the conditions of perception
are fulfilled.
70
A particular place is a place before the eyes of the cognizer. But not
every place is a particular place that is present before the cognizer. Now, it
can be questioned, How is it possible for a jar to be perceptible in a place where
it is absent? It is said to be perceptible, although it is absent, because its
perceptibility is imagined. We imagine this object in the following way: If it
were present on this spot, it certainly would have been perceived. In this case
the object, although absent, is ex-hypothesi (samaropya) visible. It is the object
whose absence is cognized, even though all the causes for its perception are
present. We can judge that the causes for the perceptibility of the object are all
present because we perceive other objects in the same act of cognition but not
diat particular object. Indeed, when two such objects are before us, we cannot
confine our perception to one of them since there is no difference between them
as regards possibility of perception (pratyaksa yogyata). Therefore, if we actually
perceive only one of them, we naturally imagine that if the other were present,
we should likewise perceive it because the totality of necessary condition is
fulfilled. Thus, something fancied as perceptible is imputed. The noncognition
of such an object is called negation of hypothetical perceptibility.
B asically, th ere is only one kind o f a n u p a la b d h i, know n as
svabhdvdnupalabdhi, but in the Pramana Vdrtika4 3 it has been classified under
the following four kinds: ( 1 ) Viruddhopalabdhi, (2) Viruddhakaryopalabdhi,
(3) Karandnuplabdhi, and (4) Svabhavanupalabdhi. In the Nyaya Bindu seven
more kinds are added to them, thus making them eleven in number. These seven
are as follows: (1) Svabhavaviruddhopalabdhi, (2) Kary anupalabdhi, (3) Viruddhavydptopalabdhi, (4) Vydpakaviruddhopalabdhi, (5) Karanaviruddhopalabdhi,
( 6 ) K aryaviruddhopalabdhi, and (7) K ara navirud dhakaryop alabd hi,44
Moksakaragupta has added five more to these, making them sixteen in number.
They are as follows: (1) Vyapakaviruddhakaryopalabdhi, (2) Svabhavaviruddhavyaptopalabdhi, (3) Karyaviruddhavyaptopalabdhi, (4) Karanaviruddhavydptopalabdhi, and (5) Vydpakaviniddhavyaptopalabdhi,45
Sadhya
The third element involved in the inferential process is sadhya or lihgin. It
is the property (<dharma) that is to be inferred in a paksa. It is that property of
the paksa that is cognized through anumdna on the basis of the perceptual
cognition of the other property, earlier referred to as lihga. Though sadhya may
be expressed as a substratum, for example, fire, and it is so in the Nyaya analysis,
in the Buddhist analysis with respect to paksa, it is a property, say, the fieriness
of a given place. In anumdna it is the sadhya, the property belonging to paksa,
which is inferred. The sadhya does not have a status independent of paksa. So in
the Buddhist tradition it is not the sadhya that is the anumeya, nor is the
paksa by itself anumeya, but the anumeya is that sadhya that is a dharma of paksa.
Anumeya (Object of Inferential Inquiry)

In the Nyaya tradition sddhya is given an independent status, and that accounts
for its being the object of inferential inquiry. So in the logical process, it is more
71
significant than paksa. Only in epistemic terms it has a status lower than the
status of paksa insofar as its exisntece is either doubted or is intended to be
established. But in the Buddhist tradition the importance of sddlxya is, so to say,
passed on to paksa. Even then, the role of sddhya cannot be minimized because
it is the cognition of sddhya being the property of paksa, which is the concluding
part of inferential inquiry. So if it is asked what is cognized in anumana, the
answer will not be that the lihga is cognized because with its cognition the
inferential process starts. Nor can it be said that paksa is the object of cognition
because the paksa is to be cognized either with the linga or with the lingin and
never without them, and its cognition with linga is the starting point. So, the real
object of inferential inquiry is the sddhya as it is possessed by the paksa, which
is technically known as anumeya.
A proposition that is unproved and is desired to be proved makes inference
possible. But what exactly is to be inferred or proved? To make the point clear,
let us suppose that the proposition The hill has fire on it is to be proved; but
the hill is already known through perception, and hence die question naturally
arises as to what exactly is here sought to be inferred. It is not quite impossible
to find persons who would declare the hill as such to be the anumeya . But common
people naturally think that, die hill being already perceived, what remains to be
inferred or proved is just the fire. This is the second alternative. We get two other
alternatives as we put major emphasis on eidier the subject (S, hill) or predicate
(P, fire), and again we get a diird one if we put equal emphasis on both subject
and predicate, that is, hill qualified by fire or, in other words, fiery hill. Those
who put major emphasis on the predicate (fire) feel that the anumeya is predicate
qualified by subject, that is, fire qualified by hill or hilly fire. Those who put
equal emphasis on both subject and predicate feel that die anumeya is subject
plus predicate. Thus, we get various answers to the question as to what exacdy
we infer or what precisely is the anumeya.
Paksa dharmata
Paksadharmata constitutes one of the two necessary grounds for the process
of anum ana , the other being vyapti, which we discuss subsequently.
Paksadharmatd stands for the relation between paksa and hetu. It consists in the
judgmentalization of the perceptual cognition of hetu located in paksa. It is a
relational cognition in which hetu is cognized as being a property (<dharma) of
paksa. Paksa is said to possess two different properties, which are hetu and
sddhya. The fact of paksa being the sddhyadharmi, that is, possessing the sddhya
as its property, is inferred on the ground of the paksa being hetudharml, that is,
possessing the hetu as its property. Since hetudharmatd of paksa is directly
cognized (i.e., not inferred), and it stimulates the process of anumana, it has
been taken to ba more significant property than that of the sddhya. Without the
cognition of paksa possessing hetu as its property, the process of anumana
cannot start or be valid. This relation of hetu and sddhya, therefore, is given
special consideration. To take the classical example of the anumana of fire on a
72
hill on the basis of the perceptual cognition of smoke there, the cognition of
smoky hill is characterized as paksadhannatd. Without the cognition of smoky
hill, it is not possible to infer the fiery hill. Mere knowledge of the vydpti between
smoke and fire cannot generate the knowledge of the fire on the hill unless the
smoke is also cognized on the hill. The relation between hill, which ispaksa, and
smoke, which is hetii, is possible only when the two are cognized to be so
related. The sadhya, which is known in vydpti, is a universal, but the sadhya,
known through the paksadhannatd of hetu, is a particular one. In other words,
the vydpti relation is always between two universals, and therefore at the back of
the two relata, there are no individuals to fall back upon, but that is not the case
with paksadhannatd. Here, both types of dhamiatd of paksa, whether that of
hetu or sadhya, are established as having an immediate reference to some individual
facts. Thus, for example, the vydpti sambandha between smoke and fire is
between two universals, but the paksadhannatd sambandha is grounded in the
conceptual cognition of hetu and paksa, which also have some underlying svalaks
anas (svalaksana prstha bhdvi). The relation of paksadhannatd is conditional
and contingent. In this respect it differs from the vydpti relation, which is necessary
and unconditional. The conditionality and contingency of the paksadhannatd are
because of the fact that the paksa does not necessarily possess hetu as its dhanna,
as it depends on the presence of certain conditions. Similarly, the hetu also is not
exclusively present in paksa. It can be present in any other thing where conditions
conducive to its presence are available; for example, it is not necessary that the
hill should always be smoky or that the smoke must be present only on the hill.
The relation of paksadhannatd is the relation between a substantive and an
2Ld]tciivt-dhanni-dhanna sambandha. Paksa is always a substantive, and hetu
an adjective. The order of the relata can never be reversed, and if it is reversed,
then it will be an altogether different thought process. The idea of smoky hill
necessarily implies that smoke is the dhanna and hill is the dhamu. If the
position of the relata is reversed, then it will be a case of smoke on the hill,
and in this case hill becomes the dhanna, and smoke becomes the dhanni. The
concept of smoky hill is altogether different from the concept of the smoke
on the hill.
The hetu that is a dhanna of paksa is not any object that may be taken to
characterize that paksa. It should be rather such an object that is essentially in
the form of a lihga being necessarily concomitant with another object that is its
lihgin. The implying power of hetu is by virtue of its being a necessary associate
of sadhya, and, therefore, only such a hetu is a dhanna of paksa. Thus, in the
case of smoke it is in enabling us to infer fire that it is a hetu, not as smoke-quasmoke.
Vyapti or Avinabhava
The concept of vydpti is central to every theory of anumdna. Vydpti stands
for a relation of necessary concomitance, positive or negative, between two classes
of facts such that one inevitably leads to the other. The entire process of anumdna,
73
as has been said, is based on such a relation between the linga (one that leads)
and the lihgin (one that is led), which can be understood in terms of necessary
dependence (avindbhdva niyama). The significance of vyapti is indicated by the
facts that there can be no anumdna in its absence and that every definition of
anumdna directly or indirectly has to bring it in.
Though we do not have any information about the analysis of vyapti by preDinnaga thinkers, Dinnaga referred to it in his statement expressing the
paksadhannata and vyapti as the two grounds of anumdna. In the Pramana
Sam uccaya46 he writes, Grahya dharm astadansena vyapto h e tu h . In
Dharmaklrti we find its detailed analysis. Etymologicaly, the word avindbhdva
means a -F vina + bhava, that is in the absence of sadly a necessary absence
of hetu. Here, the term vma stands for absence of sadkya, the term bhava,
stands for presence of hetu, and the term a stands for the negation (of the
presence of hetu). Thus, it implies absence of hetu in the absence of sddhya.
Apparently, it seems to have a negative meaning, but it has a positive implication
also. Avindbhdva is a relation between two such tilings where one thing cannot
be present without the other. Dharmaklrti also uses the expression svabhava
pratibandha, which means existential tie. Existential tie means the existence
of one thing tied to the other, which means a dependent existence. This may be
in the form of a causal relation or an analytical relation. For example, the
dependence of effect is known to us. Similarly, an analytically deduced fact by
its very essence depends on the fact from which it is deduced. Thus, there is a
svabhava pratibandha (existential tie) between cause and effect and between the
deduced object and that from which there is deduction. The example of the
former type is the relation between smoke and fire, and of the latter, between
rose and flower. We can deduce one fact from another only if the two facts are
simultaneous, and we can have causal connection only between two such facts
that are in immediate succession.
It may be asked, Why is it that we can infer one fact from another only if
there is existential dependence? The answer given by Buddhist logicians is that
this is so because if a fact is not dependent on the other, it cannot be invariably
and necessarily concomitant with the latter. 4 7 There will be no invariability. 4 8
Thus, the possibility of deducing one fact from another depends on an invariable
and necessary connection that precludes the existence of one without the existence
of other. Therefore, if two facts are existentially connected, we can assert that
one of them cannot exist independently of the other, and therefore from the
presence of the one follows the presence of the other.
The svabhava pratibandha (existential tie) is always that of the linga with
lihgin. Explaining this, Dharmottara writes that linga is always dependent on the
lingin, whereas the lihgin is independent of linga. That is why linga is said to be
tied-to, and the lihgin is said to be not-tied. That which is tied is the gamaka,
and the one to which it is tied is said to be its gamya. That which is not existentially
tied to anything particular will not have the relation of invariable concomitance
with the thing, but that linga that is not untied has the relation of invariable
74
concomitance with its lingin (which itself is not tied) because the former does not
deviate in its occurrence with the latter. This invariable concomitance is known
as avindbhava. On the basis of this invariability the gainya-gamaka-bhdva is
established. In the absence of invariable concomitance there can be no
ganvya-gamka-bhdva because the linga by itself cannot reveal the lingin, unlike a
lamp, which can illuminate its objects. The determination of lingin is on the
basis of invariable concomitance. Thus, on the basis of svabhava pratibandha
there is avindbhava, and from avindbhava follows gamya-gamaka-bhava. This is
meant when it is said that on the basis of svabhava pratibandha alone one object
leads to another. 4 9
Hetu is known as vyapya, and sddhya is known as vyapaka. According to
Dharmaklrti, vyapti being the dharrna of both vyapaka and vyapya, it can be
expressed in two ways: the presence of vyapaka is necessary for the presence of
vyapya, and vyapya can exist only when vyapaka exists. These two conditions
are, respectively, known as anvaya and vyatireka.50 Areata has explained this as
follows: An object that has vyapya as its property will also necessarily have
vyapaka as its property. This is technically known as vyapakadhannata. Here
the vyapyata of the vyapya is known through the vyapaka. Similarly, when an
object has vyapya necessarily by virtue of its possessing vyapaka, then it is
known as vyapyadharmata. By violating this regulation there cannot be the
establishment of lihga-lihgi-sambandha .5l Thus, in short, the avindbhava stands
for the regulation that the linga can be present only in the presence of lingin and
that the absence of lingin necessarily implies the absence of linga.
According to Buddhist logicians, there are only two types of vyapti, namely,
tadatinya and tadutpatti. It can, therefore, be asked why there are only two
types. The answer is that the necessary connection of one with another means
that the existence of the former is necessarily dependent on the existence of the
latter. Now one things existence could necessarily depend on the existence of the
other only under two conditions: ( 1 ) if the latter causes the former or (2 ) if the
latter is a part of the former. No other condition makes the existence of one thing
necessarily dependent on the existence of another. Hence, Dharmaklrti asserts
that the relation of causality and that of essential identity are the only two necessary
relations . 5 2
Vyapti or avindbhava is a relation of necessary concomitance that is universal
and invariable, but the problem is how we apprehend the vyapti relation between
any two given phenomena. For this different schools of logic in India have given
different answers. According to Buddhists, the relation of vyapti is not directly
apprehended in perception, as all relations are conceptual construction. According
to Dharmaklrti, the relation of vyapti is based on our knowledge of either causality
(tadutpatti) or identity (tadatmya), as an effect cannot be conceived to be
independent of a cause, and hence effect is a proof of the cause, and as regards
the two things whose nature is fundamentally identical, there can be no separation
75
between the two , 5 3 as that would be tantamount to forfeiture of their own essential
character, which is inconceivable.
It can be objected that Buddhists have reduced all vyapti relations to causal
or identity relations. But it can be pointed out that certain relations of uniformity
cannot be reduced to relations of causality or identity. Thus, for instance, the
impending rainfall is inferred from the movement of ants, but the concomitance
in such a case cannot be traced to causality or identity.
Buddhists may reply that mere concomitance in presence and absence cannot
constitute sufficient evidence of its inevitability unless the contrary possibility is
debarred by the method of tarka. The method of tarka can be employed only if
the relation is understood to be one of causality or identity because no other
relation can be conceived to be invariable and uniform. It should be observed
that there must be a causal relation, though indirect, between two sets of connected
phenomena. They must be coeffects of the same set of causes and conditions;
otherwise, the invariability of the relation cannot be explained. Such a relation of
invariability is to be constructed or established on the basis of observation.
However, it m ust be noted that the mere observation of positive and
negative instances does not give rise to the knowledge of vyapti, which has to be
constructed by the conceiving mind. Of course, the mind has the capacity of
doing so, and observation only provides a stimulus for that.
In granting the constructing capacity of mind to give us the knowledge of
vyapti, Dharmaklrti assumes two things: every event has a cause, and the same
cause always uniformly produces the same effect. In other words, there is general
regularity or uniformity in the universe. Whatever is a cause of particular type of
a thing remains forever a cause of that type of a thing. To think otherwise,
namely, that one type of cause does not always produce only one type of effect,
is to go against the logic based on experience. Y cannot be treated as an effect
of X , even in a single case, if all Y is not an effect of some X . It is so
because we call X the cause of Y only if X invariably produces Y.
Moreover, to say that at times Y is produced by X and at times it is produced
by something other than X , that is non-X, would mean that UY possesses
two contradictory natures. Again, this would suggest that the nature of a thing
does not depend on its cause, and to grant this suggestion would mean that the
thing comes into existence without any cause. This, in turn, would make it eternal
and consequently devoid of efficiency, which is the criterion of reality. So, one
type of effect can never be regarded as being produced at times by this type of
cause and at times by that type of cause. When we feel that there are instances of
one type of effect at times being produced by this type of cause and at times by
that type of cause, our feeling is not justified. We commit a fallacy of
nonobservation. The two effects produced by two different types of causes are
not merely of one type. We are deceived by their outward similarity. A close
examination may reveal that they, in fact, belong to two different types . 5 4
76
Thus, according to Buddhist logicians, what we directly perceive is nothing

but svalaksana. Perception is a series of sensations without any connection or
order in them. Only the buddhi constructs a system or order out of them, through
the instrumentality of the two necessary relations of taddtmya and tadutpatti.
Perceptual cognitions are discrete in nature, and the vikalpa buddhi superimposes
order and uniformity on them. The necessity underlying the relation of taddtmya
and tadutpatti is superimposed upon the perceptual cognition that provides an
occasion for the functioning of the vikalpa buddhi.
Sapaksa
Another significant concept that figures in the analysis of inferential process
is sapaksa. Sapaksa means that which is similar topaksa. Dharmaldrti defines it as:
Sddhyadharmasdmdivyena samdno rthah sapaksah.55
It is similar to paksa by virtue of the common possession of the sadhya,

which is the inferred property and, therefore, metaphorically called its copartner.
In other words, all those objects that possess the property to be inferred are to be
known as sapaksa in as much as they are similar to paksa in that respect. The
word sa is a substitute for samdna.56 It should, however, be borne in mind that
this similarity is not absolute because the possession of sadhya in sapaksa is a
matter of certainty, whereas the possession of a similar property by the paksa
needs to be proved. That is why some of the thinkers belonging to the early
Nyaya school define paksa as samdigdhasadhyavan paksah (i.e., paksa is that
object where the presence of sadhya is suspected) and sapaksa as nis'citasddhyavana
sapaksah (i.e., that object where the presence of sadhya has been well known).
However, the two are similar by virtue of the fact that they possess sadhya as their
property. This property in Buddhist thought is always a sdmdnyalaksana because
no svalaksana can ever be a property. 5 7 Thus, in the example of fire being inferred
on a hill on the basis of smoke, fire is the property that is inferred in relation to
the hill. Therefore, hill becomes a paksa, and all those instances, like kitchen,
where fire is known to be a property, constitute sapaksa, because they are similar
to paksa in commonly possessing the property of fire.
The paksa and sapaksa, even though similar in their possession of the common
property, which is sadhya, are dissimilar in several other respects. Paksa refers
to an object that is presently given, whereas sapaksa refers to such object(s) that
have been known in the past. Therefore, a sapaksa is always to be remembered
and not presently perceived. Second, in the case of paksa it is always numerically
one, but sapaksa may be more than one. However, Buddhists do not insist on
numerical multiplicity of sapaksas. In the Hetu Cakra Damaru Dirinaga maintains
that there should be at least one instance of sapaksa where hetu is present
along with sadhya.
77
Asapak$a or Vipak$a
That which is not similar to pak sa is known as asapaksa or vipaksa. That is
why Dharmaklrti defmes it as :
Na sapaksosapaksah 58
In fact, it is dissimilar to both paksa and sapaksa. Though the basic contention
here is to point out its dissimilarity with sap aksa , its dissimilarity from paksa
also becomes evident. A sapaksa is dissimilar from sapaksa in that it is never a
possessor of the property commonly possessed by pa ksa and sapaksa.
A sapaksa can be of the following three types:
1. Different from sapaksa (anya);
2 . Contrary to sapaksa (viruddha);
3. A b sence o f sapaksa (abhava).59
Of the three, abhava is the most fundamental, and anya and viruddha cannot
be conceived so long as there is no abhava. The conceptions of anyatva. and
viruddhatva include the conception of abhava because through the analysis of
these two conceptions the third one is revealed. When the anya and viruddha are
realized, they are realized as possessing the form of abhava of the sapaksa.
Thus, abhava is conceived as something representing the sapaksabhava directly,
and anya and viruddha are conceived indirectly. 6 0
Role of Sapaksa and Asapaksa

Sapaksa and asapaksa are basically relational concepts. Sapaksa stands for
the positive relation consisting of the presence of sadhya in paksa, and asapaksa
stands for the negative relation indicating the absolute absence of the former in
the latter. These two become elements of the process of anumdna when they are
taken as aspects of trairupya lihga. Here they are concerned with the regulations
of the presence and absence of lihga in sapaksa and asapaksa, respectively. The
lihga must be present apart from pak sa at least in one sapaksa, and it must be
absolutely absent in every case of asapaksa. Thus, we get the two riipas of the
lihga as sapakse sattvam and asapakse asattvam. The concepts of sapaksa and
asapaksa are only bilateral as they involve the relation between paksa and sadhya,
whereas the concepts of sapakse sattvam and asapakse asattvam are trilateral as
they involve hetu also, along with paksa and sadhya. In sapaksa and asapaksa
the sole consideration is the presence and absence of the sadhya, whereas in
sapakse sattvam and asapakse asattvam prominenace is given to the presence
and absence of hetu. In sapakse sattvam and asapakse asattvam the presence or
absence of hetu is governed by the rule of concomitance. Therefore, we have
only these two types of regulation.
78
H etu and Its Rupas: Ttairupya and Pancarupya

The Buddhist theory of anumana, as we saw earlier, is rooted in the concept
of gamya-gamaka-bhava. Anumana is that thought process in which the cognition
of the lirlga acts as a gamaka and leads to the inferential cognition of the lingin,
which thus is the gamya. No doubt this gamya-gamaka relationship cannot be
established between any two cognitions; there has to be the necessary connection
in the form of avinabhava. This implies that only a particular cognition can be a
linga for another specific cognition, which will be its lingin. The process of
anumana begins with the cognition of the linga. Therefore, the linga provides
the starting point of the inferential process. It is the logical ground upon which
the subsequent cognition of lingin depends. In the Buddhist tradition linga and
lingin stand for construed facts (adhyavasita) rather than real facts (grahita). The
two construed facts are so conceived that one is taken to be a linga of the other.
But, as we said, any two such facts cannot be arbitrarily taken to be the linga and
lingin. Therefore, it has to be seen that a particular fact is really a linga of
another fact, which is its lingin.
The establishment of the relation between linga and lingin and the cognition
of the linga constitute the basis of inferential process, and therefore they can be
taken to be premises. The transition from linga to lingin is the conclusion. If the
premises are not wellgrounded, the conclusion entailed by them also camiot be
logically valid. The linga constitutes the pivotal element in the premises. Whenever
anything is taken to be a linga in respect of another thing taken as a lingin, there
are always two possibilities conceivable. A linga may be a genuine linga if it
really stands for its lingin. But that linga will be termed fallacious that does not
lead to something conceived as its lingin. In such a situation the lingin doesnt
have that linga as its proper linga. In fact that linga is not at all a linga in respect
of that lingin. That linga may be a linga as some other lingin than the one in
question. Thus, in the case of the present lingin, that linga is not a linga but a
lihgdbhasa. When a linga is employed as a ground for inferring the lingin, the
linga is known as hetu. So, if hetu is not genuine, then it is known as hetvdbhasa.
Thus, a distinction has to be drawn between hetu and hetvdbhasa or, to use a
different set of phraseology, between sadhetu (valid reason) and asadhetu
(fallacious reason). In other words, there has to be some distinctive marks of
sadhetu to differentiate it from asadhetu. Since the process of anumana is grounded
in hetu, if the hetu is sadhetu, the anumana will be valid, and if it is asadhetu,
then the anumana will be invalid. In order to have a logically valid and sound
anumana we must take care to see that hetu is sat and not asat. Different systems
of logic in India have put forth a different number of characteristics a sadhetu has
to possess. Buddhists have advocated the theory of trairupya, whereas Jainas
have reduced the three rupas to one (ekarupya), and Naiyayikas have added two
more rupas to these three, making them five (pancarupya).
79
THE THEORY OF TRAIRUPYA

According to Dihnaga and Dharmaklrti, anumana stands for the cognition
of the lingin on the ground of the cognition of linga. The ling a has to be
characterized by three rupas in order to be a logically valid linga. The Buddhist
system of logic insists that there are three and only three essential characteristics
of a valid linga. This is so because there is only a threefold requirement of the
linga being related to (1) paksa, (2) sapaksa, and (3) asapaksa. Every linga
must possess all the three characteristics simultaneously, only then it is a
trirupalinga or trilaksana hetu and can be made use of in the process of inference.
The doctrine that a linga must possess three essential characteristics is known as
trairiipyavdda or the theory of trairupyalihga.
(a) Dinnagas Formulation

The first systematic formulation of the theory of trairupya is said to be
by D ihnaga, though a referen ce to it is also found in the w orks o f
Vasubandhu. 6 1 Uddyotakara in his Vartika cites Dinnagas formulation of trairupya
as follows: anumeyetha tattulye sadbhdve nastitdsati that is, existence in the
anumeya (paksa), in what is like the paksa (sapaksa), and nonexistence in what
is not like the paksa (asapaksa).62 We can render in English Dinnagas version
as follows:
1.
2.
3.
Its presence in the subject o f inference.

Its presence in similar instances.
Its absence in dissimilar instances.63
The first condition lays down the requirement of paksadhamiata. It regulates

the relation between linga and anumeya. The term anumeya has been ambiguous
and is used differently in the Buddhist and the Nyaya traditions. In the Nyaya
tradition it stands for sadhya, which is the object of inferential cognition. But
for Dihnaga and his followers it always stands for the paksa, which is a dharmi
and of which sadhya is a dharrna. Though Dihnaga doesnt seem to be very
explicit on this, by anumeya he meant anumeyadhannin, that is, paksa and not
anumeyadharma because the other expression tattulya clearly means like
that, that is, like die paksa (sapaksa). The second condition regulates the relation
between linga and sapaksa. It states the necessity of the presence of linga in a
sapaksa, but from its wording it is not clear whether the presence is essential or
not, nor is it clear whether the presence is in all sapaksas or in at least one only.
However, it should be understood as expressing the necessity of the presence of
linga at least in one sapaksa. This is so because the second condition refers to
the positive concomitance between hetu and sadhya, the reference to one instance
of which is logically sufficient to fulfill the requirements of an udaharana. The
third condition regulates the relation of linga with asapaksa and states its absence
in the same. Like the first two conditions this also is ambiguous and may be
understood as requiring the necessary absence of hetu in asapaksa or as requiring
80
the necessary absence of hetu alone in asapaksa. The intention of Dirinaga seems
to be that hetu should be absent in all asapaksas. This is because of the
requirements of inverted concomitance. Not only must there be a statement
giving out the conditions for the presence of hetu, but there should also be a
statement of the conditions that necessitate the absence of hetu. The conditions
that necessitate the absence should be more than the conditions that guarantee
the presence of hetu, because when we talk of presence, it is always in respect of
one individual, whereas when we talk of absence, it is necessarily in respect of
the entire class. Thus, the statement of sapaksa is particular in nature and that of
asapaksa is universal. The element of necessity or unexceptionality is available
only in the latter. From this it is quite evident that the logical status of the two
statements is not the same, and hence the asapaksa cannot be regarded as just
the negative corollary of the first.
(b) Uddyotakaras Objection

It seems that Uddyotakara was not fully aware of the precise sense in
which Dirinaga talked of the three rupas of hetu. Because of the apparent
ambiguity he pointed out alternative interpretations of each of the three rupas
and tried to expose their untenability on some logical grounds. Uddyotakaras
examination of Dirinagas formulation is as follows.
In the statement of the first rupa, the expression anumeye sadbhava was
not free from ambiguity, and as a consequence of that, Uddyotakara examined its
two possible interpretations, namely,
1.
2.
The hetu is present in the pciksa only, and

The hetu alone is present in the paksa.
To point out the difference in the two interpretations the following symbolic
formulation may be helpful:
(i)
(ii)
b is present in a only = every b is a = no non-a is b.

only b is present in a = every a is b = no noti-b is a.
From the preceding it is quite evident that these two interpretations

dont mean the same thing, and therefore theformulation of Dinnaga was
replete with ambiguity. The formulation of thesecond rupagiven byDirinaga
was also ambiguous in the same way, which led Uddyotakara to give two different
interpretations, namely,
(i)
(ii)
The hetu is present in similar instances only.

The hetu is present in all similar instances.
In the same way Dirinagas formulation of the third rupa was subjected to
two different interpretations by Uddyotakara as follows:

(i)
(ii)
81
Only the hetu is absent in the dissimilar instances.

The hetu is absent in the dissimilar instances only.
Though Dinnaga has given his unambiguous version in the Hetu Cakra
Damaru, where the presence or the absence of hetu in relation to sadlrya is
well regulated, perhaps he did not do so in the Pramna Samuccaya, from
which Uddyotakara has quoted him.
(c) Dharmaklrtis Reformulation

D innagas account of trairpya was given a more rigorous form by
Dharmaklrti. He did so by associating the word eva with each of the three
marks and by qualifying the entire expression by the word nis'citameva. The
other modification he introduced was the use of the terms "sapaksa and
asapaksa to remove all sorts of ambiguities.
We find that it was only to give Dirinagas formulation more precision that
Dharmaklrti put the emphasizing particle eva with the entire expression. With
this addition the first condition, for example, gives the emphatic meaning of
impossibility of absence to the assertion.
(d) Dharmottaras Modifications

The ambiguity of nonquantification that vitiated Dirinagas formulation
was sought to be removed by Dharmaklrti by adding the restrictive word eva, "
but unexpectedly, his modification caused further ambiguity. That is why
commentators from Dharmottara onward had to struggle hard to interpret it in a
satisfactory way. Dharmottara had to face a dilemma on this account while
commenting upon the second and third rpas. The second rpa apparently meant
only in the sapaksa hetu must be present, but by implication it meant the hetu
must be absent in all asapaksas. But then the second rpa will be another way of
saying the same thing as the third rpa. This renders the third rpa superfluous,
but this was not the intention either of Dinnaga or of Dharmaklrti.
In order to remove this ambiguity D harm ottara suggested another
modification, that the expression niscitam should be added to all the three
rpas to render them free from ambiguity. 6 4
Thus, his statement, illingasyanumeye eva sattvam sapakse eva sattvam
asapakse csattvameva niscitam can be interpreted as follows:
1.
2.
3.
Lingasydnumeye (eva) sattvam niscitam.

Sapakse (eva) sattvam niscitam.
Asapakse csattvam (eva) niscitam.
In English it can be rendered as follows:

1.
2.
Existence only (never nonexistence) in the paksa.

E x is t e n c e o n ly in th o se th in g s that are sim ila r to paksa (never in th in g s
that are not similar to paksa).
82
3.
Only nonexistence (never existence) in things that are not similar to paksa.
(e) Stcherbatskys Interpretation

Stcherbatsky has expressed Dharmaklrtis version in three different ways as
follows:
(i)
(ii)
The presence o f the reason in the subject, its presence ju s t, that is, never absence.
Its presence in similar instances, just in similars, that is, never in dissimilars, but
not in the totality o f the similars.
(iii) Its a b s e n c e fro m d is s im ila r in s ta n c e s , its a b s e n c e j u s t , that is, nev er
presence, absence from the totality o f the dissimilar instances.
It seems that the expression of the second condition just given has been
defective in two ways. First, the implication, namely, never in dissimilars is
not intended by Dharmaklrti, nor does it follow from the expression sapakse eva
sattvam (niscitam) as implying necessary presence of the hetu in at least one
similar instance. Second, the expression but not in the totality of the similars
is also faulty insofar as it implies that there should not be presence of hetu in the
totality of similars. Its proper wording should have been but not necessarily in
the totality of similars. Because of these defects the second and the third conditions
have been seen to be mutually implying each other. 6 5
The second mode of the expression of trairupya is as follows:
(i) The necessary presence o f the reason in subjects totality.
(ii) Its necessary presence in similars only, although not in their totality.
(iii) Its necessary absence from dissimilars intheir totality.
This way of expressing trairupya is free from the defects referred to earlier
because it draws a clear distinction between presence only in sapaksas and
necessary presence in at least one sapaksa. Only when the second rupa is
understood in the former sense does it overlap with the third rupa, but not when
taken in the latter sense.
The third way of expressing trairupya is nothing but an abbreviation of
the second. It is as follows:
1.
2.
3.
In subject wholly.
In similar only.
In dissimilar never.
(f) Chis Exposition

Chi has given the Chinese version of trairupya, which seems to be free from
ambiguity as follows:
(i)
(ii)
The pervasive presence of the hetu in the subject.

The necessary presence of the hetu in som e similar instances.

(iii)
83
The pervasive absence o f the hetu from dissimilar instances.
In the preceding rendering the use of the word pervasive in the first
and the third rupas and of the word necessary in the second rupa refer to the
distributive quantification of hetu. Similarly the phrase necessary presence
means assured presence or not failing to be present. Chi has defined the
notion of pervasive presence as follows:
Pervasive presence of b in a .
= b is present in every a .
= every a is ?.
The notion of pervasive absence is defined by him as follows:
Pervasive absence of b from 0 .
= b is absent from every a .
= no a is b.
The notion of necessary presence is defined by him as follows:
Necessary presence of b in a.
= ? is present in atleast one a , almost every a
= at least one a, at most every a is 7.
In accordance with this understanding he interprets trairupya as follows:
I rupa:
The property of g is present in every thing which possesses the property /
= Everything which possesses the property/possesses the property g.
= For every x, x is an f implies x is g.
II rupa:
There is at least one occasion in which the property g is present in a thing
which possesses the property h apart from the thing which possesses the
property/w hich remains to be proved.
= Apart from the thing which possesses the property / at least one thing
which possesses the property h possesses the property g .
= For some X which is n o t/, X is both an h and g .
HI rupa:
There is no occasion in which the property g is present in things which
possess the property of non-h.
= Nothing which possesses the property non-h possesses the property g .
= For no X , X is both non-h and a g .
84
On the basis of this interpretation Chi proposes to resolve Dharmaklrtis

dilemma on the interpretation of eva (only) in the second rupa as follows:
Only presence.
= Only presence of the property of the hetu in similar instances but not
otherwise.
= Only presence of the property of the hetu in similar instances but not
utter absence of its property in all similar instances.
= The presence of the property of the hetu in at least one similar instance.
Understood in this way, the second rupa doesnt overlap with the third rupa,
and the problem of redundancy is overcome.
After discussing the Buddhist theory of hetu-trairupya in detail, let us attempt
a comparative account of the different theories of hetu-rupa attempted in the
three systems of logic, namely, Buddhist, Nyaya, and Jaina. All three systems
have differences with regard to the required rupas of hetu. Buddhists insist on
three rupas only, but Naiyayikas accept five rupas of hetu, and Jainas emphasize
that only one rupa is necessary.
Nyaya Theory of Pancarupya
Nyaya logicians emphasize the fact that hetu or lihga is the central element
in the inferential process. It is related to paksa as well as sddhya, and it occurs in
all significant premises, namely, hetu, uddharana, and upanaya. The validity of
inference depends, to a great extent, on hetu; and that is why a fallacious inference
is known as having hetvabhasa. Nyaya logicians therefore have taken great pains
to expound the characteristics of a good hetu, because if the hetu is sadhetu, then
the inference will be valid, and if it is asadhetu, the inference will be invalid.
Naiyayikas enumerate the following conditions of a sadhetu:
1. Pakadharmatvam. Hetu must be a dharrna or characteristic of paksa.
This means that the hetu should have its locus (adhikarana) in paksa, that is, it
should reside in, or be related to, paksa. Thus, the paksa should never be without
hetu, and nothing can be paksa if there is no hetu related to it.
2. Sapaksesattvam. Hetu must be distributively related to sddhya. This
means that whenever hetu exists, in all such cases sddhya must be present. This
means that the necessary condition for the occurrence of hetu is the occurrence
of sddhya .
3. Vipaksadvyavrttih. Hetu must be absent in all such cases where sadhya
is absent. This means that the absence of sddhya necessarily implies the absence
of hetu. So, in all asapaksas, that is, where sddhya is absent, hetu must also be
absent.
4. Abadhitavi$ayatvam. Hetu should not be such as to be contradictory to,
or incompatible with, the nature of sadhya. This is so because the function of
hetu is to establish sddhya, but if it is incompatible with sddhya, it will disprove
sddhya.
85
5.
A satpratipaksatvam or Aviruddhatvam . Hetu should not be such as t
have a rival hetu that is competent to invalidate it.
Of course, Naiyyikas make it clear that all these five rpas are not
simultaneously present in all hetu. For example, in a kevalnvayi anumna
the third condition will not be applicable. Similarly, in the kevalavyatireki
anumna the second condition will not be applicable . 6 6 Hence, it has been
said that a sadhetu satisfies the five or at least the four conditions.
If we compare the Nyya theory of pahcarpya with the Buddhist theory
of trairpya, we find that the first three rpas of the Naiyyikas correspond
to the trairupya of the Buddhists. Of course, the details in the formulation of
these three rpas are very much different in the two traditions, but we can still
regard them as having some rough correspondence. But the last two rpas of the
Nyya theory are not accepted and will not be acceptable to Buddhists. Now it
can be asked why Buddhists do not accept the last two rpas, The reason is that
Buddhists believe in the theory of pramnavyavasth, which is the opposite of
the Nyya theory of pramnasampalava. So the verdict of one anumna, if
falsely drawn, can be contradicted by some other pramna in the Nyya position,
but the verdict of one anumna cannot be contradicted by another pramna in
the Buddhist position. Therefore, there is no possibility of satpratipaksa here . 6 7
Second, the basis of anumna, according to Buddhists, is lihga-ling-bhva,
between any two concepts. We shall never establish lihga-ling-bhva if they are
of o p p o site nature. T h erefo re, there w ill never be an occasion for
abdhitavisayatvam.
Third, the introduction of the particle eva in (2) and (3) at proper places
implies that a hetu has a necessary connection with the sdhya. Thus, as a
hetu's necessary connection with the sdhya is covered by conditions (2 )
and (3)they being a modification of the corresponding conditions of the Nyya
Vaisesika schemethere remains no possibility of its being either counterbalanced
by another hetu or contradicted by a noninferential pramna. So, for Buddhists
conditions (4) and (5) formulated by the Nyya-Vaisesika logicians become
redundant or inapplicable.
Though there has been a lot of controversy between Buddhists and Naiyyikas
as to whether only three rpas or five rpas are to be accepted, the whole
controversy appears to be futile because they are two different traditions having
different types of requirements. The Nyya tradition stands in need of five rpas,
whereas in the Buddhist tradition only three rpas are possible, and therefore the
theories of pahcarpya hetu and trairpya. hetu are perfectly in order in their
respective systems.
Jain a Criticism of Trairpya
The Jaina tradition maintains that hetu has a unitary nature, and therefore it
possesses only one rpa. Hetu is defmed as that which is inseparably connected
with sdhya. This means hetu is that which is present only in the presence of
sdhya and which is necessarily absent in the absence of sdhya. Akalankadeva
86
defines hetu as sddhy avinabhdva vinibodhaikalaksana. 6 8 Some Jaina logicians

have described this fact with the help of another concept, namely, "anyathdnupapatti.
Vadidevasuri puts it as niscitdtiyathdnupapattyeka laksanohetuh. 6 9 The term
anyathdnupapatti" means that in the absence of sddhya (anyathd), there should
be absence of hetu (anupapatti). By implication it means that hetu should be
present only in the presence of sddhya. So to be sadhydvinabhavi is the sole
characteristic of hetu.
The Jainas have not only insisted on one and only one characteristic of
hetu but they have also put forth a refutation of the theories of trairupya and
pahcarupya.
Patrasvamin seems to be the first Jaina scholar, as quoted by Akalahka
and Vinitadeva, who attempted refutation of the doctrine of trairupya as follows:
Anyathdm ipapannatvam yatra tatra trayena kirn
Nanyathanupapannatvam yatra tatra trayena kirn, 70
In the preceding verse P atrasvam in em phatically m aintains that

anyathanupapannatvam is the only rupa of hetu. If it is present, then what is
the need of three rupas, and if it is absent, then what is the purpose of having
three rupas? Following Patrasvamin, all subsequent Jaina logicians like Akalahka,
Vidyananda, Prabhacandra, Vadidevasuri, Anantavlrya, and Hemacandra have
also refuted the doctrine of trairupya. The preceding verse of Patrasvamin has
been quoted by Santaraksita in the Tattva Samgraha in the form of purva-paksa
presenting the Jaina position, and there he has refuted the Jaina objections against
trairupya. The basic objection put forth by the Jainas is that even an invalid hetu
may have the three rupas, iltasya hetvabhasasyapi sambhavdt. For example, the
argument There is smoke on the hill because there is fire has all the three
rupas, namely, paksadhannatvam, sapaksesattvam, and vipakseasattvam, but
still it is logically invalid because there is no necessary connection (avinabhdva)
between fire and smoke. In other words, there may be fire and smoke on the hill,
and so the condition of paksadharmatvam is fulfilled. Similarly, there can be fire
and smoke in the kitchen, and the condition of sapksesattvam is fulfilled. Likewise,
there will be no fire and smoke in the lake, and the condition of vipakseasattvam
is also fulfilled. Even then fire is an invalid hetu for smoke. Of course, Buddhists
may point out that the trairupya should be understood as qualified by avinabhdva,
and there is no avinabhdva between fire and smoke because there may be fire
without smoke, for example, in an electric hearth. So the relation of fire and
smoke is conditional (sopadhika) and not unconditional (nirupadhika). To this
Jainas have replied that if avinabhdva is to be emphasized, then this amounts to
their position, which means hetu has only one rupa and not three rupas. Jainas
point of emphasis is that the hetu in an argument is valid and competent to prove
the sddhya not because the two exist in the same paksa, as the Naiyayikas say,
but because the two are inseparably related. In the words of Jaina logicians the
hetu is not cognized otherwise than in connection with the sddhya. Accordingly,
87
so far as the essential characteristic of valid hetu is concerned, it is this and this
one only.
Santaraksita has stated and examined Patrasvamins arguments in great detail.
The basic point made by Patrasvamin is that hetu is valid if and only if it has
anyathanupapatti with respect to sadhya. This is the only feature of hetu that
is required, and it takes care of paksadharmatvam, sapaksesattvam, and
vipakseasattvam. To this Santaraksita replies that this concept is nothing but an
abbreviated form of trairupya. Anaythanupapatti includes positive and negative
concomitance, and by its presence in the object that is paksa, paksadharmatva is
also adm itted. Santaraksita not only has defended trairupyavada against
P atrasvam ins criticism but has him self raised some objections against
Patrasvamins theory of ekarupya.71
H etu Cakra Damaru of Dihnaga

The doctrine of trairupya has been explicated by Dihnaga in his work Hetu
Cakra Damaru,12 a primer of Buddhist formal logic. In this work nine different
conceivable relations of hetu with paksa, sapaksa, and asapaksa are presented.
This presentation of the doctrine of trairupya in a wider context was named by
him as the doctrine of hetucakra13 Both these doctrines refer to the extension of
hetu. This doctrine of trairupya represents only three valid relations of hetu with
paksa, sapaksa, and asapaksa, whereas the doctrine of hetu cakra takes for
granted the presence of hetu in paksa, and its relations with sapaksa and
asapaksa are alone taken into consideration. Here three possible ways of the
relation between hetu and sapaksa and hetu and asapaksa are conceived and
analyzed, namely, vyapaka (pervasive presence), avrtti (pervasive absence), and
ekadesavrtti (partial presence) . 7 4 He gives a formal schema of nine valid and
invalid types of anumana based on three possible relations of hetu with sapaksa
and asapaksa. Since the text is very short we can have the advantage of giving it
here in full . 7 5
H etu Cakra Damaru (The Wheel of Reasons)

Homage to Manjusrlkumarabhuta.
H om age to the Omniscient One, who is
The destroyer o f the snare o f ignorance.
I am expounding the determination of
The reason with three-fold characteristics
A m ong the three possible cases o f presence, absence and both
O f the reason in the probandurn,
Only the case o f its presence is valid,
W hile its absence is not.
The case o f both presence and absence is inconclusive,
It is therefore not valid either.
The presence, absence and both .
88
O f the reason in similar instances,
Combined with those, in dissimilar instances,
There are three combinations in each o f three,
The
The
The
The
top and the bottom are valid,

two sides are contradictory.
four com ers are inconclusive because they are too broad,
Centre is inconclusive because it is too narrow.
Knowable, produced, non eternal,

Produced, audible, effort-made,
Eternal, effort-made and incorporeal,
Are used to prove the properties o f being:
Eternal, non eternal, effort made,
Eternal, eternal, eternal,
Non effort-made, non eternal and eternal.
When two tops or two bottoms meet,
The reason is valid.
When two corresponding sides meet,
It is contradictory.
When corresponding corners meet,
It is inconclusive because it is too broad.
When the centers o f two crosses meet,
It is inconclusive because it is too narrow.
Since there are nine classes o f reason ,
Accordingly we have nine sets o f example:
Space-pot, pot-space,
Pot-lightning-space,
Space-pot-lightning,
Lightning-space-pot,
Pot-lightning-space,
Space-action-pot.
The above concerns the determined reason only;
As regards the doubtful ones,
There are also nine combinations of
Presence, absence and both .
Here the presence of hetu in paksa is combined with different types of relations
that a hetu may possess with sapaksa and asapaksa. The combination of these
two sets of possibilities gives rise to nine types. Among these nine possible
relations between hetu and sadhya, only two are valid, and these constitute the II
and III rupas of the doctrine of trairupya, and the remaining seven are graded as
invalid as they are at variance with the doctrine of trairupya. The nine possible
89
relations are as follows:

I:
II:
Sapaksasapaksavyapaka : Pervasive presence in similar and dissimilar instances.

Sapaksavydpaka asapaksdvrtti: Pervasive presence in similar instances and necessary
Ill:
Sapaksavydpaka asapaksaikcidesavrtti: Pervasive presence in similar instances and
IV:
Sapaksdvrtti asapaksavyapaka: Necessary absence in similar instances and pervasive
V:
VI:
Sapaksdsapaksavrtti: Necessary absence in similar and dissimilar instances.

Sapaksdvrtti asapaksaikades'avrtti: Necessary absence in similar and partial presence
absence in dissimilar instances.

partial presence in dissimilar instances.
presence in dissimilar instances.
in dissimilar instances.
VII: Sapaksaikades'avrtti asapaksavyapaka: Partial presence in similar instances and
pervasive presence in dissimilar instances.
VIII: Sapaksaikades'avrtti asapaksdvrtti : Partial presence in similar instances and necessary
absence in dissimilar instances.
IX: Sapaksasapaksaikadesavnti : Partial presence in similar and dissimilar instances.
These nine rupas of the hetu cakra have been represented by Dinnaga in the
form of this diagram:
I
IV
II
V
III
VI
VII
VIII
IX
Referring to this diagram, he writes:

The top and the bottom are valid,
The two sides are contradictory,
The four corners are inconclusive because they are utoo broad .
The center is inconclusive because it is utoo narrow.
Keeping this in view, we can explicate the diagram as follows:

I (corner)
IV (side)
VII (corner)
II (top)
V
(center)
VIII (bottom)
III (corner)
VI (sid e )
IX (corner)
After stating the hetu cakra, Dinnaga proceeds to illustrate the different
rupas with the help of the following examples:
Knowable
Produced
Eternal
Eternal
Eternal
N o n effort-made
Produced
Audible
Effort-made
Noneternal
Eternal
N on eternal
Noneternal
Effort-made
Incorporeal
Effort-made
Eternal
Eternal
90
With the help of these examples we can explain the earlier mentioned verse
like this:
Two tops meet:

Whatever is produced is nonetemal:
VALID.
Two Bottoms meet:

Whatever is effort-made is nonetemal:
VALID.
Two corresponding sides meet:

Whatever is produced is eternal:
Whatever is effort-made is eternal:
Contradictory.
Contradictory.
Corresponding corners meet:

Whatever
Whatever
Whatever
Whatever
is
is
is
is
knowable is eternal:
eternal is noneffort-made:
nonetem al is effort-made:
incorporeal is eternal:
Inconclusive,
Inconclusive,
Inconclusive,
Inconclusive,
too
too
too
too
broad.
broad.
broad.
broad.
Two Centers meet:

Whatever is audible is eternal:
Inconclusive, too narrow.
The statement of the hem cakra, because of its cryptic wording, is unintelligible
by itself, but with the help of examples given by Dinnaga it can be better
understood. Here we take an example of anwnana consisting of three steps because
Buddhists accept only three steps. The three steps are pratijha, hem, and udaharana
of sapaksa and asapaksa. The three terms of anwnana are paksa, hem, and
sddliya. It is presumed that hem is present in paksa (i.e., paksadhamiatva). The
relation of hem with sapaksa is conceived to be of three possible types, namely,
vyapaka, avrtti, and ekadesavrtti. Similarly, the relation of hem with asapaksa
can also be conceived of in the preceding manner. On the basis of the preceding
stipulations the hetu cakra can be exemplified in the following way:
Statement of the example of first form:

Pratijha
Hetu
:
:
Sound is eternal.
because it is knowable.
Udaharana (of sapaksa and asapaksa): like space and unlike pot.
The three terms are:
Paksa
Hetu
Sadhya
:
:
sound.
knowable.
eternal.
In this example the hem, apart from being present in paksa, is also present
in both sapaksa and asapaksa. It renders this argument invalid. Here there is a
fallacy of sadharana anekantika (inconclusive, too broad), because the hem is
present in all three, whereas as per rule it should be present only in the first two.
91
Statement of the example of second form:

Pratijna
:
Sound is noneternal.
Hetu
:
because it is produced.
Udaharana (of sapaksa and asapaksa): like a pot and unlike space.
Paksa
:
sound.
Hetu
:
produced.
Sadhya
:
noneternal.
In this example the hetu is present in paksa, is also present in sapaksa, and
is absent in asapaksa. Thus, it satisfies all the three requirements of trairiipya.
So it is valid.
Statement of the example of third form:

Pratijna
:
Sound is effort-made.
Hetu
:
because it is nonetemal.
Udaharana (of sapaksa and asapaksa): like pot and unlike lightning and
space.
:
sound.
Paksa
Hetu
:
noneternal.
Sadhya :
effort-made.
In this example, the hetu is no doubt present in paksa and sapaksa but is
absent in some instances of asapaksa and is present in others. The hetu has
asapaksaikadesavrtti because ( 1 ) some noneffort-made things are noneternal
like lightning whereas (2 ) some noneffort-made things are eternal like ether.
Thus, the presence of hetu in some asapaksas renders this argument invalid.
Here there is a fallacy of sadhdrana anekantika (inconclusive, too broad).
Statement of the example of fourth form:

Pratijna
:
Sound is eternal.
Hetu
:
because it is produced.
Udaharana (of sapaksa and asapaksa): like ether and unlike pot.
Paksa
:
sound.
Hetu
:
produced.
Sadhya
:
eternal.
In this example, the hetu is present in paksa, is absent in sapaksa and present
in asapaksa. Thus, hetu is contradictory of sadhya. This renders it invalid. Here
there is a fallacy of viruddha (contradictory).
Statement of the example of fifth form:

Pratijna
Hetu
:
:
Sound is eternal.
because it is audible.
92
Udaharana (of sapaksa and asapaksa): Like space and unlike pot.
Paksa
:
sound.
Hetu
:
audible.
Sadhya :
eternal.
Here the hetu is present only in paksa and is absent not only in asapaksa but
also in sapaksa. Here there is a fallacy of asadharana anekantika (inconclusive,
too narrow).
Statement of the example of sixth form:

Pratijha
:
Sound is eternal.
Hetu
:
because it is effort made.
Udaharana (of sapaksa and asapaksa) : Like space and unlike pot and
lightning.
Paksa
:
sound.
Hetu
:
effort made.
Sadhya
:
eternal.
Here the hetu is present only in paksa, absent in sapaksa, but present in
some instances of asapaksa and absent in others. Here there is a fallacy of viruddha
(contradictory).
Statement of the example of seventh form:

Pratijha
:
Sound is noneffort made.
Hetu
:
because it is noneternal.
Udaharana (of sapaksa and asapaksa) : Like lightning and space and unlike
pot.
Paksa
:
sound.
Hetu
:
nonetemal.
Sadhya
:
noneffort made.
Here the hetu apart from its presence in paksa is present in some instances
of sapaksa and absent in others, whereas it is present in asapaksa. Here there is
a fallacy of sadharana anekantika (inconclusive, too broad).
Statement of the example of eighth form:

Pratijha
Hetu
Udaharana
space.
The three terms
Paksa
Hetu
:
Sound is noneternal.
:
because it is effort made.
(of sapaksa and asapaksa) : Like pot and lightning and unlike
are:
:
:
sound.
effort made.
93
Sadhya
:
nonetemal.
Here the hetu is present in paksa, present in some instances of sapaksa and
absent in others, whereas it is absent in all the cases of asapaksa. Thus, the
argument satisfies all the three requirements of the trairupya. So, it is valid.
Statement of the example of ninth form:

Pratijna :
Sound is eternal.
Hetu
:
because it is incorporeal.
Udaharana (of sapaksa and asapaksa) : like space and infinitesimal particles
and unlike action and pot.
Paksa
:
sound.
Hetu
:
incorporeal.
Sdd/iya :
eternal.
Here, no doubt, hetu is present in paksa and in some instances of sapaksa
but is also present in some instances of asapaksa. This renders it inconclusive
(too broad). Here there is a fallacy of sddharana anekantika.
THE AVAYAVAS
Anumana is a complex cognition arrived at as an outcome of a thought
process consisting of several stages known as avayavas. The entire inferential
thought process, when expressed in language, is said to constitute one single unit
named as vdkya, having several constituent elements (avayavas) . 7 6 In case of
pratyaksa being a simple cognition (in the Buddhist tradition) there are no parts,
but that is not the case with anumana, which is a complex cognition having
several parts closely connected together by mutual requirement (paraspara
apeksita sambandha).
Dasa vaya vf Tradition

As regards the complex character of anumana, there is no difference of
opinion among the different schools of Indian logic. But how many parts, this
complex consists of, has been a matter of dispute. Several positions are available
in Indian logical tradition about the number of avayavas ranging from ten to one.
Vatsyayana7 7 refers to a view that held that avayavas of anumana were ten,
namely, jijhasa, samsaya, sakya prapti, prayojana, sanisayavyudasa, pratijna,
hetu, udaharana, upanaya, and nigamana. It seems to be a reference to some
Jaina logicians of early time. Bhadrabahu, for example, refers to the dasdvayavi
vdkya. He is of the view that the number of avayavas is really two only, namely,
pratijna and hetu, but it may be increased up to ten, depending on the grasping
power of the other party. However, it is to be noted that Vadideva even grants that
in dealing with a particular type of person, even one single avayava, namely,
hetu, may constitute anumana. Those who insist on ten avayavas were of the
opinion that the five avayavas have to be added, taking psychological factors in
consideration. But Vatsyayana and other Naiyayikas criticize this view on the
94
ground that the first five members represent not so much the logical grounds
needed for drawing the conclusion as the psychological or epistemological
conditions involved in anumdna. Jijhdsd, though psychologically an antecedent
condition of discussion of hem , has no bearing on the hem and so is outside the
limit of hetu, which aims at proving pratijhd. Sanisaya, too, is a purely psychical
fact, and though it inspires the inquiry and as such initiates the argument, it has
no probative value. Sakyaprdpti likewise is a question of psychological attitude
and by itself has no logical consequence. Similarly, prayojana is only a by
product of the syllogistic argument insofar as it stands for practical application of
the truth ascertained. The fifth factor, namely, samSayavyuddsa, which is arrived
at by the method of tarka, has a remote logical bearing on doubt, but it cannot,
for that matter, be regarded as a part of the process of anumdna because its
function is only to approve and confirm the truth of the conclusion logically
deduced from the premises. Thus, the Naiyayikas point out that the first five
avayavas are of no logical use and therefore do not constitute a part of the
process of anumdna. But the remaining five avayavas from pratijna onward are
the real avayavas, as each of them is essential to the deduction of the conclusion
and to the conviction of the disputant. None of them can be omitted, as each has
a distinct contribution that is not made by the other . 7 8
Naiyayikas consider the last five to be the real avayavas, and therefore their
model is known as pahcavayavlvdkya.19 In this context one may refer to a very
interesting remark, though not very plausible, made by Vatsyayana that in the
N y a y a s c h o o l o n ly fiv e avayavas have b e e n a c c e p te d o w in g to a d e sir e to equate
four premises with the four pramanas: pratijna = sabda, hetu = anumdna,
drstdnta (udaharana) = pratyaksa, and upanaya = upamdna .80 It is noteworthy
that anumdna is here identified with hem only. The Vedantins admitted only the
first or the last three members of the pahcdvayavl vdkya.si A similar view is
expressed by the Mlmamsakas.
PancBvayavi Tradition
According to Naiyayikas, pratijhd is the first avayava because it is the
statement of the thesis to be proved in the process of anumdna. It is the first
avayava insofar as it is the starting point of the process of anumdna. The second
avayava is hem, which consists in adducing a fact capable of proving the sddhya.
The third avayava is udaharana, which stands for a familiar instance known to
possess the hetu, which is invariably concomitant with its sddhya. The fourth
avayava is upanaya. It is an application of hetu to the disputed case after its
probative value has been attested by the udaharana. In the terminology of later
Naiyayikas, it is a statement of pardm aria ,82 The last avayava, according to
Naiyayikas, is nigamana, which is a restatement of the thesis that is well established
through hetu and uddharana. The Nyaya pahcdvayavl vakya can be illustrated
with the help of the classical example:
Pratijhd
Word is nonetemal.
96
between hetii and sddhya. Although the paksa is observed without the sddhya,
the association of sddhya with the paksa is stated in the pratijna on the ground of
the observation of hetu, but nonobservation of such an association leads to a
feeling of uncertainty for which a proof has to be requisitioned. Jayantas position
also seems to be quite weak even from the psychological point of view because
only in a complex and complicated situation do we need all three avayavas;
otherwise, in normal situations hetu (reason) is enough.
Buddhists therefore contend that in an anumana the avayavas should be
chosen keeping in view their logical cogency, and the psychological order
should have no bearing on it. If the psychological factors have a determining
valu e, then even such facto rs as statem en t o f ap p ro v al should be
incorporated as an avayava. If logical cogency is regarded as a criterion,
then pratijna should be excluded in the same way in which jijhasa, sams'aya,
and so on, advocated by the exponent of dasavayava, have been discarded
by Naiyayikas.
According to Buddhists, upanaya, which is an application of hetu and
uddharana, too, is superfluous and has no independent probative force, as it
only reiterates the hetu and uddharana , 8 5
To this objection of Dinnaga and Dharmaklrti, Uddyotakara has given the
following reply. 8 6 The statement of hetu serves only to assign a reason and doesnt
testify that the hetu exists in the paksa. The upanaya emphasizes the presence of
hetu in the paksa and as such has a different function and value from the mere
statement of hetu. Further, the upanaya doesnt reiterate the hetu as such; it
applies the hetu along with vyapti and uddharana to the case in question and thus
leads to the conclusion. The statement of hetu unbacked by vyapti is ineffective
and hence needs upanaya.
Santaraksita, a later exponent of the Dinnaga-Dharmaklrti tradition reacting
to the Nyaya contention, argues that if upanaya is deemed necessary for pointing
out the presence of hetu in paksa, then this amounts to usurping the task of hetu.
In that case what shall be the function of hetul Mere statement of hetu without
reference to its presence mpaksa is absolutely out of place. Therefore, any meaningful
statement of hetu should always be in relation to paksa and sddhya, and if these
two functions are served by the second and the third avayavas, then what is the
need of having upanaya? In fact, the statement of paksadhamiata is the basis of
anumana, and if this is done by both the second and the fourth avayavas, then
either of them should be jettisoned, and upanaya, is not necessary for bringing
into relation the vyapti with hetu, because this relation is understood eo ipso
from the two premises, namely, hetu and uddharana, and these two premises
constitute a perfect anumana, and nothing further is necessary.
In Srldhara we find a reply to Santaraksita regarding the functions of hetu
and upanaya. According to him, the two dont serve the same function. The
second avayava, that is, hetu, also known as apadesa in the Vaisesika tradition,
is the bare statement of the lihga and not the assertion of the relation of lihga
with the paksa. This relation, known as paksadhamiata, is conveyed only by
97
upanaya, and thus upanaya is not a duplication of hetu. This reply of Srldhara
doesnt seem to be pertinent because it is commonly recognized that hetu is the
statement of paksadharmata.
Vacasapti and Jayanta fully realize the cogency of the argument as put
forward by Santaraksita and the weakness of Uddyotakaras defense. But
they once again appeal to psychological evidence. Their contention is that
our argument should be advanced in the same order in which we arrive at
truth in our own experience. Now, we first observe the paksa, say, the hill
and then the hetu the s m o k e . N ext we rem em b er the in v aria b le
concom itance of sm oke and fire as exem plified in the kitchen, and
immediately this invariable concomitance is understood in relation to smoke
on the hill, and the direct result of this is the deduction of the conclusion.
Thus, the five avayavas embody only the order of our own subjective
ratiocination and as such constitute the most satisfying process of anumana.
It must, however, be stated in favor of Buddhist contention that the
psychological account of the process of anumana, should not be confused with
the logical requirement of the truth and validity of anumana upon which alone its
evidential value depends. Psychological evidence as to the subjective process of
reasoning should not be allowed to dictate terms to the constituents of a logically
sound anumana. Logic, as has been pointed out, is concerned with validity and
cogency, whereas psychology is interested in the natural history of mental
phenomena. So, though psychologically pratijha and upanaya may have a
raison d etre, they cannot on that account be taken to be avayavas.
As regards the nigamana, Buddhists insist that this also doesnt require to be
stated, as it follows by a sheer logical necessity from the universal proposition as
stated in the udaharana and from the statement of hetu. Moreover, on the
Naiyayikas, own showing, it is perfectly redundant, being only a repetition of
p ratijha}1
Uddyotakara, however, argues that nigamana is not a useless repetition
of pratijha, as the latter states only what is yet to be proved, and the former
is the statem ent of the proven fact; nor is the statem ent of nigam ana
unnecessary because it serves to dispel a likely error or doubt. Unless the nigamana
is stated, the opponent may still waver as to whether the pratijha is acceptable or
not. The clear statement of pratijha dispels all such doubt and satisfies the opponent
completely. Santaraksita points out that this defense of the Naiyayikas is not
forceful. In fact, there can be no possibility of doubt if the hetu satisfies all the
three logical requirements, that is, if it is trairupya lihga. The conclusion
irresistibly follows from this and from none else. If, on the other hand, the three
rupas are lacking, the statement of nigamana by itself cannot remove doubt
about its validity. Santaraksita refers to Aviddhakarna, who contends that the
premises, being scattered and piecemeal, cannot establish a unitary judgment
unless they are shown to be mutually related, and this relationship is shown by
the conclusion. To this he replies that though the premises are scattered and
piecemeal, they are knit together by a logical bond of mutual compatibility and
98
relevancy, and therefore the nigamana is unnecessary even for the purpose of
showing the mutual relation of the premises . 8 8
Because of the foregoing considerations Buddhist logicians reduce the
avayavas to two, namely, hetu and udaharana, and ultimately these two to one,
namely, hetu, depending on the grasping power of the opponent.
It is proper to conclude this account concerning the number of avayavas
with the words of S. Mookherjee. From the doctrine of ten membered syllogism
reduced to five in the Nyayasutra and still further reduced to two (or one) in
Buddhist Logic, we can trace the history of the evolution of syllogism. Naturally
the psychological and logical factors were mixed together in the doctrine of tenmembered syllogism. In the Nayiyayikas syllogism there has been a bold attempt
to shake off the psychological incumbus, but still the psychological influence did
not cease to be at work. In the Buddhist syllogism as propounded by Dinnaga
and Dharmaklrti, the psychological factors were carefully eliminated and the
syllogism received a perfectly logical shape. But the survival of the example was
a relic of the ancient sway of psychology and this was destined to be
unceremoniously brushed aside by the onslaughts of Jaina logicians . 8 9
Avayavadvaya Tradition
Though the Buddhist account of the number of avayavas can be traced back
to pre-Dirinaga thinkers, 9 0 for want of some definite information we have to
begin with the Nyaya Bindu of Dharmaklrti. In the Nyaya Bindu three avayavas
of anumana are jointly referred to as sadhana. The three avayavas are named
paksa, hetu, and drstanta. The acceptance of paksa, that is, pratijha, indicates
that Dharmaklrti is not aversed to the avayavatraya tradition.
Here, though we find the statement of pratijha it is not, in fact, a part of the
process of anumana.91 Both in the Pramana Vartika and Nyaya Bindu we find
elaborate arguments advanced by Dharmaklrti to point out the nonacceptance of
pratijha as an avayava of anumana 92 The main argument put forth by him is
that the statement of pratijha may be made, but it can be done away with also. In
those cases where pratijha is not stated, it is understood as implicit.; In fact,
from the context itself the reference to pratijha is to be understood, even though
it is not explicitly stated. Thus, only hetu and udaharana are parts of the process
of anumana. In fact, Dharmaklrti goes a step further and states that udaharana
is needed for ordinary minds, but for an intelligent person only hetu suffices. 9 3
In the statement of pardrthanumana Dharmaklrti advocates the model of
avayavatraya, consisting of pratijha, udaharana, and upanaya, but maintains
that only udaharana and upanaya are real avayavas because they alone have
probative value. The examples of the three types of anumana are:
1.
Svcibhdvdniundna
Udaharana
Upanaya
Nigamana
:
:
:
Everything that exists is momentary, like a jar.

The sound exists.
Therefore sound is momentary.

2.
3.
Kdry anumana
Uddharana
Upanaya
Nigcimana
Anupalabdhyanumdna
Uddharana
Upanaya
Nigainana
99
Wherever there is smoke, there is fire, like in

kitchen.
Here there is smoke.
Therefore here there is fire.
W h a tsoev er is p r esen t and is p e r c e p tib le is
necessarily perceived, like ajar.
But there is no such jar being perceived.
Therefore a jar is not present here.94
For Dinnaga and Dharmaklrti the nigamana is the sadhya for which hetu
and uddharana or uddharana and upanaya are the sadhana. Therefore they are
referred to as sadhananga (constituents of proof), whereas pratijha and nigamana
are known as asadhanahga. In the case of svarthanumana, hetu and uddharana
are sadhananga and pratijha, upanaya and nigamana are asadhanahga, whereas
in case of pardrthanumana, pratijha, hetu, and nigamana are sadhanahgas, and
uddharana and upanaya are asadhanahgas. Thus, the Buddhist position is to be
regarded as avayavadvayi.
In conclusion, for Buddhists a statement of anumana is ordinarily
expressed either as pratijha-hetu-uddhrana or as udaharana-upanaya-nigamana.
But from a strict logical point of view neither pratijha nor nigamana is a genuine
part of the process of anumana, and therefore the real process of anumana consists
of only two avayavas, namely, hetu and uddharana or uddharana and upanaya.
This is a view advocated by Dharmaklrti and accepted by all of his followers, like
Santaraksita and Moksakaragupta.
Appendix 1
Nyayapravetokasutram
Sadhanam dusanam caiva sabhasamparasamvide
pratyaksamanumdnam ca sabhasam tvatmasamvide.
Iti sastrarthasamgrahah.
Tatra p a ksd d iv a c a n a n i sa d h a n a m . P a k sa h e tu d rsta n ta va c a n a irh i
prasnikandmapratito rthah pratipadyata iti. Tatra paksah prasiddho dharml
prasiddhavisesana visistataya svayam sadhyatvenepsitah. Pratyaksadyaviruddha
iti vakyasesah. Tadyatha. Nityah sabdo nityo veti.
Hetustrirupah. Kim punastrairupyam. Paksadharmatvarii sapakse sattvam
vip a kse c a sa ttva m iti. Kah p u n a h sa p a ksa h . Ko va vipa ksa iti.
Sadhyadharmasamdnyena samano rthah sapaksah. Tadyatha. Anityes'abdesadhhye
ghatadiranityah sapaksah. Vipakso yatra sadhyam ndsti. Yannityam tadakrtakam
drstam yathakdsamiti. Tatra krtakatvarii prayatnanantariyakatvam vasapaksa evasti
vipakse nastyeva. Ityanityadauhetuli. Drstanto dvividhah. Sadhartnyetia vaidharmyena
ca. Tatra sadharmyena tavat. Yatra hetoh sapaksa evastitvam khyapyate. Tadyatha.
Yatkrtakam tadanityarh drstam yatha ghatadiriti. Vaidharmyenapi. Yatra
sadhyabhave hetorabhava eva kathyate. Tadyatha. Yannityam tadakrtakam drst
am yathakdsamiti. Nityasabdendtranityatvasydbhava ucyate. Akrtakasabdenapi
krtakatvasyabhavah. Yatha bhavabhdvobhava iti. Uktah paksadayah.
Esam vacanani parapratyayanakale sadhanam . Tadyatha. A nityah
sabda iti paksavacanam. Krtakatvaditi paksadharmavacanam. Yatkrtakam
tadanityarii drstam yatha ghatadiriti sapaksdnugamavacanam. Yannityam
tadakrtakam drstam yathakdsamiti vyatirekavacanam. Etanyeva trayovayava
ityucyante.
Sddhayitumistopi pratyaksadiviruddhah paksabhdsah. Tadyatha. (l)Pratyaks
avimddhah, (2) Anumanaviruddhah, (3) Agamaviruddhah, (4) Lokaviruddhah,
(5) Svavacanaviruddhah, (6) Aprasiddhavis'esanah, (7) Aprasiddhavis'esyah, (8)
Aprasiddhobhayah, (9) Prasiddhasambandhasceti. Tatra Pratyaksaviruddho yatha.
Asravanah sabda iti. Anumanaviruddho yatha. Nityo ghata iti. Agamaviruddho
yatha. Vaisesikasya nityah sabda iti sadhayatah. Lokaviruddho yatha. Suci
102
Appendix 1
narairahkaplaiii p rnyaga tv cch akh aukti vaditi. Svavacanaviruddho yath.

Mt me vandhyeti. Aprasiddhaviesano yath Bauddhasya Sihkhyarh prati vinl
abda iti. Aprasiddhaviesyo yath. Smkkyasya Bauddham prati cetana tmeti.
A p ra sid d h o b h a yo
ya th .
V aiesikasya
B a u dd ha m
p ra ti
sukhdisamavyikranamtmeti. Prasiddhasambandho yath. rvanah abda
iti. Esm vacanni dharniasvanipanirkaranamukhena pratipdansambhavatah
sdhanavaiphalyataceti pratijdosh. Ukth paksbhsh.
Asiddhnaikntikaviruddh hetvbhsh. Tatrsiddhacatuhprakrah.
Tadyath. (1) Ubhaysiddhah, (2) Anyatarsiddhah, (3) Samdigdhsiddhah, (4)
raysiddhaceti. Tatra abdnityatve sdhye cksusatvdityubhaysiddhah.
Krtakatvditiabdbhivya- ktivditiam pratyanyatarsiddhah. Bspdibhvena
sandihyamno bhtasamghto gnisiddhvupadiyamnah sariidigdhsiddhah.
Dravyamkam gunrayatvdity- ksattvavdinam pratyraysiddhah.
Anaikntikah satprakrah. (1) Sdhranah, (2) Asdhranah, (3) Sapaksaikadeavrttirvipaksavypl, (4) Vipaksaikadeavrttih sapaksavypl, (5) Ubhayapaks
-aikadesavrttih, (6) Viruddhvyabhicri ceti.
Tatra sdhranah abdah prameyatvnnitya iti. Taddhi nitynityapaksayoh
s dh ra natvdanaikntikam . Kirii ghatavatpram eyatvdanityah abda
hosvidkavatprameyatvnnitya iti. Asdhranah rvanatynnitya iti. Taddhi
n ity n itya p a ks b h y iii
vy vrtta tv n n ity n ity a v in irm u k ta sy a
cnyasysambhavtsamayahetuh. Kimbhitasysya rvanatvamiti. Sapaks
aikadeavrttirvipaksavypi yath. Aprayatnnantariyakah a b d o fnityatvt.
Aprayatnnantariyakah paksah. Asya vidyudkdih sapaksah. Tatraikadee
vidyuddau vidyatenityatvam nkdau. Aprayatnnantariyakah paksah. Asya
ghatdirvipaksah. Tatra sarvatra ghatdau vidyatenityatvam. Tasmdetadapi
vidyudghatasdhamjyennaikntikam. Kirii giiatavadanityatvtpmyatnnantanyakah
abdah hosvidvidyuddivadanityatvdaprayatnnantariyaka iti. Vipaks
aikadeavrttih sapaksavypi yath. Prayatnnantariyakah ab do nityatvt.
Prayatnnantariyakah paksah. Asya ghatdih sapaksah. Tatra sarvatra ghatdau
vidyate nityatvam. Prayatnnantariyakah paksah. Asya vidyudkdirvipaks
ah. Tatraikadee vidyuddau vidyatenityatvam nkdau. Tasmdetadapi
vidyudghatasdharmyena prvavadanaikntikam. Ubhayapaksaikadeavrttir
yath. Nityah abdo mrtatvditi. Nityah paksah. Asyka paramnvdih sapaks
ah. Tatraikadea kdau vidyate mrtatvani na paramnau. Nityah paksah.
Asya ghata sukhdirvipaksah. Tatraikadee sukhdau vidyate murtatvam na
g h a t d a u .
T a sm detadapi
su kh k a s d h a rm yen n a ik n tika m .
Viruddhvyabhicri yath. Anityah abdah krtakatvd ghatavat. Nityah abdah
r v a n a tv t
a b d a tva va d iti.
U bhayoh
sa m a ya h e tu tv d
dvvapyetveko naikntikah samuditveva.
Viruddhacatuhprakrah. Tadyath. (1) Dharmasvarpaviparitasdhanah,
(2) Dharmaviesaviparitasdhanah, (3) Dharmisvarpaviparitasdhanah, (4)
Dharmivies-aviparitasdhanaceti. Tatra dharmasvarupaviparitasdhano yath.
Nityah abdah krtakatvt prayatnnantariyakatvdveti. Ayaih heturvipaksa eva
bhvdviruddhah. Dharmaviesaviparitasdhano yath. Parrthcaksurdayah
Appendix 1
103
samghtatvcchayansand- yangvisesavaditi. Ayarfi heturyath prrthyaih caks

u rdinm s d h a ya ti tath sam hatatvam pi parasy tm a na h s dhayati.
Ubhayatrvyabhicrt. Dharmisvarpavipantasdhano yath. Na dravyam na
karma na guno bhvah ekadravyavattvt gunakannasu ca bhvt smnyavis'es
avaditi. Ayaih hi heturyath dravydipratisedham bhvasya sdhayati tath
bhvasybhvatvam api sdhayati. U bhayatrvyabhicrt. D harm ivises
aviparitasdhano yath. Ayameva heturasminneva prva-pakse syaiva dharmino
yo vis'esah satpratyayakartrtvam nnia tadviparitamasatpratyaya- kartrtvamapi
sdhayati. Ubhayatrvyabhicrt.
Drstntbhso dvividhah. Sdharmyena vidharyena ca. Tatra sdhannyena
tvad drstntbhsah pahcaprakrah. Tadyath. (1) Sdhanadhannsiddhah,
(2) Sdhyadharmsiddhah, (3) Ubhayadharmsiddhah, (4) Ananvayah, (5)
Viparltnvayasceti. Tatra sdhanadhannsiddho yath. Nityah s'abdo mrtatvt
paramnuvat. Yadamrtam tannityam drstam yath paramnuh. Paramnau hi
sdhyam
n ity a tv a m a sti
s d h a n a d h a rm o 'm rtatvam
n sti
mrtatvtparamnnmiti. Sdhyadhannsiddho yath. Nityah s'abdomrtatvd
buddhivat. Yadamrtam tannityam drstam yath buddhih. Buddhau hi
sdhanadharm omrtatvamasti sdhyadharmo nityatvam nsti. Anityatvd
buddheriti. U bhaysiddho dvividhah. Sannasansceti. Tatra ghatavaditi
vid ya m n o b h a y sid d h a h .
A n itya tv n m rta tv c ca
g h a ta sya .
ksavadityavidyamnobhaysiddhah. Tadasattvavdinam prati. Ananvayo yatra
vinnvayena sdhyasdhanayoh sahabhvah pradarsyate. Yath g h a te
krtakatvamanityatvam ca drstamiti. Viparitnvayo yath. Yat krtakam tadanityam
drstamiti vaktavye yadanityam tatkrtakaiii drstamiti bravlti. Vaidhannyenpi drs
tantbhsah pahcaprakrah Tadyath. (1) Sdhyvyvrttah, (2) Sdhanvyvrttah,
(3) Ubhayvyvrttah, (4) Avyatirekah, (5) Viparitavyatirekasceti. Tatra
sdhyvyvrtto yath. Nityah s'abdo m rtatvt param nuvat. Yadanityam
tanmrtam drstam yath paramnuh. Paramnorhi sdhanadharmo mrtatvam
vyvrttam mrtatvtparamnnmiti. Sdhyadharmo nityatvam na vyvrttam
nityatvtparamnnmiti. Sdhanvyvrtto yath. Kannavaditi. Karmanah
sdhyam nityatvam vyvrttam. Anityatvtkannanah. Sdhanadharmo 'mrtatvam
na vy vrttam . A m rta tv tka rm a n a h . U bhayvyvrttah. ks'avaditi.
T atsattvavdinam p rati. Tato nityatvam am rtatvam ca na vyvrttam .
Nityatvdamrtatvccksasyeti. Avyatireko yatra vin sdhyasdhananivrtty
tadvipaksabhvo nidarsyate. Yath ghate mrtatvamanityatvam ca drstamiti.
Vipantavyatireko yath. Yadanityam tanmrtam drstamiti vaktavye yanmrtam
tadanityam drstamiti bravlti.
Esm paksahetudrstntbhsnm vacanni sdhanbhsam.
napratyyanrthcnh tu pratyakscanammmrunh ca dve evapramne. Tatra pratyaks
am kalpanpodhamyajjhnamarthe rpdau nmajtydikalpanrahitam. Tadaks
amaksam prati vartata itipratyaksam. Anumnam lihgdarthadarianam. Ungarn
punastrirpamuktam. Tasmdyadanumeye rthe jhnamutpadyate gniratra anityah
s'abda iti v tadanumnam. Ubhayatra tadeva jhnam phalamadhigamarpatvt.
Savypravatkhyteh pramnatvamiti. Kalpanjhnamarthntare pratyaks
104
Appendix 1
dbhasam. Yojjndnam ghcitcih pata iti va vikalpayatah samutpadyate tadarthasvalaks

anavis-ayatvdtpratyaksdbhdsam. Hetvdbhdsapurvakam jhdnam-anumdndbhdsam.
Hetvdbhaso hi bahuprakdrci uktah. Tasmadyadanumeye rthejhanamavyutpannasya
bhavati tadanumdnabhdsam.
Sddhanadosodbhdvandni dusmani. Sddhanadoso nyimatvcun. Riksadoscilipratyaks
- adivimddhatvam. H etudososiddhdnaikdntikaviniddhatvam. Drstantadoscih
sadhana-dhaniiddyasiddhatvam. Tasyodbhavanam prasnikapratyayanam dus
atiam. Abhutasadhanadosodbhdvandni dusandbhdsani. Sampurne sadhane
n y u n a tv c iv a c a n a m . A d u sta p a kse p aksad osa vaca na m . S id d h a h e tu k e '
sid d h a h etu ka m vacanam . E k a n ta h e tu k e 'n eka n ta h etu ka m vacanam .
A viruddhahetuke viruddhahetukam vacanam . A dustadrstante dustadrst
dntadosavacanam . Etani dusandbhdsani. Na hyebhih parapakso dusyate.
Niravadyatvattasya. Ityuparanvyate.
Paddrthamdtramdkhyatamddau Dihmatrasiddhaye;
Ydtra yuktirayuktirvd sanyatra suvicarita.
** Iti NYAYAPRAVESAKASUTRAM samaptam**
Appendix 2
Nyayapravesakasutram
(Translation)
Giving arguments in support of ones own position and pointing out defects in
the rivals position along with their respective fallacies are essential for
communicating knowledge to others, whereas for acquiring knowledge for ones
own sake, perception and inference and their respective fallacies are essential.
This is the sum and substance of the science of debate . 1
Here, the statement regarding subject (paksa) and so on is means (sadhana).2
The statements of subject, reason {heta)y and example (drstanta) establish the
hitherto not known object to the inquirer. Subject is a known substratum having
the known qualifying property through which another property is desired to be
proved by someone. 3 The subject must not be contrary to perception and so on.
In the example of whether sound is eternal or nonetemal, the subject is sound,
and the property that is desired to be proved is whether it is eternal or noneternal.
This is the point of debate.
Reason has three features . 4 Now the question is, Which are these three
features? The necessary presence of reason in the subject, the presence of reason
only in homologue (,sapaksa), and the necessary absence of reason always in
heterologue (vipaksa) are the three features of reason. Again, what is homologue? 5
What is heterologue? Homologue is what is similar (to subject) by virtue of
having probandum (sadhya) as its common property. For example, in order to
prove that Sound is noneternal, pot and so on, which are nonetemal, become
homologue. Heterologue is that where probandum is absent for example, in the
inference Whatever is eternal is experienced to be nonproduced as space and so
o n . Being produced or being necessarily associated with effort is present only
in homologue and is never present in heterologue. Here, reason is noneternal and
so on.
Example is twofold. 6 One is based on similarity (sadharmyend) and, the
other is based on dissimilarity (yaidhamxyend). That which is based on similarity
106
Appendix 2
is where the existence of reason is known only in homologue. Its example is

Whatever is produced, is experienced as nonetemal, for example pot and so
on. That which is based on dissimilarity is where absence of reason is said to be
in the absence of probandum, for example: Whatever is eternal is experienced
to be nonproduced as space and so on. Eternal means absence of nonetemal.
The word nonproduced means absence of being produced, as for example,
nonbeing is absence of being. Thus, we have stated subject and so on.
Statements about all these are means of communicating knowledge to others.
That can be explained as follows: Sound is nonetemal is a statement of subject,
and because it is produced is a statement of subject having reason as its property
(paksadharmata). Whatever is produced is experienced to be nonetemal like
pot and so on is the statement of homologue, which is based on similarity. The
statement of dissimilarity (yyatireka) is Whatever is eternal is experienced to be
nonproduced like space and so on. These are said to be the three elements (avayavas)
of the process of argumentation in support of ones own position.
Even though it is desired to be proved, a fallacious thesis (paksdbhasa) is
(fallacious because it is) contrary to perception and so on . 7 It is of the following
nine types: ( 1 ) contrary to perception (pratyaksa viruddha), (2 ) contrary to
inference (anumana viruddha), (3) contrary to ones own scripture (dgama
viruddha), (4) contrary to public opinion (loka viruddha), (5) contrary to ones
own statement (svavacana viruddha), (6 ) a thesis whose subject is unacceptable
(iaprasiddha visesana), (7) a thesis whose predicate is unacceptable (aprasiddha
visesya), (8 ) unacceptable to both parties (aprasiddhobhaya), and (9) a thesis too
well known or accepted universally (prasiddha sambandha)Sl) A thesis contrary
to perception is like Sound is audible.(ll) A thesis contrary to inference is like
Pot is eternal.(lil) A thesis contrary to ones own scripture is like a Vaisesika
adherent trying to prove that Sound is eternal.(iv) A thesis contrary to popular
belief is like A dead mans skull is pure because it is a limb of an animate being,
as, for example, a conch or a shell.(v) A thesis contrary to ones own statement
is like My mother is barren. (vl) A thesis whose predicate is unacceptable is like
while arguing with a Samkhya adherent, a Buddhist taking his stand on such a
proposition as Sound is perishable.(vll) A thesis whose subject is unacceptable
is like, while arguing with a Buddhist, a Samkhya adherent taking his stand on
such a proposition as Self or ego is animate. (VJ,1) A thesis whose both the terms
the subject and the predicate are unacceptable is like a Vaisesika adherent
arguing with a Buddhist and taking his stand on such a proposition as Soul is the
inherent cause of pleasure and so o n.(lx) A thesis universally accepted is like
Sound is audible.
These statements have a fallacious thesis (pratijhadosa = paksdbhasa) because
they cannot be logically established and, second, they cannot serve as a means of
proof. They negate the very property that is to be proved. Thus, fallacies of
thesis are stated.
Unproved (,asiddha), inconclusive (ianekdntika), and contradictory (viruddha)
are the fallacies of reason (hetvabhasas) . 8
Appendix 2
107
Unproved is divided into four types: ( 1 ) unacceptable to both (ubhayasiddha),

(2) unacceptable to either (anyatarasiddha) , (3) unproved because of doubt
(sanidigdhasiddha) , and (4) unproved locus (as'rayasiddha).
In the argument Sound is nonetemal on account of being visible/ sound is
subject, nonetemal is probandum, and visible is reason. Here visibility (of sound)
is unacceptable to both parties, and, therefore, it is a fallacy of being unacceptable
to both. Again, the inference Sound is nonetemal because it is effort-made,
will not be acceptable to a person upholding the position that sound is eternal and
that only its manifestations, which are effort-made, are nonetemal. On the basis
of doubtful existence (of reason), if one undertakes the inference like, inferring
fire on the basis of doubting cluster of mist as smoke, then it is a fallacy of
doubtful existence. Space is a substance because it is a locus of quality (sound) :
(this argument is valid) for believers in the reality of space; but (for Buddhists) it
is not valid because (Buddhists) dont believe in the reality of space.
Inconclusive is sixfold: (1) too wide (sadharana), (2) too narrow
(<asadharana), (3) pervading one part of the homologue and pervading the entire
heterologue (sapaksaikadesavrttih vipaksavyapt)9 (4) pervading one part of the
heterologue and pervading the entire hom ologue (vipaksaikadesavrttih
sapaksavyapt) , 1 0 (5) pervading one part of both (ubhayapaksaikadesavrttih) 11 and
(6 ) contrary and nondivergent, (vimddhdvyabhicarT) .n The example of too wide
is that Sound is eternal on account of its knowability. Here, the reason
(knowability) is common to both eternal and nonetemal things; therefore it is a
fallacy of inconclusiveness of the variety of being too wide. Is sound nonetemal
like a pot on account of its knowability or is it eternal like space on account of its
knowability? The example of too narrow is Sound is eternal on account of its
audibility. Here, audibility is peculiar to sound and is not found in any other
thing eternal or nonetemal, and there is no other thing different from eternal or
noneternal, and this gives rise to doubt as to what help audibility (as a reason)
can render. Pervading one part of the homologue and pervading the entire
heterologue is as follows: Sound is naturally existing (which can exist without
any volitional effort on our part). Here, the term natural (aprayatnanatariyaka)
is subject. Its homologues are lightning, space, and so on. Here in one part of the
homologue like lightning, nonetemality resides, but it doesnt reside in some
other parts like space and so on. Let us again take the term natural as subject.
Pot and so on are its heterologues. Now this nonetemality resides in all heterologues
like pot and so on. Therefore, being common to both lightning (which is
nonproduced) and pot (which is produced), it is inconclusive. Here a doubt
arises whether sound is effort-made because of nonetemality like pot or noneffortmade because of nonetemality like lightning. Residing in some part of heterologue
and residing in whole of homologue is as follows: Sound is effort-made because
it is nonetemal. Here subject is effort-made. Pot and so on are its homologues.
Everywhere in pot and so on nonetemality resides. Again subject is effort-made;
its heterologues are lightning, space, and so on. Here, in one part of the heterologue
like lightning, nonetemality resides but does not reside in other part like space
108
Appendix 2
and so on. Therefore, this also being common to both lightning and pot it is
inconclusive as before. Pervading one part of both (i.e., homologue and
heterologue) is like Sound is eternal because it is incorporeal. Here subject is
eternality. Space, infinitesimal particle, and so on are its homologues. In one
part of the homologue, that is in space, incorporeality resides but not in the other
part, that is, an infinitesimal particle. Again, subject is eternality. Pot, pleasure
and so on are its heterologue. Here, in one part of the heterologue, that is,
pleasure incorporeality resides but not in the other part of the heterologue like
pot and so on. Since it is common to both pleasure (which is heterologue) and
space (which is homologue), it is inconclusive. An example of Contrary and
nondivergent is as follows: Sound is nonetemal on account of being produced
like a pot and Sound is eternal on account of audibility like soundness, in
both these arguments, the two reasons taken together cause doubt and are therefore
inconclusive (here, about the same thesis two different reasons lead to two
contradictory conclusions).
Contradictory is of four types. They are as follows: (1) reason contradictory
to probandum 0 dhamasvarupaviparitasddhana ) , 1 3 (2 ) reason contradictory to a
particular probandum (<dharmavis'esaviparitasadhana) , 1 4 (3) reason contradictory
to thesis (<dharniisvampavlparitasddhana) , 1 5 (4) reason contradictory to a particular
thesis (dharmivis'esaviparitasddfiana) . 1 6 Reason contradictory to probandum
is as follows: Sound is eternal on account of being produced or effort made.
This reason belongs to the side of heterologues. Therefore, it is known as
contradictory. Reason contradictory to a particular probandum is as follows:
eyes and so on exist for the sake of others on account of their composite character
like bed, seat etc. which are composite in nature. This reason not only proves
that eyes and so on exist for the sake of others but also proves that self (as
conceived by the Samkhyas) is of a composite nature because reason is
invariably applicable to both. Reason contradictory to the thesis is as follows:
Summum genus (bhdva) is not a substance or action or quality, because of its
possessing one substance and because of its presence in qualities and actions like
the universal and the particular. This reason not only proves that summum genus
is the opposite of substance and so on but also proves the absence of summum
genus itself because it is invariably common to both. Reason contradictory to a
particular thesis : this very reason in this very argument of the opponent proves
the presence as well as the absence of being based on being and being based
on nonbeing and is common to both . 1 7
The fallacy of examples is twofold, on the basis of similarity and on the basis
of dissimilarity.
The fallacy of example based on similarity is fivefold. It is as follows:
( 1 ) incompatibility of the example with the reason (Sadhanadharmasiddha) , 1 8
(2) incompatibility of the example with the probandum (Sadhyadharmdsiddha),19
(3) incom patibility of the example with both (reason and probandum )
(Ubhayadharmdsiddha ) , 2 0 (4) absence of statement of positive invariable
concomitance (Ananvoryd)}x and (5) contrary to the statement of positive invariable
Appendix 2
109
concomitance ( Viparitanvayah) . 2 2 Incompatibility of example with the reason

is as follows: Sound is eternal on account of its being incorporeal like infinitesimal
particle. In infinitesimal particle the probandum, that is, eternality, exists, but
the reason, namely, incorporeality, doesnt exist because infinitesimal particles
are corporeal. Incompatibility of the example with the probandum is as follows:
Sound is eternal on account of its being incorporeal like intelligence. In
intelligence, the reason, that is incorporeality, exists, and the probandum, that is
eternality, doesnt exist because intelligence is noneternal. Incompatibility of the
example with both (reason and probandum) is twofold, positive and negative.
The positive is as follows: Sound is eternal on account of being incorporeal like
a pot. Here, the example is contrary to both reason and probandum because pot
is noneternal (contrary to probandum) and corporeal (contrary to reason). The
example of negative is as follows: Sound is eternal on account of being incorporeal
like space. This argument contains an example that is not acceptable to a person
who doesnt believe in the reality of space. Absence of statement of positive
invariable concomitance is as follows: the coexistence of probandum and reason
is stated without stating their invariable concomitance, for example in the statement
In the pot there is the property of being produced and noneternality. Contrary
to the statement of positive invariable concomitance is as follows: instead of
saying, Whatever is produced is experienced to be nonetemal, we say, Whatever
is noneternal is experienced to be produced. (Here concomitance is stated in a
reverse order.)
Fallacy of example based on dissimilarity2 3 is fivefold, which is as follows:
( 1 ) n o n ab se n t p robandum (Sa dh yavyavrtta ) , 2 4 ( 2 ) n onabsent reaso n
(iSadhanavyavrtta ) , 2 5 (3) both are nonabsent (Ubhayavyavrtta) , 2 6 (4) absence of
statement of negative concomitance (Avyatireka) , 2 7 and (5) contrary to the statement
of negative invariable concom itance ( Viparitavyatireka ) . 2 8 Nonabsent
probandum is as follows: Sound is eternal on account of incorporeality like
infinitesimal particle. Whatever is noneternal is experienced to be corporeal like
infinitesimal particle. Of infinitesimal particle, reason is incorporeality, but
incorporeality, in fact, is absent from infinitesimal particles because they are
corporeal, whereas the probandum, namely, eternality, is not excluded because
infinitesimal particles are eternal. Nonabsent reason is as follows: Sound is
eternal on account of incorporeality like action. Here, the probandum, that is,
eternality, is excluded in respect of action because all actions are nonetemal, but
the reason, that is incorporeality is not excluded because an action is incorporeal.
Both are nonabsent is as follows: Sound is eternal on account of incorporeality
like space. This is fallacious for one who believes in the existence of space.
Here, both eternality (probandum) and incorporeality (reason) are not excluded
because space is both eternal and noncorporeal. Absence of statement of negative
concomitance is that where without negating probandum and reason, their
presence in the heterologue is stated, as, for example, in pot there are incorporeality
and noneternality. Contrary to the statement of negative invariable concomitance
is as follows: instead of saying Whatever is nonetemal is experienced to be
110
Appendix 2
corporeal, we say, Whatever is corporeal is experienced to be nonetemal.

These are the statements of the fallacies of thesis, reason, and example, and
they are known as fallacies of demonstration or means of proof.
In order to acquire knowledge for ones own sake perception and inference
are the only two means of knowledge. Perception is bereft of conceptualization.
It is that knowledge that is devoid of all determinations in terms of words and
concepts like class and so on. That which depends on each individual cognitive
sense is perception. Inference is knowledge of objects on the basis of a necessary
mark. Necessary mark is said to have three features. Therefore, it is that knowledge
that arises concerning the inferential object, for example, Here is fire (because
of smoke) or Sound is nonetemal (because it is produced). In both (perception
and inference) the same knowledge is both the cause and its result, which is in
the form of cognition of an object. Knowledge is always of functional character,
and, therefore, it is true cognition. (The truth of knowledge consists in its ability
to be functional.) A determinate knowledge is a fallacious perception if it is
taken in the context of objective reality.
The object of determinate knowledge is a universal, but if a unique particular
is taken to be its object, then it is fallacious. So, (determinate) knowledge like
This is a pot or This is cloth, which arises through a judgment, is fallacious
perception because it takes the objective reality (unique particular) as its object.
Fallacious inference is that which is due to fallacious reason. Fallacious reason is
said to be of many kinds. Thus, concerning the inferential object, that knowledge
that arises in one who doesnt take cognizance of (fallacies like unproved and so
on) is fallacious inference.
To point out defects in means of proof is known as fallacies in means of
proof or refutation (<dusana). Deficiency in means of proofs is (known as) its
defect. Defect in thesis consists in incompatibility with perception and so
on. Defect in reason is unproved, inconclusive, and contradictory. Defect in
example is where reason and so on as property are not proved. To point out
the defects to the inquirer is for his or her knowledge.
To point out that the defects are not, in fact, defects is known as fallacious
refutation. To point out deficiency in a perfect reason, to point out defects in
nondefective thesis, to point out unprovenness of a proved reason, to point
out inconclusiveness in a conclusive reason, to point out contradiction in a
noncontradictory reason, to point out defects in a nondefective examplethese
are fallacious refutations. By these the rival position is not vitiated because they
are not refutable. This is the end.
The entire discourse on (logical) categories is stated to prove the philosophical
position of Dinnaga. Whatever is argued or not argued here is well discussed (in
Pramdna Samuccaya) (by us).
Notes
CHAPTER 1
1. In Buddhist epistem ology the Sanskrit word for knowledge is pramna, and the
words pram, samyag-jnna, and so on are also used as its synonym.
2. Dharmaklrti, Nyya Bindu, p. 1.
3. Dharmaklrti, Pramana Vrika, p. 3.
4. Ibid., p. 8.
5. Dharmottara, Nyya Bindu Tik, p. 10.
6. Diiinga, Pramana Samuccaya, Tr. by Hattori, Dinnga on Perception , p. 28.
7. Ibid, p. 2 9.
8. Dharmottara, Nyya Bindu Tik , pp. 82-85.
9. Aniruddha, Abhidhammamatasamgaho, IV. 8.
10. Edited by Kashyap, Jagdish, Kathvatthu, p. 374.
11. Th. Stcherbatsky, Buddhist Logic, vol. 2, p. 311.
12. Ibid., AppendixIV.
13. Ibid., vol. 1, p. 552.
14. (a) Dinnga, Pramna Samuccaya, Tr. by Hattori, Dinnga on Perception ,
p. 28.
(b) Dharmaklrti, Pramna Vrtika, pp. 4 7 9 , 4 8 0 , 491.
15. Dharmaklrti, Pramana Vrtika, p. 337.
16. Dinnga, Pramna Samuccaya, Tr. by Hattori, Dinnga on Perception, p. 2 8.
17. Ibid., p. 2 9.
18. Ibid., p. 108.
19. Ibid., p. 2 8 .
2 0 . Ibid., p. 2 9 .
21. Ibid., p. 28.
22 . Dharmottara, Nyya Bindu Tik, pp. 69ff.
2 3 . Dinnga, Pramna Samuccaya, Tr. by Hattori, Dinnga on Perception, p. 30.
CHAPTER 2
1.
2.
3.
4.
Dinnga, Pramna Samuccaya, Tr. by Hattori, Dinnga on Perception , p. 32.

See Bhatt, Basic Ways of Knowing, p. 31.
Dinnga, Pramna Samuccaya, Tr. by Hattori, Dinnga on Perception , p. 24.
Ibid, p. 25.
112
Notes
5. Tatra sandhne na pramnntaram anistsakteh, ibid., p. 24.

6. Ibid., p. 28.
7. Ibid., p. 29 .
8. Ibid., pp. 25-2 6.
9. Vasubandhu, Abhidharmakoa , p. 145.
11. Dharmottara, Nyya Bindu Tik, pp. 12ff.
13. Ibid., pp. 42ff.
14. Cf. avyapadeyam of the Nyya school.
15. Dharmottara, Nyya Bindu Tik, p. 44.
16. Vikalpa yonayah abdca abd vikalpa yonayah.
17. Dharmottara, Nyya Bindu Tik, pp. 32ff.
18. Ibid., pp. 51ff.
19. Ibid., pp. 54.
20. ntaraksita, Tattva Samgraha, verses 1220-23.
21. Ibid., verse 1223
22. Ibid., verse 1224.
25. Th. Stcherbatsky, Buddhist Logic, vol. 1, pp. 153-45.
2 6. Dharmottara, Nyya Bindu Tik, p. 36.
2 7 . ntaraksita, Tattva Samgraha, verse. 1313.
28. Dharmottara, Nyya Bindu Tik, pp. 36-40.
2 9. ntaraksita, Tattva Samgraha, verse. 1323.
30. Kamalasila, Tattva Samgraha Pajik, p. 482.
31. Dharmarja Adhvarindra, Vednta Paribhs, p. 32.
32. Bhartrhari, Vkyapadiya, I, verses 123-24.
33. Isvara Krsna, Smkivya Krik, pp. 27-2 8.
34. Bhatta, Kumarila, Sloka Vrtika, pratyaksa khada, p. 133.
35. Ibid., p. 73.
36. Bhatta, Jayanta, Nyya Majari, p. 92.
37. Vis'vantha, Bhs Pariccheda, p. 58.
38. Dinga, Pramna Samuccaya, Tr. by Hattori, Dinga on Perception, p. 88.
39. Bhartrhari, Vkyapadiya Ch. II, verse 48. Kamalaila in Pajik quotes this
verse in order to substantiate the Buddhist position, which ntaraksita presents in Tattva
Samgraha in another verse with similar import.
4 0 . ntaraksita, Tattva Samgraha, verses 1292ff.
41. ntaraksita, Tattva Samgraha, verses 1268-90.
4 2 . D i n g a , Pramna Samuccaya, Tr. by H attori, Dinga on Perception,
A ppendix 1.5. Atra viesanam paramatpeksam sarvetvavikalpak eva.
43. The Buddhist theory o f mnasa pratyaksa is different from that of the Nyya. In
Nyya mnasa pratyaksa is internal perception of the self and mental states through the
mind, which is an inner cognitive sense organ,
4 4 . D i n g a, Pramna Samuccaya, Tr. by H attori, Dinga on Perception,
Appendix, 1.6.
45. Ibid.
4 6. Dharmottara, Nyya Bindu Tik, pp. 46-48.
Notes
47 .
48 .
49.
50.
51.
5 2.
53.
5 4.
55 .
56.
57.
58 .
59 .
60.
61.
62.
113
Kamalasla, Tattva Samgraha Pajik, pp. 1260-61.
Dharmottara, Nyya Bindu Tik. pp. 419-50.
Ibid., pp. 56ff.
Dharmakirt, Pramna Vrtika, p. 243.
Ibid., p. 23 9.
Dharmottara, Nyya Bindu Tik, pp. 56ff.
Ibid., p. 60.
Th. Stcherbatsky, Buddhist Logic, vol. 1, p. 162.
Dharmottara, Nyya Bindu Tik; See Buddhist Logic, vol. 2, Appendix 3.
Dharmottara, Nyya Bindu Tik, p. 59.
Ibid.
Mira, Durveka, Dharmottara Pradipa, p. 62.
Dharmottara, Nyya Bindu Tik, pp. 62-63 .
Ibid.
Dharmaklrti, Pramna Vrtika, pp. 268 -6 9.
Ibid., pp. 281-86.
CHAPTER 3
1. Encyclopaedia of Religion and Ethics, vol. 8, p. 133, fn. 4.
2 . Edited by Swami Dwarikadas Shastri, Sutta Nikya, vol. II, p. 5 8 , Digga Nikya,
vol. Ill, p. 2 26 .
3. Samyutta Nikya, vol. 2, p. 57.
4 . Ibid., p. 58.
5. Asanga, Mahynasutrlakra, 1.12.,
6. Sugiura, Sadajvio, On Some Aspects of the Doctrines ofMaitreyantha and Asanga,
pp. 5 2-5 3 .
7. Ibid., p. 74.
8. Ibid., p. 81.
9. Vidyabhushan, History of Indian Logic, p. 267.
10. Ibid., p. 269 .
11. Th. Stcherbatsky, Soul Theory of the Buddhists, quoted from Buddhist Logic,
vol. 1, p. 31.
12. Uddyotakara, Nyya Vrtika, p. 300.
13. Dinga, Pramna Samuccaya, Tr. by Hattori, Dinga on Perception, II. 1.
14. Keith, Indian Logic and Atomism, p. 43.
15. Chatterjee, Nyya Theory of Knowledge, pp. 24 4 -45 .
16. Dinga, Pramna Samuccaya, Tr. by Hattori, Dinga on Perception, I. 7-8.
17. Vcaspati, Nyya Vrtika Ttparya Tik, p. 9.
18. Pariuddhi, Asiatic Society edition, p. 113.
19. Dinga, Pramna Samuccaya Tr. by Hattori, Dinga on Perception, 1.9.
20 . Ibid., 1.10.
21. Dharmaklrti, Nyya Bindu, 1.1.
22 . Dharmottara, Nyya Bindu Tik, p. 131.
2 3 . From the epistemic angle the relation can be named as gamaka-gamya-bhva,
but from the ontological angle it can be put as ganiya-gamaka-bhva. In the text it is put
in the latter form.
2 4 . Dharmottara, Nyya Bindu Tik, pp. lllf f .
2 5 . Ibid., p. 97.
114
Notes
26.
27.
28.
29.
30.
Dinnaga, Pramana Samuccciyci Tr. by Hattori, Dihndga on Perception, II. 1.

Dharmaklrti, Nydya Bindu, p. 98.
Dharmottara, Nydyci Bindu Tikd, pp. 98-99.
Dharmottara, Nydyci Bindu Tikd, p. 97. Pardrthdnumdnam sabdatmakam,
svarthdnumdnam tu jhandtmakam.
31. Ibid., p. 30.
32. Quoted from Randle, Fragments from Dihndga, section 14.
33. Dharmaklrti, Nydya Bindu, p. 186.
34. Ibid.
35. Dharmottara, Nydya Bindu Tikd, p. 97.
37. The word individual should not be understood as referring to svalaksana.
Here it means every individual object belonging to the category o f vikalpa or samanya
laksana.
38.
39.
4 0.
41.
42.
43.
44.
45 .
46.
47.
Dharmaklrti, Nydya Bindu , p. 111.

Vacaspati, Nydya Vartika Tdtparya Tikd, p. 199.
Dharmaklrti, Nydya Bindu, Ch. 2. pp. 122ff.
Ibid., p. 126.
Ibid., pp. 117, 140.
Pramana Vartika, p. 260 (Vrtti by Manorathanandi).
Dharmaklrti, Nydya Bindu, pp. 152ff.
Bauddha Tarka Bhdsd , Moksakaragupta p. 62.
Randle, Fragments from Dihndga , p. 46.
Dharmaklrti, Nydya Bindu, p. 129. Svabhdva pratibandhe hi satyarthortham
gamayet.
4 8. Ibid., p. 131. Tadapratibaddhasya tada vyabhicdraniyamdbhdvdt.
49. Dharmaklrti, Nydya Bindu Tikd, p. 129.
50. Hetu Bindu , Dharmaklrti, p. 53. Tasya vydptirhi vydpakasya tatra bhdva eva.
vyapya va tattraiva bhdva. Etena anvayo vyatireko va.

51. Areata, Hetu Bindu Tikd, pp. 17-18.
53. Dharmaklrti, Nydya Bindu, pp. 134ff.
54. Shah, Akalahka's Criticism of Dharmaklrtis Philosophy , p. 2 6 4 , fn. 49.
55. Dharmaklrti Nydya Bindu, p. 112.
56. Dharmottara, Nydya Bindu Tikd, Samanasya ca sa s'abdddesah, p. 112.
57. Ibid., p. 113. Na ca visesah sddhyah apitu sdmdnyam.
59.
60.
61.
62.
63.
64.
Ibid.
Ibid.
Uddyotakara, Nydya Vartika, 1.1.5, p. 301.
Dharmottara, Nydya Bindu Tikd, p. 103 .Yadyapi cdtra niscitagrahanam na krtam
tathdpi ante krtam prakrdntayordvayorapi rupayorapeksaniyam.

65. Dharmottara, Nydya Bindu Tikd, pp. 109-10.
66. Buddhist logicians do not admit the possibility o f kevaldnvayi and kevalavyatireki
vyaptis ; the metaphysics o f Naiyayikas, however, permit them to do so. In a situation
Notes
115
where there is only the possibility o f co-occurrence of hetu and sadliya in their presence,
and there is no possibility o f their co-occurrence in absence, it is known as kevaldnvayi
vydpti. Likewise, if in a situation there is a possibility o f co-occurrence o f sddhya and hetu
only in their absence, and there is no possibility of their co-occurrence in their presence,
it is known as kevalavyatireki. The kevaldnvayi is purely affirmative concomitance, whereas
the kevalavyatireki is purely negative concomitance. The example o f former is, Whatever
is knowable is nam eable. The example of latter is, In any pure substance different from
earth, there is absence o f earth because there is absence o f sm e ll.
67 . Establishing a contradictory thesis based on a rival reason.
68. Cf. Hemchandra, Pramana Mimamsa, p. 72, and Akalanka, Laghiyastraya III. 12,
published in Sindhi Grantha Mala.
69 . Vadi Deva Suri, Pramdnanayatattvdlokdlamkara , Ch. 3, p. 142.
70. Quoted by Santarakrita in Tattva Samgraha , verse 1368.
71. For details see Santarakrita, Tattva Samgraha, verses 1363-1428.
72 . Hetu cakra is also called paksadharma cakra\ see Vidyabhushana, A History of
Indian Logic , p. 2 9 9 , fn. 2.
7 3. The doctrine o f Hetu cakra is also mentioned in Nydya Pravesa.
7 4 . In the Nydya Vartika o f Uddyotakara in the context of examination o f the doctrine
o f trairupya there is a statement o f another doctrine o f seven possible types o f relations
hetu may have with paksa, sapaksa, and asapaksa. The seven possibilities are:
1.
2.
3.
4.
5.
6.
I.
present in paksa , absent in sapaksa, and present in asapaksa .

present in sapaksa , absent in paksa, and present in asapaksa.
absent in asapaksa , absent in paksa, and absent in sapaksa.
present in paksa , present in sapaksa, but not absent in asapaksa .
present in paksa , absent in asapaksa, but not present in sapaksa.
present in sapaksa , absent in asapaksa, but not present in paksa.
present in paksa , present in sapaksa, and absent in asapaksa.
O f these the first three fail to satisfy two requirements, the next three fail to satisfy
one requirement, but the last one satisfies all three requirements. Thus, the first six are
rejected, and the seventh alone is regarded as valid. The hetu in the seventh placement is
trairupya hetu. This septenary is different from the Hetu cakra insofar as it takes into
consideration the relation o f hetu with paksa apart from its relation with sapaksa and
asapaksa. Here the possibility o f asiddha hetu is also taken into consideration. But the
doctrine hetu cakra presumes that hetu must necessarily be present in paksa. With this
presumption it considers nine possible ways of the relation o f the hetu with sapaksa and
asapaksa.
75. Borrowed from Chi, Buddhist Formal Logic.
76. Vacaspati, Nydya Vartika Tatparya Tikd, p. 266. Avayavatvenaikavakyata darsita,
sa ca paddndm paraspardpeksita sambandha yogydrthapratyayena bhavanti.

7 7. Vatsyayana, Nydya Bhasya I. 1.32.
78. Ib id ., 1 .1 .1 . Agamah pratijhd heturanumdnam uddharanam pratyaksam
upam ana upanayah. Sarvesam ekartha sam avaye sam arthya p ra d a ria n a m
nigamanamiti. So yam param nydya iti.
79. Ibid., 1.1.32.
8 0. Parthasarathi Mira, Nydya Ratna Mala on Sloka Vartika, anumdna khanda,
p. 54.
116
Notes
81. Vcaspati, Nyya Vrtika Ttparya Tk, p. 267.

82. Vypti visista paksadharmat jnam parmaram.
83. In the Buddhist literature prior to Dinga there is an acceptance o f eight avayavas,
which have only been stated and not analyzed (cf. Tucci, Buddhist Logic before Dinga,
pp. 461-65). In the Nyya Pravea, however, only three avayavas , namely, pratij, hetu,
and drstnta, are put forth (pp. 1-2).
84. ntaraksita, Tattva Samgraha, verse 1435.
85. A ccord in g to them , in parrthnumna w e have fiv e avayavas, but in
svrthnumna three are enough.
86. Quoted in ntaraksita, Tattva Samgraha , pp. 514ff.
87. Ibid.
88. Ibid., p. 516.
89. Satkari Mookerjee, Buddhist Philosophy of Universal Flux, p. 364.
90. Dinga, Nyya Pravea, Tr. by Dhruva.
91. Kamalaila, Tattva Samgraha Pajik , p. 516.
92. DharmakTrti, Pramna Vrtika', Ch. 4, verses 16, 17, 2 0 , and 26 .
93. DharmakTrti, Pramna Vrtika , Ch. 3, verse 2 7 . Tadbhvahetubhva hi
drstnte tadvedinah.
94. DharmakTrti, Nyya Bindu, Ch. 2, p. 117.
APPENDIX 2
1.
According to Buddhist tradition, the purpose o f acquiring knowledge is either fo
o n e s own awareness or for communicating it to others. Buddha acquired knowledge for
his own enlightenment and also communicated knowledge for the enlightenment o f others.
So, Buddhist epistem ological thinkers draw a distinction between knowledge for one's
own sake (tmasarhvit) and knowledge for the sake o f others (parasamvit). Perception
(pratyaksa) and inference ( anumna) are the two means to acquire knowledge for o n e s
own sake. Anumna in this context is svrthnumna only. For communicating knowledge
to others there is only one mode, which is sdhana, also known as parrthnumna. In
this text first there is exposition of sdhana, and then pratyaksa and anumna are discussed
with their respective fallacies. So, in total, there are eight topics discussed in this text.
They are as follows: (1) Sdhana , (2) Sdhanbhsa , (3) Duana (4) Dsanbhsa , (5)
Pratyaksa (6) Pratyaksbhsa (7) Anumna (8) Anumnbhsa.
In a proper ep istem ological order first there should have been d iscu ssio n on
perception and inference and then on sdhana and diisana. But the order is reversed here.
The tradition explains it by saying that this book is intended for the sake o f others
( parasamvit) and therefore tmasarhvit is made subservient to parasamvit. Buddha also
acquired enlightenment not for his own sake primarily but for suffering beings (Bahujana
hitya bahujana sukhya).

T h e word sdhana is used in two differen t se n ses. O ne is the m o d e o f
demonstration or giving arguments in support of o n e s own position, and the other is for
one o f the constituents o f the process o f inference, that is, hetu (reason). Here, it is used in
the former sense. The entire process of argumentation consisting o f different elements and
stages is collectively known as sdhana. The elements are thesis (paksa), reason (hetu),
hom ologue (sapaksa), and heterologue (vipaksa). The stages are thesis, reason, and example
(drstnta). Pointing out fallacies in sdhana is known as diisana. Diisana means pointing
a fallacious sdhana, that is sdhanbhsa. It means pointing out such defects in sdhana
that are existent here. Diisana is directed against sdhanbhsa and can never be directed
Notes
117
against sadhana. For a genuine sadhana there cannot be any dusana. Only when the
sadhana is fallacious is there a possibility o f dusana. In fact, sadhana and dusana are the
two positions adopted by the two parties in a debate. The proponent puts forth o n e s
position through sadhana, and the opponent tries to refute it through dusana. A fallacious
sadhana is known as sadhanabhasa. A fallacy may be because o f defect in thesis or
reason or example. To catch the fallacious sadhana , that is, to point out sadhanabhasa, is
known as dusana.
Dusanabhdsa means pointing out defects in a sadhana that are nonexistent. It is
allegating defects in a sadhana that are not there. Sadhana and dusana, along with their
respective fallacies, are meant for communicating knowledge to others. All these four are
involved in a debate where one party tries to refute the other. These are, therefore, different
aspects o f vdda-vidhi (art o f debate).
Perception and inference are the two m odes o f acquiring knowledge. Buddhists
belonging to the Dirinaga-Dharmaklrti tradition accept only two pramdnas , namely,
perception and inference. A knowledge is acquired by a knower for o n e s own sake.
According to Buddhists, perceptual knowledge concerns the objective real known as svalaks
ana. A svalaksana is devoid o f all determinations and characterizations; therefore, a
perceptual knowledge is also indeterminate. In this respect Buddhists fundamentally differ
from Naiyayikas, according to whom a perceptual knowledge can be determinate as well.
Buddhists accept five types o f determinations ( kalpand), namely, in terms o f substance,
qualities, action, class-character, and language. Buddhists insist that perception is devoid
o f all determinations, and, therefore, they define perception as kalpandpodha. Knowledge
o f an object by means o f a necessary mark is known as anumdna. A distinction is drawn
b e tw e e n svdrthdnumdna and pardthdnumdna. Svdrthdnumdna is ju st c o g n it iv e
(jndnatmaka), whereas pararthdnumdna is expressed in verbal propositions (sabddtmaka ).
Pardthdnumdna is covered up under sadhana, and under anumdna as a mode o f knowing
svdrthdnumdna is accepted. There is a possibility o f defects in both these modes of knowing.
The defective perception is known as pratyaksdbhdsa, and defective anumdna is known as
anumdndbhdsa. P erceptual k n o w led g e is n e c essa r ily indeterm inate. But i f it is
m isunderstood as determinate knowledge, then it is a fallacious perception. Perceptual
knowledge concerns objective reality ( svalaksana). A svalaksana can only be grasped
(grdltya) and not conceptualized ( adhyavasita). But if in a perceptual knowledge the objective
reality is conceptualized, then it becom es pratyaksdbhdsa.
Anumdndbhdsa is fallacious inference on account o f fallacious reason (hetvdbhdsa).
Since anumdna is taken here as svdrthdnumdna, only hetvdbhdsa is mentioned, not pratyaks
dbhdsa and drstdntdbhdsa, which com e under sadhanabhasa.
This is the synoptic account o f the vdda-vidhi (theory o f debate) and pramdna-vidhi
(theory o f knowledge), which are the two aspects o f ivydya concerning knowledge. There
are works dealing exclusively either with pramana or with vada, but here both are discussed
together. The verse that occurs at the beginning o f the text sums up the entire discussion
on vada and pramana presented in this text, and therefore it prefaces the text.
2. Sadhana consists o f three elements. They are paksa, hetu, and drstdnta. A sadhana
is always employed to establish something that is not known to the other party. Therefore,
it is necessarily communicative ( vacana). In fact, it is employment o f pardthdnumdna in
debate. W hen svdrthdnumdna is verbalized, it b ecom es pardthdnumdna, and when
pardthdnumdna is used in debate, it is known as sadhana.
3. Paksa is that which is brought to consciousness or manifested (pacyate iti paksah).
Paksa is always a subject taken with its predicate. It has two predicates. One is known or
118
Notes
wellknown, whereas the other is yet to be known. The latter is to be known on the basis of
the former. According to Buddhists, the paksa is the object of inferential inquiry and
su bject o f p roof. T he d e fin itio n o f paksa in the B ud dh ist tradition as svayam
sddJtyatvenepsitah means that it is something that one desires to prove; that is, it is something
that is upheld by the proponent (vddi) and directed to the opponent (prativddi) for proving.
R e a so n is the m e a n s th r o u g h w h ic h the h ith e r to n o t p r o v e d is p r o v e d .
Etymologically, heta means hi, hinoti, to know, which means that by which something is
proved. The paksa and the hetu should be accepted by both the parties; only then can they
make the hitherto unproved, proved.
4. These three features of reason constitute the formal conditions o f the validity o f
anumdna and therefore o f sddhana. Violation o f any o f these three results in a fallacy.
Since there are three features o f reason, therefore, there are three types o f fallacy pertaining
to reason.
5. H om ologu e and heterologue are the supporting factors for proving a thesis.
H om ologue is affirmative, and heterologue is negative in nature. Both are grounded in
experience, and their veracity is wellestablished. H om ologues are known substrata o f the
presence of probandum, and heterologues are the known substrata of the absence of
probandum. The hom ologue provides positive support, and the heterologue provides
negative support to reason in proving the probandum. Since the relation o f probandum
with the substrata involved in hom ologues and heterologues is that o f logical necessity,
both o f them provide the logical ground for the relation o f invariable concomitance between
reason and probandum. The hom ologue points out that there is at least one such case that
is similar to subject and that can serve as a corroborative instance for the existence o f
probandum in the particular subject where reason is also present. The heterologue also
provides a negative support insofar as it points out that there cannot be any presence of
reason in the absence o f the presence o f probandum, and, therefore, the presence of
reason in the particular subject provides the necessary ground for the presence of probandum
in that particular subject.
6.
Enumeration o f example provides further support to the reason in proving its
probandum. Since the relation between the reason and the probandum can be either positive
or negative, accordingly, there can be two types of example. The positive example instantiates
the hom ologue, and the negative example instantiates the heterologue. The difference
between heterologue and hom ologue and their corresponding examples can be understood
in terms of a formal statement o f a relation and its concrete instantiation. Historically,
before the idea o f generalization or universalization came to be formulated, examples
alone served as the basis for proof. But when the need and necessity o f generalization
were met in terms o f vydpti or the relation o f invariable concom itance, the role o f
example became subservient to that o f vydpti . Nevertheless, the probative role o f the latter
was not discarded or belittled. The sddhamiya drstanta is o f the same nature as that o f the
sapaksa . Likewise, vaidharuiya drstanta is o f the same nature as that o f the vipaksa.
In the Buddhist tradition sddhana, which stands for a m eans to com m unicate
knowledge to others, always consists o f three elements, the thesis, the reason, and the
example. All three have to play their respective role in the sddhana. In other words, the
thesis must be wellform ulated, the probative reason must be w elladduced, and the
corroborative examples must be suitably enumerated.
7. In the formulation o f a sddhana if any of the three constituents are vitiated by some
defects, then it is known as sddhandbhdsa. The sddhandbhdsa can be o f three types: paks
dbhdsa, hetvdbhdsa, and drstdntdbhdsa. In the Nyaya system the roles of paksa and drst
Notes
119
anta are made subservient to the role o f hetu, and therefore it concentrates on hetvabhasas
alone, but Buddhist logicians take into account the other two types o f fallacy also. Let us
clarify som e points regarding these nine paksabhasas one by one.
(i)
S in c e w e k no w by p e rc e p tio n th a t w o rd s are a u d ib le (o r th e re is a u d ib ility in w o rd s ), the

s ta te m e n t W ords a re in a u d ib le is c o n tra d ic te d by p e rc e p tio n ,
(ii)
It is c o n tra d ic te d by the in fe re n c e A p o t is n o n e te rn a l b e c a u s e it is a p r o d u c t
(iii) In V aisesik a m e ta p h y sic s s o u n d is re g a rd e d to be p r o d u c e d , a n d , th e re fo re , it is n o n e te rn a l.
(iv) A c c o rd in g to p o p u la r b e lie f, th e fo r m e r is re g a rd e d as u n to u c h a b le , th o u g h n o t the latter.
(v)
It is n o t c le a r h e re w h e th e r a s ta te m e n t th a t c o n tra d ic ts o n e s fo r m e r s ta te m e n t w ill also
c o m e u n d e r this h e ad ;
(vi) A c c o rd in g to B u d d h ists, e v e ry th in g is m o m e n ta ry and th e re fo re n o n e te rn a l; b u t a c c o rd in g to
satkdryavdda o f S a m k h y a , all e n titie s p re e x ist in th e ir c a u s e , a n d , the re fore , they c a n n o t
a g re e to sabda b e in g p e ris h a b le .
(vii) H e re , th e e x isten c e o f s e lf is d e n ie d by B u d dh ists. T h e y den y b o th the s u b je c t an d the
p re d ic a te .
(viii) T h e y d o n t b elieve in the e x iste n c e o f soul o r h o ld th a t p le a su re an d so o n are q u a litie s
in h e rin g in so u l.
(ix)
S o u n d is a u d i b l e is a f a lla c io u s th e sis b e c a u s e s o m e t h in g is d e s ir e d to b e p ro v e d
(sddhyatvenepsitali) o n ly w h e n its tru th is at issue b e tw ee n the tw o p a rtie s, b u t this is n o t the
ca s e w ith S o u n d is a u d ib le , and so it is a fallacio u s thesis. T h is is a fallacy o f triv iality
b e c a u s e it is a b su rd an d falla c io u s to o ffer as a thesis a s ta te m e n t th a t e v ery o ne w ou ld a c c e p t
as a p la in s ta te m e n t o f fact.
8. According to the doctrine o f trairupya there are three conditions which regulate
the validity o f a reason (hetu). Violation o f any of the three conditions results in making
the reason invalid. Thus, there are three types o f fallacies o f reason.
9. Sapaksaikdesavrttih vipaksavyapi: Inconclusive ( anekdntika) is sixfold. The first
two, being easy to understand, do not require explaination. Here we are giving the detailed
explanation for the remaining four.
Thesis;
Sound is naturally existing (non effort-made)
Reason:
Noneternality
H om ologoue:
Lightning, space, and so on
In one part o f hom ologue, that is, lightning, reason (noneternality) resides but not in
the other part, that is space.
Thesis:
Sound is naturally existing (non effort-made)
Reason:
Noneternality
Heterologue:
Pot
Reason (noneternality) resides in the entire class o f heterologues; therefore, the reason
is inconclusive here.
10. Vipciksciikcidesavrtti sapaksavyapi:
Thesis:
Sound is effort-made
Reason:
Noneternality
H om ologue:
Pot, and so on
Here, reason resides in the entire class o f hom ologues.
Thesis:
Sound is effort-made
Reason:
Noneternality
Heterologue:
Lightening, space, and so on
Here, reason resides in one part of the class o f heterologues, that is, lightning and so
on, and d o e sn t reside in another part, that is space and so on. Therefore, the reason is
120
Notes
inconclusive here.
11. Ubhayapaksaikadesa vrtti:
Thesis:
Sound is eternal
Reason:
Incorporeality
Homologue:
Space, infinitesimal particles, and so on
Here, reason resides in one part o f the hom ologue, that is space and so on and does
not reside in another part, that is infinitesimal particles and so on.
Thesis:
Sound is eternal
Reason:
Incorporeality
Heterologue:
Pot, pleasure and so on
Here, reason (incorporeality) resides in one part o f the heterologue, that is, pleasure
and so on, and does not reside in another part, that is, pot and so on. Therefore the reason
is inconclusive here.
12. Viruddhavyabhicdri:
Here, two different theses are given, one put forth by Vai&sikas and another by
Mlmamsakas. According to Vaisesikas Sound is noneternal because it is produced, like a
pot and so o n , and, on the contrary, according to Mlmamsakas, Sound is eternal because
o f its audibility, like soundness.
(a)
(b)
Thesis:
Reason:
Thesis:
Reason:
Sound is noneternal
Produced
Sound is eternal
Audibility
Here, we have two contradictory theses supported by two different valid reasons
about the same subject, sound. As Vidyabhushana puts it, "This fallacy arises when a
thesis and its contradictory are both supported by what appear to be valid reasons." This
fallacy is known as viruddhavyabhi cdri because the theses are mutually contradictory, but
they are validly established by their respective reasons. If taken separately, each appears to
be valid, but doubt arises only when they are taken together. Here it can be asked how this
fallacy is not different from the fallacy o f too narrow discussed earlier. The reply is that
it arises only when one argument alone is taken independently o f the other. But when both
are taken together, it would be the fallacy o f viruddhdvyabhicdri
In the Nyaya Bindu Tika Dharmottara gives two possible meanings o f the term
viruddhdvyabhicdri :
1. avyabhicari ofviruddha, that is, that which invariably proves the opposite o f what
is proved by another hetu.
2. viruddha, which is at the same time avyabhicari , that is, that which is opposed to
another hetu inasmuch as it proves its contradictory and is at the same time invariably
accompanied by its own sadhya , that is, which is good in itself, so far as its own vyapti is
concerned.
In the example Sound is noneternal on account of being produced like a p o t,
being produced is opposed to, or contradicted by, Sound is eternal on account of
audibility like soundness. The two reasons taken together cause doubt and are inconclusive.
The function o f a reason is to prove the existence o f the probandum in a particular
locus or paksa. A reason can perform this function if and only if it stands in the relation
o f necessary concomitance with its probandum. This implies that the reason should not be
such as to prove the opposite o f either the probandum or the thesis concerning the
Notes
121
probandum. Likewise, it should not disprove the very existence o f the probandum or the
thesis, nor should it disprove any essential property o f the probandum or the thesis.
Accordingly, four varieties can be conceived of the contradictory reason, namely, pertaining
to reason or to a particular reason and pertaining to a thesis or to a particular thesis. One
type o f fallacy is general, and the other one is specific or particular; one covers up the
entire existence, whereas the other covers up only a particular property.
13. Dharmasvarupaviparita sddhana:
Thesis:
Sound is eternal
Probandum:
Eternal
Reason:
Produced / effort made
If anything is produced, it cant be eternal. Likewise, if anything is effort made, it
must be naturally existing, and, therefore, must have a beginning. These two reasons
d ont reside in eternal entities (homologues) like sound; rather, they reside only in nonetemal
entities (heterologues). Thus, instead o f proving etem ality o f sound, they would prove the
opposite o f etemality.
14. Dharmavisesa viparltasadhana:
In the argument Eye and so on exist for the sake o f others (i.e ., self) on account of
their being o f the nature o f aggregates like bed, seat, and so on, which have parts , here,
we have,
Thesis:
Eyes and so on exist for the sake o f others
Reason:
Aggregateness
Probandum:
To exist for the sake o f others
This argument not only proves the existence o f eyes and so on for the sake o f others
on the ground o f being aggregates, but also proves the aggregateness o f the se lf This is
because if eyes and so on are aggregate, then one w hose purpose they serve should also be
aggregate. This is because o f transference of property. However, this is not acceptable to
the Samkhya school, which is the opponent here because, according to the Samkhya school,
se lf is not an aggregate. In this argument the reason is fallacious because it proves the
opposite o f the particular dharma or property that it is intended to prove. The reason, that
is, aggregateness, w hile proving that there is something beyond eyes, proves also that
som ething, namely, dtman , which Samkhya desires to prove, for the same reason is proved
to be having aggregation, a position that Samkhya is not prepared to hold. Samkhya
thinkers on the basis o f the previously stated reason want to prove not only the existence of
the individual self but also its being noncomposite. But, this argument not only proves the
existence o f se lf but also proves its com posite character.
15. Dharmisvarupaviparitasddhana:
The example given here is Existence ( bhdva) is not a substance or action or quality,
because o f its possessing one substance and because of its presence in qualities and actions
like the universal and particular.
T hesis
Existence (mahdsdmdnya) is summum-genus
Probandum
:
Existence is different from substance or
action or quality
But this argument is vitiated by a fallacy o f hetu contradicting a thesis, say Buddhists.
Because the same bipartite hetu , namely,
Reason:
(a) Because it possesses a single substance
(b)
Because o f its presence in qu
would prove the absence o f the thesis, that is, bhdva as well as absence, that is, abhdva.
Thus, this bipartite hetu may prove that bhdva is abhdva, which is the very opposite o f the
122
Notes
thesis. Buddhists here are refuting the Vatfesika concept o f bhava, which is the swnmiun
genus, on the ground that the reason put forth to establish the existence o f bhava, in fact,
disproves its very existence. It no doubt proves that existence is different from substance,
qualities, and actions, but it also proves the absence of existence.
16. Dharmivisesa vipantasddhana:
Here, the example given is the same as before with the addition that the thesis is taken
along with its particular property, namely, the causal capability o f giving rise to the notion
It is existent . In this argument both the reasons not only prove the property o f causing
the notion it is existent but also prove the absence o f this property. The Vaisesikas are
realists in their epistemology, and therefore they argue that existence alone is the cause o f
the notion that it is existent.
17. In the theory o f inference, example plays a significant probative role. It acts as a
support to the reason in terms o f a concrete exemplification. It enumerates a case similar
to the vyapti situation, that is, a locus in which reason necessarily coexists with the
probandum. Such cases are known as sapaksa or hom ologue. A sapaksa is always similar
to paksa insofar as it possesses the coexistence o f reason and probandum. But in terms of
assuredness o f the coexistence o f reason and probandum, it is on a strong footing compared
to that o f paksa. An example based on similarity reinforces the positive concomitance, and
an example based on dissimilarity reinforces negative concomitance. So, the former consists
o f enumeration o f hom ologue, and the latter consists o f enumeration o f heterologue. If the
example is not in conformity with hom ologue or heterologue, it is fallacious. Thus, there
are two types o f fallacy of example: one in which sapaksa is not valid, and the other in
w hich vipaksa is not valid.
18. Sddhana dharmdsiddha:
The example given is Sound is eternal on account o f its being incorporeal like
infinitesimal particle. Here,
Thesis:
Sound
Reason:
Incorporeality
Probandum:
Etemality
H om ologue:
Infinitesimal particle
Here the hom ologue (i.e., infinitesimal particle) no doubt possesses the probandum
(i.e ., eternality) but d o esn t possess the reason (i.e ., incorporeality). Therefore, the
hom ologue is not similar to the thesis. The reason does not exist in the hom ologue, and
therefore the hom ologue does not have any probative value. Only that hom ologue has
probative value that has the presence o f both the reason and the probandum.
19. SddJiyadharmasiddha:
In the example Sound is eternal on account of its being incorporeal like intelligence ,
Thesis:
Sound
Probandum:
Eternality
Reason:
Incorporeality
H om ologue:
Intellect
Here the hom ologue (i.e., intellect) no doubt possesses the reason (i.e., incorporeality)
but does not possess the probandum (i.e., eternality). Therefore, the hom ologue is not
similar to the thesis. As before, the hom ologue does not have the probative value because
it lacks the probandum.
20. Ubhayadharmdsiddha:
This is twofold: affirmative and negative. An example o f the former is Sound is
eternal on account o f being incorporeal like a po t . Here,
Notes
123
Thesis:
Sound
Reason:
Incorporeality
Probandum:
Eternality
H om ologue:
Pot
The hom ologue (i.e ., pot) has absence of both reason and probandum; therefore, the
hom ologue is not similar to the thesis and therefore has no probative worth.
An example o f the latter is Sound is eternal on account of being incorporeal like
space . (This argument is valid only for those who believe in the reality o f space, but it
will not be valid for Buddhists, who do not believe in the reality of space.) Here,
Thesis:
Sound
Reason:
Incorporeality
Probandum:
Eternality
H om ologue:
Space
The existence o f h om o log u e (i.e ., space) is not acceptable to one party ( i.e .,
Buddhists).
21. Ananvaya:
The statement o f invariable concomitance is the very backbone and logical foundation
o f inference. N o inference can be valid in the absence o f such a statement. An example is
attached to such a statement. If an example is given without a statement o f invariable
concomitance, then it cannot have firm probative worth. Such an example will be fallacious.
In such a situation the mere coexistence o f probandum and reason is stated without pointing
out their relationship of invariable concomitance.
2 2 . Viparitanvaya:
In the argum ent in the pot there are the properties o f p r o d u c e d n e s s and
non eternality , the example lacks positive invariable concomitance. It would be a valid
example if it is restated as Whatever is produced is noneternal like a p o t. This fallacy
occurs when a positive invariable concomitance is stated inversely and therefore wrongly.
Thus, instead o f saying, Whatever is produced is noneternal, if it is said that Whatever
is noneternal is produ ced, then the order o f reason and the probandum are reversed, but
thereby the pervader becom es the pervaded, and the pervaded becom es the pervader.
2 3 . In dissimilarity we have a statement of heterologue that should have the absence
o f both reason and probandum. Like the fallacies based on similarity these are also o f five
types. In the classification o f the fallacies based on similarity, the starting point is reason
because the presence o f reason im plies the presence o f probandum, whereas in the
classification based on dissimilarity, the absence o f probandum implies the absence o f
reason.
24. SadJiyavydvrtta:
The exam ple Sound is eternal on account o f incorporeality like infinitesim al
particle , if converted to a statement o f negative invariable concomitance containing
dissimilar example o f heterologue, would then run as: Whatever is noneternal is corporeal
like infinitesimal particle. As per the rule, the same example cannot be adduced both as
heterologue and hom ologue. But in this case, the same example, that is, infinitesimal
particle, is put forth in both situations. Just as in the invariable concom itance between
smoke and fire, where kitchen can serve as a homologue, but it cannot serve as a heterologue,
whereas lake can serve as a heterologue, likewise, in this case also infinitesimal particle
can serve only as a h om ologue and cannot serve as a heterologue. In infinitesimal particle
incorporeality, which is reason, is absent, but nonetemality, which is probandum, is not
absent, whereas as per the rule both should be absent. Thus, it contains the fallacy of
124
Notes
n o n a b sen t p ro b a n d u m .
2 5. Scidhanavydvrtta:
H ere, the thesis is sam e as before, but the exam ple is d ifferent. Instead o f
infinitesimal particle here we have action. In this argument, the statement o f positive
invariable concomitance, Whatever is incorporeal is eternal , if converted to a statement
o f negative invariable concomitance containing dissimilar example o f heterologue, would
then run as, Whatever is noneternal is corporeal like action . As explained before, the
same example cannot serve as both homologue and heterologue. In action the probandum,
that is, eternality, is excluded, but the reason, that is, incorporeality, is not excluded.
26. Ubhayavydvrtta:
Again, the thesis is the same as before but the example is different. Instead o f an
infinitesimal particle or action, we have space here. In this argument the statement of
positive invariable concomitance, Whatever is corporeal is eternal, if converted to a
statement o f negative invariable concomitance containing dissimilar example or heterologue,
would then run as, Whatever is noneternal is corporeal like space . Here, both reason
and probandum are not absent because space is both eternal and incorporeal.
27 . Avyatireka:
Only the absence o f probandum and reason is said to belong to the example without
stating their negative invariable concomitance. Thus, instead of saying, Whatever is
noneternal is not incorporeal like a p o t, if we simply say, In pot reside corporeality and
noneternality , then it is a case o f nonstatement o f negative invariable concomitance.
2 8. Viparita vyatireka:
W hile stating negative invariable concomitance, first the absence o f probandum is
stated, and thereafter the absence o f reason is stated. But here, first the absence o f reason
is stated, and thereafter absence of probandum is stated. This is the fallacy of reversed
absences because here the logical order o f absences is not followed. Only absence o f
probandum im plies absence o f reason, not vice versa (sddliydbhdve sddhandbhavah ) .
The treatment o f the fallacious means o f proof com es to an end with the exposition of
its three varieties. The author discusses the means o f knowledge that are helpful in acquiring
knowledge for oneself. Thus, svasamvit and dtmapratydyana are synonyms, as parasamvit
and parapratydyana are synonyms.
According to Buddhists, the theory of knowledge is dependent on the theory of reality.
Since there are two and only two types o f objects, there are two and only two modes of
knowing. One and the same mode of knowing cannot cognize both types o f objects. Thus,
for Buddhists perception and inference are the only two ways of knowing. It is not that
Buddhists deny other ways o f knowing accepted in other schools. They only deny their
independent status and reduce them to inference.
Glossary
1.
.
3.
4.
5.
6 .
7.
8.
9.
.
.
1 2 .
13.
14.
15.
16.
17.
18.
19.
2 0 .
2 1 .
2 2 .
23.
24.
1 0
1 1
bhsa:
Abha sdhanadosa:
gamaviruddha:
Ananvaya:
Fallacy
Nonexistent defect in means of proof
Contrary to ones own scripture
Absence of statement of invariable
concomitance
Anekntika:
Inconclusive
Anwmdmr.
Inference
Fallacious inference
Anumnbhsa:
Anumnaviruddha;
Contrary to inference
Anyatarsiddhah :
Unacceptable to either
Aprasiddhavisesana:
A thesis whose subject is unacceptable
Aprasiddhavis'esya :
A thesis whose predicate is unacceptable
Aprasiddhobhaya :
Unacceptable to both parties
Aprayatnnantaryaka:
Natural, noneffort-made
Asdhrana:
Too narrow
Asiddha:
Unproved
Absent
y4yynr^/ca:
Absence of negative concomitance
Fallacy of unproved locus
sraysiddha:
Dharmasvarupaviparitasadhana: Reason contrary to probandum
Dharmavisesaviparitasadhana: Reason contrary to a particular probandum
Dharmisvarupaviparitasadhana: Reason contrary to thesis
Dharmivisesaviparitasadhana: Reason contrary to a particular thesis
Dosa:
Defect
Example
Drsna:
G lo s s a r y
126
25.
26.
27.
28.
29.
30.
31.
32.
33.
34.
35.
Drstnta-dosa:
Dsana:
Dsanbhsa:
ife/w:
Hetvbhsa:
Kalpan:
Linga:
Lokaviruddha:
Paksa:
Paksbhsa = pratijndosa:
Paksadharmat:
36. Paksadharmatva:
37. Paramnu:
38. Prasiddha Sambandha:
39.
40.
41.
42.
43.
44.
45.
46.
Prsnika:
Pratyaksa:
Pratyaksbhsa :
Pratyaksaviruddha :
Prayannanaryaka :
Sdhana:
Sdhnbhsa :
Sdhanadharmsiddha :
47.
48.
49.
50.
51.
Sdhanadosa:
Sdhanvyvrtti:
Sdhrana:
Sdharmya:
Sdharmya drsnbhsa:
52. Sdhya:
53. Sdhyadharmsiddha :
54.
55.
56.
57.
58.
59.
60.
61.
Sdhyvyvrtti:
Smnyalaksana:
Sapaksa:
Sapaksaikadesavrti:
Sapaksavypi:
Svalaksana:
Svavacanaviruddha:
Ubhayadharmsiddha :
Fallacy in example, fallacious example

Fallacy in means of proof or refutation
Fallacious refutation
Reason
Fallacy in reason, fallacious reason
Conceptualization
Necessary mark
Contrary to public opinion
Subject, thesis, locus
Fallacious thesis
N ecessary p resence of reason in the
thesis
Thesis having reason as its property
Infinitesimal particle
A thesis too well known or accepted
universally
Inquirer
Perception
Fallacious perception
Contrary to perception
Effort made
Means of proof
Fallacy in the means of proof
In c o m p a tib ility o f the exam ple w ith
the reason
Defective means of proof
Nonabsent reason
Too wide
Similarity
Fallacy o f exam ple on the basis of
similarity
Probandum
In c o m p a tib ility of the exam ple w ith
the probandum
Nonabsent probandum
Generalised image
Homologue
Pervading one part of homologue
Pervading entire homologue
Unique particular
Contrary to ones own statement
In c o m p a tib ility o f the exam ple w ith
both (reason and probandum)
G lossary
62.
63.
64.
65.
6 6 .
67.
6 8 .
69.
70.
71.
72.
73.
Ubhayapaksaikadesavrtti:
Ubhayasiddha:
Ubhaydvyavrtta:
Ubhayavrtta:
Vaidharmya (vyatireka):
Vaidharmya drstantdbhdsa:
Vidyamana:
Vikalpa:
Vipaksa (Asapakasa):
Vipaksaikadesavrtti:
Vipaksavyapi:
Viparitanvaya:
74. Viparitavyatireka:
75. Viruddha:
76. Viruddhavyabhicdri:
77. Visayakara (arthdkara):
127
Pervading one part of both
Unacceptable to both
Both are nonabsent
Both are absent
Dissimilarity
Fallacy of example based on dissimilarity
Present
Concept
Heterologue
Pervading one part of the heterologue
Pervading entire heterologue
Contrary to the statement of positive
concomitance
Contrary to the statement of negative
concomitance
Contradictory
Contradictory and divergent
Form of the object
Bibliography
Aniruddha, Abhidhammatasamgaho. Translated by Shwe Zan Aung and C.A.F. Rhys
Davids, London, Pali Text Soceity, 1910.
Asanga, Mahynastrlakra. Edited by Vaidya P.L., Darbhanga, Mithila Institute,
1960-64.
Akalaiika, Laghiy astray a. Edited by Mahendra Kumar, Ahmedabad, Sindhi Jain granth
M ala, 1939.
Areata, Hetu Bindu Tik. Baroda, Gaekwad Oriental Institute, 1949.
Bhartrhari, Vkyapadiya. Edited by Pillai K .R ., Delhi, Motial Banarsidass, 1971.
Bhatt, G. P., Basic Ways of Knowing, Delhi, Motilal Banarsidass, 1989.
Bhatta, Jayanta, Nyya Majari. Edited by Surya Narayana Shukla, Varanasi, 1971.
Bhatta, Kumarila, Sloka Vrtika. Darbhanga, K .S. Darbhanga Sanskrit University, 1979.
Chatterji, Durgacharana, Hetucakranirnaya, Indian Historical Quarterly 9, 1933, pp.
2 6 6 -2 7 2 ,
. Sources of Buddhist L ogic (From the Traditional Point o f View). Indian Historical
Quarterly 9, 1933, pp. 49 9 -02 .
. T he D o c trin e o f Trirupa H e t u . Indian Historical Quarterly 9 , 1 9 3 3 ,
pp. 503-10.
. Sources o f Knowledge in Buddhist L o g ic. Indian Culture, Calcutta, no. 2- Oct.
1934 pp. 2 6 3 -74 .
. Hetucakrahamaru (also known as Hetucakranirnaya or Hetucakradamaru)
(Translation into English), Indian Historical Quarterly, 9, 1933, pp. 511-14.
Chatterji, S .C ., Nyya Theory of Knowledge. Calcutta, Calcutta University, 1939.
Chi, Richard S. Y., Buddhist Formal Logic (A Study o f D iiinagas Hetucakra and K UeiC h is Great Commentary on the Nyya Pravea). D elhi, Motilal Banarsidass, 1984.
Chinchore, Mangala R, Vdanyya; A Glimpse of Nyya-Buddhist Controversy, D elhi,
Sri Sadguru Publications, 1988.
. Som e Thoughts on Significant Contribution of Buddhist Logicians. Journal of
Indian Philosophy , 15, no. 2 June 1987, pp. 155-71.
Croce, Bendetto, On Indian L o g ic . East and West (Roma), 4, 1953, pp. 1-30.
Das, Rasvihary, Relations in M odern Indian L o g ic. The Calcutta Review, 45 , no. 2,
1932, pp. 143-60.
Dasgupta, S. N ., A History of Indian Philosophy, 5 vols. Cambridge, Cambridge University
Press, 1951.
Dharmaklrti. Hetu Bindu (with Tik by Areata and Aloka by Durveka Mtra). Edited by
130
B ibliograp hy
Sanghavi, Sukhalalji, and Muni Jinavinayaji, Baroda, Baroda Oriental Institute,

1949.
. Nyya Bindu. Edited by Shastri, Chandrasekhara, Banaras, 1954.
. Pramna Vrtika. Edited by Pandeya R .C ., D elhi, Motilal Banarsidass, 1989.
. Santnntarasiddhi. Edited by Kitagawa and Hidenoir. Journal of Greater India
Society 14, no. 1,2, 1955, pp. 407-29.
. Svrthnumna-pariccheda. Edited by Dalasukha Bhai Malvaniya, Varanasi, 1959.
. Vda Nyya (with Viparicitrtha by ntaraksita). Edited by Sankrityayana, Rahula.
Appendix to Journal of Bihar and Orissa Research Society, 1949, pp. 21-22.
. Vda Nyya (with by Viparicitrtha and Sambandhapariks). Edited by Swami
Dwarikadas Shastri, Varanasi, 1972.
. Pramna Vinis'caya. Edited by Steinkellner, W ien, Verlag Der Ostereichischen
Akademe Der Vissenschaften, 1973.
Dharmottara, Nyya Bindu Tik. Edited by Shastri Chandrasekhar, Banaras, Chaukhamba,
1954.
Dharmarja Adhvarlndra, Vednta Paribhs. Translated by Swami Madhvananda, Belur
Math, Rama Krishna M ission, 4th edition, 1972.
Dinga. lambana Pariks Vrtti. Edited by N. Shastri Aiyaswami, Madras, Adyar Library,
1942.
. Nyya MukJia, Edited by Tucci Guiseppe, vol. 1. Heidelberg, Jabuch des Institutes
fur Buddhismus Kunde, 1930.
. Nyya Praves'a. Edited by B. J. Sandesara, Baroda, Baroda Oriental Institute,
1968.
. Pramna Samuccaya ( Pratyaksa Khanda) (S vavrttisa h ita). E d ite d by
H. R. Iyengar Rangaswamy, Mysore, Mysore Press, 1930.
Durveka, Mira, Dharmottara Pradipa . Edited by Dalsukhabhai Malvania, Patna, Kashi
Prasad Jayaswal Research Institute, 1971.
Gokhale, P. P ., Inference and Fallacies Discussed in Ancient Indian Logic. D elhi, Sri
Satguru Publications, 1973.
G u p ta , P raj kara, Pram navrtiklakra (a ls o k n o w n as Pram navrtika
Bhsrya). Edited by Sankrityayana, Rahul, Patna, Kashi Prasad Jayaswal Research
Institute, 1953.
Gupta, Rita, The Buddhist Doctrine o f Momentariness and Its Presuppositions. Journal
of Indian Philosophy 8, no. 1, March 1980.
Hastings, James, Encyclopaedia of Religion and Ethics. Edinburah: T. & T. Clark, N ew
York.
Hattori, Masaki. Dinga on Perception {Pratyaksa Pariccheda of Difinagas Pramna
Samuccaya). Cambridge, 1968.
. Fragments from Pramna Samuccaya. Journal of Indian Buddhist Studies, no.
I, 1958, pp. 330-35.
. Pratyaksbhsa (Diiinagas View and Dharmaklrtis Interpretation,), Miscellanea
Indologica Kiotiensa, 6-7, March 1965, pp. 122-28.
Hayes, Richard P ., Dirmagas Views on R easoning (First half o f Svrthnumna
Pariccheda of Pramna SamuccayaJ, translated into English in Journal of Indian
Philosophy, 3, 1980, pp. 219-77.
Hemchandra, Pramna Mimms. Varanasi, Tara Publications, 1970.
Herzberger, H. G ., Double Negation in Buddhist L o g ic. Journal of Indian Philosophy,
3, March/April 1975, pp. 3-16.
B ib liograp h y
131
Hvara Krna, Samkhya Kdrikd. Edited by Chaturvedi Brij Mohan, Delhi, National
Publishing House, 1970.
Iyengar, Rangaswami
. Some Theories of Buddhist Logic in the Kavyalankara of Bhamaha. Proceedings
of All India Oriental Conference, No. 8 , 1935, Mysore, pp. 419-25.
. The Vdda Vidhi and the Vdda Vidhdna of Vasubandhu. Brahmavidyd. The
Adyar Library Bulletin 17, parti, 1953, pp. 9-19.
Jayatilake, K. N., Early Buddhist Theory of Knowledge. London, George Allen and Unwin,
1963.
Jitari, Hetutattvopadesa. Edited by Chattopadhyaya, Durgacarana, Calcutta, University of
Calcutta, 1939.
Joshi, Rasik Vihari, Treatment of Fallacy in Indian Logic. Nagpur, Vidarbha Samshodhan
Mandal, 1965, pp. 270-301.
Kajiyama, Yuichi, On the Theory of Intrinsic Determination of Universal Concomitance
in Buddhist Logic. Journal of Indian Buddhist Studiesf 7, pp. 354-60.
. The Avayavi Nirakarana of Pandita ASoka. Journal of Indian Buddhist Studies,
9, no. 1 1961, pp. 371-76.
KamalaSila, Tattva Samgraha Panjika, 2 Vols., Edited by Shastri Dwarikadass, Varanasi,
Bauddha Bharati, 1981, reprint Delhi, Motilal Banarsidass, 1986.
Kashyap, Jagdish. (Edited). Kathdvatthu. Bihar Pali Publication Board, 1961.
Katsura, Shoryu, New Sanskrit Fragments of the Pramana Samuccaya, " Journal of
Indian Philosophy 3, March/April 1975, pp. 67-78.
Keith, A. B. Vasubandhu and His Vdda Vidhi. Indian Historical Quarterly 4, 1928, pp.
221-27.
. Indian Logic and Atomism. New Delhi, Oriental Reprint, 1977.
Kenneth, K. I., Some Basic Misconceptions of Buddhism. International Philosophical
Quarterly 10, no. 1, March 1969.
Kher, Chitrarekha, The Concept of Pramana according to Dinnaga and Dharmaklrti.
Journal of the Oriental Institute 22, no. 3, March 1973, pp. 256-64.
Kitagawa, Hidenoir, (Edited). A Refutation of Solipsism (An Annotated Translation of
the Santanantarasiddhi). Journal of Greater India Society; 14, no. 1,2, 1955, pp.
407-29.
. A Note on the Methodology in the Study of Indian Logic. Journal of Indian
Buddhist Studies 8 , no.l, 1960, pp. 380-90.
Matilal, B. K., and Robert D. Evans, Editors, Buddhist Logic and Epistemology; Studies
in the Buddhist Analysis of Inference and Language. Dordrecht, D. Reidel, 1986.
Mira, Durveka, Dharmottara-Pradlpa. Edited by Malvania Dalsukhabhai, Patna, K.P.
Jayaswal Institute, 1971.
Mira, Parthasarathi, Nyaya Ratna Mala. Baroda, Gaekwad Oriental Institute, 1937.
MiSra, Vacaspati, Nydyavartikatatparyatika. Edited by Dravid Shastri. R., vols. 1, 2,
Varanasi, Chowkhamba Sanskrit Samsthana, 1926.
Moksakaragupta, Bauddha Tarka Bhajd. Edited by Giri, Raghunatha, Varanasi, PrSchya
Prakashana, 1969.
Mookeijee, Satkari, (Edited). Vols. 1,2, Patna, Nav-Nalanda Mahavihara Research, 1937.
. Buddhist Philosophy of Universal Flux. Delhi, Motilal Banarsidass, 1975.
. Manasa pratyakja: A Conundrum in the Buddhist Pramana System. Dordrecht,
132
B ib liograp h y
D. Reidel, 1980, pp. 243-60.

Oliver, J.W., "Formal Fallacies and Other Invalid Arguments. Mind, 76, 1967.
Randle, H. N. Fragments from Dinnaga. Delhi, Motilal Banarsidass, 1981.
. Indian Logic in the Early Schools. Delhi, Oriental Books Reprint, 1976.
. A Note on the Indian Syllogism. Mind, 33, 1924, pp. 398-414.
Saradchandra, E. R., "From Vasubandhu to antarakita. Journal of Indian Philosophy
4, no. 1, 1976, pp. 67-77.
Shah, Nagin J., Akalahkas Criticism of Dharmakirtis Philosophy. Ahmedabad. L. D.
Institute of Indology, 1967.
Sharma, Brajanarayana, Bharatiya DarJana main Anumdna. Bhopal, M. P. Hindi Granth
Academy, 1973.
Shastri, D.N., The Philosophy of Nyaya-Vaisesika and Its Conflict with the Buddhist
Dinnaga School (Critique of Indian Realism). New Delhi, Bharatiya Vidya
Prakashana, 1976.
Shastri Dwarikadas, (Edited). Sutta Nikaya. Varanasi, Bauddha Bharati.
. Uddyotakara ka Nyaya Vdrtika eka Adhyayana. Kanpur, Bharatiya Prakashana,
1974.
Stall, J. F., "Correlations between Language and Logic in Indian Thought. Bulletin of
the School o f Oriental and African Studies, 23, no. 1, 1960,
pp. 109-22.
3antarak$ita, Tattva Samgraha, Edited by Shastri Dwarikadass, Varanasi, Bauddha Bharati,
1981, reprint Delhi, Motilal Banarsidass, 1986.
. The Concept of Pak$a in Indian Logic Journal of Indian Philosophy, 2,
no. 2, 1973.
Sugiura, Sadajvio. Hindu Logic as Preserved in China and Japan. University of
Pennsylvania Press, 1900.
. "Is the Nyaya Pravesa by Dinnaga. Journal of the Royal Asiatic Society 82,
1928, pp. 7-13.
. "Buddhist Logic before Dinnaga. *Journal of the Royal Asiatic Society 81,1929,
pp. 451-88.
. On Some Aspects of the Doctrines of Maitreyanatha and Asafiga. Calcutta,
Calcutta University, Press, 1930.
. Pre-Dihnaga Buddhist Texts on Logic from Chinese Sources. Madras, Vesta,
1981.
. The Problem of Svalakfana in Sautrantika Epistemology. Journal of the
Oriental Institute 20, 1970-1971, pp. 216-25.
Th. Stcherbatsky, Buddhist Logic Vols. 1 and 2. Delhi, Motilal Banarsidass, 1993.
Uddyotakara, Nyaya Vdrtika. Edited by Thakur, Anant Lai, Vaishali, Prakrita Jain
Institute.
Vacaspati, Nyaya Vdrtika Tdtparya Tikd. Edited by Thakur, Anant Lai. Vaishali, Prakrita
Jain Institute.
Vadi Deva Suri, Pramananayatattvalokdlankdra. Bombay, Jain Shitya Vikas Mandal,
1967.
Vasubandhu, Abhidharmakosa, 4 vols. Edited by Shastri Dwarikadass, Varanasi, Bauddha
Bharati, 1970-74.
Vatsyayana, Nyaya Bhasya. Edited by Thakur Anant Lai, Vaishali, Prakrita Jain Insititute.
Vidyabhushana, S. C ., Requisites of a Good Hetu. Annals of the Bhandarkar Oriental
Research Institute, 46, 1965, pp. 43-48.
B ib lio g ra p h y
133
. A History of Indian Logic. Delhi, Motilal Banarsidass, 1978.

Vinltadeva, Nydyabindutlkd. Edited by Mrinalakanti Gangopadhyaya, Calcutta, Indian
Studies Past and Present, 1971.
ViSvanatha, Bh&sa Pariccheda. Varanasi, Chaukhamba Sanskrit Series, 1972.
Wayman, Alex. "The Rules of Debate according to Asanga. Journal of the American
Oriental Society 78, no.l, 1958, pp. 29-40.
. A Reconsideration of D harm aklrtis Deviation from Dinnaga on
Pratyaksabhasa. Pune, Annals of the Bhandarkar Oriental Research Institute, Vol. 8 ,
49. 1977-1978.
Index
WORDS
Abdhitaviayam, 84.
Abhva, 77.
Abhilpasamsargayogya pratibhsapratti,
30, 31, 32, 33.
Abhrntam (nonerroneous cognition),
29-30.
Adhyavaseya, 19, 21.
Agrahtagrhi, 63.
Ajntrthapraks'a, 45.
Anabhilpya, 31, 44.
Anantaryaka, 64.
Anityat, 3, 4.
Antarendriya, 46.
Anuloma, 51.
Anumna, 23, 24, 25, 27, 35, 43ff.
Anumeya, 53, 70, 71, 79.
Anumiti jnna, 54, 55.
Anupalabdhi, 54, 6 8 , 69, 70, 99.
Anvaya, 54, 59.
Anvaya jfnam, 50.
Anya, 76.
Anypoha, 8 , 49.
Anyathnupapatti, 8 6 , 87.
Apadesa, 96.
Apoha, 8 , 54.
Arthakriykritva, 2, 11, 30, 45, 50.
Arthasrpya, 20-21, 33.
Arthbhsa (arthkra, viaykra,

visaybhsa), 17, 18, 43.
Arthdhigati (visaydhigati), 18.
Asadhetu, 78, 84.
Asamdigdhatvam, 32, 33.
Asapakfa or vipaksa, 53, 64, 77ff.
Asatpratipakatvam or Aviruddhatvam, 85.
Asdhannga, 99.
Atadvyvrtti, 26.
i4vayavfl, 93, 94, 96.
98.
Avayavatraya, 98.
Avinbhva, 52, 57, 58, 64, 72-74, 78.
Avisamvdakatvam (nondiscordance),
12, 20ff. 32-57.
i4vrtti, 87, 90.
gama, 51, 52.
gama jnna, 44.
khyna, 52, 65.
layavijfina, 8 .
rya-aytngikamrga, 3.
tmasamvedana, 47.
Bhyrthavda (Realism), 7, 14.
Bhrnta jnna, 58, 59.
5.
Bhtasanghta, 2.
Causality, relation of, 69, 75.
Caitta, 47.
Index
136
Change, 1.
Citta, 5, 47.
Citta sanghta, 2.
Karma, 23, 28, 6 6 .

Karana, 14, 22.
Kdraka, 11, 12.
Kdrana, 13, 69.
Kdrana sdmagri, 14.
Kdrmic-force, 3.
Knowledge, (samyakjhdna) Theory of, ix,
llff., 32, 54, 55.
Types of, 12, 23.
Kdrya, 6 8 , 69, 99.
Ksana, 2.
Ksana-santdna, 3.
Kfanikavada, 4.
Das'dvayavi, 93, 96.

Dhamma jnam, 50
Dharma, 58, 65.
Dharmi, 58, 65.
Dissimilarity, 109.
Dravya, 23, 28, 6 6 .
Drstnta, 94.
Dvairpya, 16,18, 21.
Ekadeavrtti, 87, 90.
Ekarpa, 78, 87.
Ekdhikaranya, 53.
Eva, 81, 84, 85.
Grahitagrhi, 63.
Gamaka, 57, 73, 78.
Gamya, 57, 73. 78.
Grhya, 19, 53, 58.
Guna (Attributes), 23, 28,
Unga, 53ff., 57, 64, 65, 6 8 , 69. 70, 71,

77, 78ff.
Ungin, 57ff., 67, 69, 70, 71, 78.
6 6
Heterolouge. See Asapakja

Hetu, 51ff.
Hetu Cakra, 8 , 87.
Hetu vidy, 49.
Hetvbhsa, 34, 52, 55, 78, 84.
Homologue. See Sapaksa
Identity, relation of, 69, 75.
Indriya, 15, 45.
Indriya pratyaksa, 43-46.
Indriyrtha sannikar$a (rejection by
Dinriga), 27.
Inference (anumdna), 26ff.
Jti, 23, 28, 35, 6 6 .
Jijdsd, 67, 93, 94, 96.
Jnna, 18, 34.
JMntmaka, 65.
Jpaka, 11.
Kalpan, (See also vikalpa,
smnyalakfana), 23, 26-28, 30, 33,
43, 45, 58.
Kalpanpodha, 27ff.
Madhyamapratipad (middle path), 6 .

Manas, 15.
Manovijhana, 44, 46, 50, 51.
Manovijhdna dhatu, 46.
Manameyodaya, 4.
Mdnasa pratyaksa, 43-46.
Manadhindmeyasiddhih, 22, 24
Meyddhinamanasiddhih, 8 , 22, 24.
Mithya, 1.
Modes, 1.
Momentariness, 15, 16.
Nama, 23, 35.
Nama skandha, 2 .
Nantariyaka, 64.
Nigamana, 51, 93ff.
Niggaha, 51.
Nirdkarajhanavada, 19.
Nirupadhika, 8 6 .
Nirvdna, 3, 4.
Nirvikalpaka, 29, 35.
Niscitam, 81.
Noble Truth, 2.
53, 63ff.
Pakjadharmatd, 65-68, 71, 72, 84, 8 6 , 87,
96, 106.
Pak$dbhdsa, 106.
Pancakarani, 54.
Index
Pancarupa, 78, 84, 85.

Pancaskandha, 3.
Pancavayavi vakya, 51, 52, 94, 95.
Paramdrtha sat, ix.7.
Paratantra, 7, 8 .
Pardmaria, 94.
Pardrthdnumdna, 9, 49, 51, 52, 59, 63,
64, 98.
Parikalpita, 7, 8 .
Parinifpanna, 7, 8 .
Ptirokfa jndna, 26, 30, 49, 65.
Patikamma, 51.
Pdramdrthika, 54.
Prajnd, 7, 48, 51, 52, 90ff.
Prakdiana, 52, 65.
Pramanaphala, 13ff., 55, 56.
Pramanafdstra, 11, 49.
Pramdnavada, 38, 43.
Pramdnavyavastha, 8 , 24, 60, 62, 85,
Pramdnabhasa, 56.
Prameya, 50, 52, 56, 60.
Pratibhdsa, 16, 19-20, 27, 29-31, 61.
Aniyata, 19.
Niyata, 19.
Dharmaklrtis analysis, 2 0 .
Dinnagas analysis, 2 0 .
Pratibhasapratlti, 27, 30-31, 35.
Pratltyasamutpdda, 4, 6 .
Prativi?aya, 29.
Pratyaksa, 8 , 23ff. 49.
Dharmakirtis definition of,
28ff.
Dinriagas definition of, 27.
Vasubandhus definition of, 26, 29.
objects of, 30.
types of, 43ff.
Pratyak$abhdsa, 34.
Pratyaya, 15, 26.
Adhipati, 15, 26.
Alambana, 15, 19, 26.
Samanantara, 15, 26.
Prayojana, 93, 94.
Probandum. See Sddhya
Prdmdnya, 20, 54.
Pramanyavdda, 43.
Purvavat anumdna, 69.
137
Reality
theory of, 1 2 .
three levels of, 7, 8 .
Rdpa, 18.
Rupaskandha, 2.
Sadhetu, 6 8 , 78, 84.
Sahabhuhetu, 5, 14, 15.
Samanatara pratyaya, 45.
Samddhi, 6 , 48.
Samjfid skandha, 2.
Samskdra skandha, 2.
Samvrtti sat, 6 .
Samskdra, 3.
Sarirfaya, 93, 94, 96.
Samiayavyudasa, 93, 94.
Sandeha, 61
Santana, 3.
Sahghata, 2.
Sapakfa, 53, 64, 76ff.
Sapakfesattvam, 84, 8 6 , 87.
Sarvagyatd, 48, 53.
Savikalpaka, 32.
Sddhana, 7, 6 8 , 98, 105.
Sadharmya, 105,
Sadhandnga, 99.
Sddhya, 53, 64, 65, 6 8 , 70, 71, 72, 74.
Sakdra, 19.
Sakdrajnanavdda, 7, 20, 21, 22, 56.
Sdmarthya, 61.
Sdmanyalakfana, 8 , 16,20-21, 24, 34, 53,
58, 60, 61.
Samvrtika, 54.
arthasarupya, 2 2 .
as pramana 14.
vikalpa, kalpand, 25, 26.
in early Buddhism phlosophy, 14.
justification for its acceptance, 2 1 .
Sdrupya, 5, 6 , 7, 14ff., 32, 54.
Sifddhayifa, 67.
Sopddhika, 8 6 .
Svabhava, 6 .
Svabhava hetu, 6 8 , 69.
Svabhavapratibandha, 73.
Svabhavdnumana, 53, 6 6 , 98.
Svakarta, 55.
Svatovydvartana, 8 .
Svdrthanumdna, 9, 50, 52, 53, 63, 64, 97.
138
Self, Buddhist conception of, 3.

Substance, 1.
Suffering, 4.
Svalakfana, ix, x, 8 , 16, 20, 24ff., 53,
58, 60, 61,76.
Svapraksa, (svayamprakas'a,
svasamvedana) 14, 16, 43, 47.
Svasamvedana pratyakfa, 43, 46.
Svasamvitti, 14ff.
Svaatahprmnya, 16.
Svatahprmnyavda, 55, 56.
Svbhsa, 16ff., 43.
Svkra, 17ff.
abda, 52, 60, 94.
abdtmaka, 65.
akyaprpti, 93, 94.
Sesavat anumna, 69.
ila, 7, 48.
ramana tradition, 3.
unya, 4, 6 .
prapaca snya, 6 .
svabhva snya, 6 .
Tadupatti, 6 6 , 74, 76.
7fl/i/zd (longing), 2.
7hr*a, 75, 94.
Tatulya, 79.
Tattva-jMna, 11, 18.
Tdtmya, 74, 75.
Trairpya, 51, 52, 53, 64, 65, 77-79,
85-87.
Trayvayavi, 52.
Truth, criterion of, 14.
Udharana, 51, 84, 90ff.
Upamna, 52, 60, 94.
Upanaya, 51, 84, 93, 94, 96.
Vaidharmyena, 105.
Vairpya, 2 1 .
Vda-vidhi (art of debate), 49.
Vda s'stra, 49.
Vedanskandhat 2 .
Vijna, 6 , 7, 15, 56.
triple division of, 19.
Vijapti-mtra, 19, 20.
Vikalpa, (See also smnyalakana), 25ff.
Vipaka, 77.
Index
Vipakfdvyvrtti, 84.
Vipakje asattvam, 8 6 , 87.
Viruddha, 77.
Visaya, 15, 18.
Visayajfiana, 17, 18.
Viayajfina-jnna, 17, 18.
Vifaybhsa. See Arhbhsa.
Vifaydhigama, 14.
Visaykrat, 55.
Vyatireka, 54, 59, 94, 106.
Vyavasytmaka, 32.
Vypaka, 74, 87, 90.
Vypti, 53, 55, 57, 58, 65, 71, 72, 74, 75,
96.
Vypya, 6 8 , 74.
Yogi pratyakja, 43, 44, 48.
Yogi jrina, 44, 48.
AUTHORS, WORKS, AND

SCHOOLS
Abhidhamma, 51.
Abhidhamma literature, 46. 50.
Abhidharma Koia, 7.
Abhisamaylankra Krik, 7.
Advaita Vednta, 2.
Akalanka, 85, 8 6 .
Anantavirya, 8 6 .
Antmavda (no-substance ontology), 2.
Anumna Stta, 50.
Arcata, 62, 74.
Asanga, 7, 8 , 33, 51, 52.
Aviddhakarna, 97.
lambana Parik, 9.
tamavda (substance ontology), 2 .
Bhartrhari, 54, 59.
Bodhisattvacary Nirdefa, 7.
Crvka, 3, 49, 54.
Codan Prakarana, 9.
Chi, 82, 83, 84.
Dharmakirti, 9, 11, 12.
on inference, 49ff.
on knowledge, 11, 12, 14.
on perception, 26
Index
on pramna and pramnaphala 14.

on pratibhsa, 2 0 .
on srpya, 14.
on types of perception, 46ff.
Dharmottara, 12, 14, 20, 30, 31, 33, 34,
35,44, 45,54, 63,64, 65,73, 81.
on pramna, 14.
on pramna and pramnaphala,
13, 14.
on process of apprehension of an
object, 1 2 .
on srpya, 14.
on types of perception, 46.
Dinnga: ix. 7, 8 , 9.
on inference, 49ff.
on knowledge, 13ff.
on perception, 26ff.
on pratibhsa, 20.
on srpya, 14, 21.
on types of perception, 43.
Durveka, 46.
Gangesa, 8 , 55.
Gautam, the Author of Nyya Stra, 29.
Hattori, 17-19.
Hemacandra, 8 6 .
Hetu Bindu, 9.
He/w Cafcra Damaru, 9, 76, 81, 87.
Hnayna, 4.
Jainism, 2, 78, 85, 8 6 , 98.
Jayanta, 95, 96, 97.
Jnnasri Mitra, 54.
Kamalasila, 32, 34, 35, 54.
Kathvatthu, 51.
Keith, 52.
Mahyna, 4.
Mahynbhidharmasamyuktasangitis'stra,
51.
Maitreya, 7, 8 .
Materialism, 4,
Mdhavcrya, 5.
Mdhyamika, 4, 6 .
Mnameyodaya, 4.
139
Mmms, 2, 26, 60, 94.

Mokfkaragupta, 54, 70, 99.
Mookherjee S., 98.
Naiyyika, 60, 64.
Navya-Nyya, 8 , 67.
Ngrjuna, 6 , 51.
Nryana Bhatt, 4.
Ttydya, 51ff. 67, 69, 70, 84, 85 , 95.
Nyya i/afa, 9, 11, 20, 30, 44, 48, 53,
63, 64, 70, 98.
Nyya Bindu Tik Tippani (Durveka Mira)
46, 50, 51.
Nyya Mukha, 9, 33.
Nyya Praves'a, ix, x, 9.
Nyya stra, 49.
Nyya Stra (Gautam), 29, 98.
Nyya-Vaiseika, 2.
Nyya Vrtika Tik, 6 8 .
Nikyas, 50.
Parisuddhi, 55.
Ptrasvmi, 8 6 , 87.
Prabhcandra, 8 6 .
Prajkaragupta, 54
Prakarana, 51.
Prakaranrya Vcsstra, 51.
Pramna Samuccaya, 9, 47, 55, 60, 73,
110 .
Pramna Vrtika, 9, 12, 44, 48, 53, 70,
98.
Pramna Vinicaya, 9.
Ratnakirti, 54.
Sambandha Pariks, 9.
Santnntara Siddhih, 9.
Saptadasabhmisstra, 7, 51.
Sarvstivda, 14.
Sautntrika, 4, 5, 6 , 9, 14, 15, 16.
Skrajanavda, 6 .
Smkhya, 2.
ntaraksita, 14, 33, 34, 35, 44, 54, 8 6 ,
87, 96, 97, 99.
Stcherbatsky, Th., 14, 16, 33, 45, 52, 64,
82.
Sutta Nikdya, 50.
Strnta, 6,1.
Index
140
rtdhara, 96, 97.

nyavda, 6 .
Tarka stra, 7, 51, 52.
Tattva Samgraha, 8 6 .
Tipitaka, 3, 5, 50.
Tucci, 51.
Udayana, 55.
Uddyotakara, 52, 79, 80, 96, 97.
Upanifadic thought, 1.
Vaibhfika, 4, 5, 15.
Vasubandhu, 7-9, 26ff., 34, 43, 49, 51,
52, 64, 79.
Vcaspati, 55, 95, 97.

V&to VMM, x, 7, 51, 64.
Vda Koala, 7.
Vda Mrga, 7.
Vdidevasri, 8 6 , 93.
Veddntin, 54.
Vibhfd, 5.
Vidyabhusana, 52.
Vidynanda, 8 6 .
Vijnavdda, 4, 7, 14, 21, 43, 56,
Vinltadeva, 33.
Yogacarybhumistra, 51.
Yogcra (Vijnavdda), 4, 6 , 9, 23, 47.
About the Authors

S. R. BHATT is Senior Professor of Philosophy at Delhi University. His research
interests include Indian philosophy, logic and epistemology, social and political
thought, and philosophy of religion. He has published numerous scholarly articles
and seven books, including The Philosophy ofPancaratra (1968) and Knowledge,
Values and Education (1986).
ANU MEHROTRA is senior scholar of Philosophy at Delhi University. Her research
interests include Indian Philosophy, logic and epistemology, philosophy of reli
gion, and social and political thought. She has published scholarly articles on
Nehru and Buddhist Philosophy.

(Contributions in Philosophy) S. R. Bhatt, Anu Mehrotra-Buddhist Epistemology-Greenwood Press (2000) PDF

Diunggah oleh

Informasi Dokumen

Judul Asli

Hak Cipta

Format Tersedia

Bagikan dokumen Ini

Bagikan atau Tanam Dokumen

Opsi Berbagi

Apakah menurut Anda dokumen ini bermanfaat?

Apakah konten ini tidak pantas?

Hak Cipta:

Format Tersedia

(Contributions in Philosophy) S. R. Bhatt, Anu Mehrotra-Buddhist Epistemology-Greenwood Press (2000) PDF

Diunggah oleh

Hak Cipta:

Format Tersedia

BUDDHIST

The Last Choice: Preemptive Suicide in Advanced Age, Second Edition

Diogenes of Sinope: The Man in the Tub

The Adventure of Philosophy

Intentionalist Interpretation: A Philosophical Explanation and Defense

Natural Law Ethics

Anglo-American Idealism, 1865-1927

Two Views of Virtue: Absolute Relativism and Relative Absolutism

Liberty: Its Meaning and Scope

Contributions in Philosophy, Number 75

Westport, Connecticut London

Library of Congress Cataloging-in-Publication Data

The paper used in this book complies with the

1. The Buddhist Theory of Knowledge

2. The Buddhist Theory of Perception

3. The Buddhist Theory of Inference

Appendix 2: Nyayapravesakasutram (Translation)

form of evolution from one mass of matter or in the form of a combination of

NO-SUBSTANCE ONTOLOGY OF BUDDHISM

causally regulated. In case of a human being, the series is psychophysical, having

HISTORY OF BUDDHIST THOUGHT

DEVELOPMENT OF YOGCRA EPISTEMOLOGY

Meyadhinamanasiddhih : epistemology is to be constructed to support ontology.

auto-commentary (Svavrtti) , Nyaya Pravesa, Nyaya Mukha, Alambana Pariksd,

The Buddhist Theory of

Different from knowledge is false cognition. Cognition that makes us reach

THE PROBLEM OF PRAMANA

The Buddhist Theory of Knowledge

cognition of an object (visayadhigama). According to the other, it consists in

The Concept of Sarupya in Early Buddhist Philosophy

The Buddhist Theory of Knowledge

There the perceptual cognition is regarded to be a resultant of three types of

sainanantarapratyaya (i.e., perceiving consciousness),

Here a question naturally arises as to why a particular cognition should refer

The Doctrine of Sarupya in the Dihnaga-Dharmaklrti Tradition

to refer to the relation between a sensation and a conception,

In the Dinnaga-Dharmaklrti tradition it has been used in the second sense.

THE DOCTRINE OF SVA-PRAKASA (SELF-REVELATION)

The Doctrine of Dvairupya

The Buddhist Theory of Knowledge

(yisaydbhasa). In being visayabhasa it establishes its truth because of its being in

sva-prakdfa theory pronouncedly intends to do, there is no need to bring in C2,

The Buddhist Theory of Knowledge

pramanaphala for pragmatic purposes only. Granting this distinction, Dinnaga

Dinnagas Analysis of Pratibhdsa

Dharmaklrtis Analysis of Pratibhdsa

Is There Arthasarupya in Inferential Pratibhdsa?

The Buddhist Theory of Knowledge

for Buddhist thinkers s&m&nyalaksana is also real, although, of course, it is real

Justification for Accepting Sarupya

The Buddhist Theory of Knowledge

The Buddhist Theory of Perception

THREE WAYS OF DEFINING PRATYAKSA

VASUBANDHUS DEFINITION OF PRATYAKSA

The Buddhist Theory of Perception

specifically say that a perceptual cognition has no element of conceptualization

to distinguish it from anumana and so on (anyavyavrttyartham) and

Rejection of Nyaya-M imamsa Definition

Rejection of Vasubandhus Definition

Comparison of the Definitions of Vasubandhu and Dinga

The Buddhist Theory of Perception

PERCEPTION AS DISTINCT FROM ERRONEOUS COGNITION,

WHY THE NAME PRATYAKSA AND NOT PRATIVISAYA1