Anda di halaman 1dari 21

Definisi Hemostatis

Hemostasis merupakan suatu mekanisme local tubuh yang terjadi secara spontan
berfungsi untuk mencegah kehilangan darah yang berlebihan ketika terjadi trauma atau
luka.Sistem hemostasis pada dasarnya terbentuk dari tiga kompartemen hemostasis yang
sangat penting dan sangat berkaitan yaitu trombosit, protein darah danj aring-jaring fibrin
pembuluh darah (Rahajuningsih, 2007).
Secara umum menurut Hoffbrand (2005), hemostasis terdiri dari 3 macam yaitu:
1. Hemostasis primer yaitu akan terjadi jika terdapat deskuamasi dan
luka kecil pada pembuluh darah. Hemostasis primer ini melibatkan
tunika intima pembuluh darah dan trombosit. Luka akan
menginduksi terjadinya vasokonstriksi dan sumbat trombosit.
Hemostasis primer ini bersifat cepat dan tidak tahan lama. Karena
itu, jika hemostasis primer belum cukup untuk mengkompensasi
luka,

maka

akan

berlanjut

menuju

hemostasis

sekunder.

Pemeriksaan faal hemostasis untuk melihat proses ini adalah dengan


pemeriksaan bleedingtime.
2. Hemostasis sekunder, terjadi bila terdapat luka yang besar pada
pembuluh darah atau jaringan lain, vasokonstriksi dan sumbat
trombosit belum cukup untuk mengkompensasi luka ini. Hemostasis
sekunder yang melibatkan trombosit dan faktor koagulasi.
Hemostasis sekunder mencakup pembentukan jaring-jaring fibrin.
Hemostasis sekunder ini bersifat delayed and long-term response.
Jika proses ini sudah cukup untuk menutup luka, maka proses
berlanjut ke hemostasis tersier. Pemeriksaan faal hemostasis untuk
melihat proses ini adalah dengan pemeriksaan clottingtime.

3. Hemostasis Tersier. Hemostasis tersier ini bertujuan untuk


mengontrol

agar

aktivitas

koagulasi

tidak

berlebihan.

Hemostasis tersier melibatkan system fibrinolisis.


Mekanisme Hemostatis
Mekanisme terjadinya proses hemostasis terdiri dari beberapa tahapan, pertama
pembuluh darah akan mengalami vasokonstriksi (Guyton and Hall, 2006). Setelah
pembuluh darah mengalami suatu kerusakan atau pecah, rangsangan dari pembuluh
darah menyebabkan dinding pembuluh darah berkontraksi, sehingga dengan segera
aliran darah dari pembuluh yang pecah akan berkurang.
Kontraksi terjadi akibat dari reflex saraf, spasme miogenik, dan faktor humoral
setempat yang berasal dari jaringan yang terkena trauma dan respon trombosit darah.
Refleks saraf ini dicetuskan oleh rasa nyeri atau oleh impuls-impuls lain dari
pembuluh darah yang rusak atau dari jaringan yang berdekatan. Sebagian besar
vasokonstriksi hasil dari kontraksi miogenik berasal dari pembuluh darah. Untuk
pembuluh darah yang lebih kecil, trombosit akibat sebagian besar vasokonstriksi
dengan melepaskan substansi tromboksan A2 (Sherwood, 2001; Guyton and Hall
2006).
Tahapan kedua adalah aktivasi trombosit. Pada saat terjadi sebuah kerusakan
pembuluh darah, makat rombosit akan mulai membesar, berbentuk ireguler dengan
tonjolan-tonjolan yang keluar dari permukaannya, protein kontraktilnya berkontraksi
dengan kuat dan menyebabkan pelepasan granula yang mengandung berbagai faktor
aktif, sehingga trombosit lengket dan melekat pada serat kolagen, kemudian
mensekresi sejumlah besar ADP (AdenosinDiphospate) danenzim-enzim nyamem
bentuk tromboksan A2 yang juga disekresikan kedalamdarah. ADP dan tromboksan
A2 kemudian mengaktifkan trombosit yang berdekatan (Guyton and Hall, 2006).

Karena sifat trombosit yang lengket maka akan menyebabkan melekatnya trombosit
tambahan pada trombositsemula yang sudah aktif.
Dengan demikian, pada setiap luka, dinding pembuluh darah yang rusak atau
jaringan di luar pembuluh disekitar luka menimbulkan siklusakti vasitrombosit yang
jumlahnya teru smeningkat yang menyebabkannya menarik lebih banyak lagitrombosit
tambahan sehingga membentuksumbat (Hoffbrand, 2005; Guyton and Hall 2006)

Gambar
2.1:
tahapanhemostatik
a)
skemailustrasipembuluhdarahketikarusak,
b)
adhesitrombositdenganmatrikskolagenpada sub endothelial,c)
aktivasidanagregasitrombositmembentuksumbattrombosit,
d)
jaring-jaring fibrin (koagulasi) menstabilkanplatelet
plug
(Monroe and Hoffman,2006).
Fasekoagulasimerupakantahapanketigadalampembekuandar
ah.Suatuzatataukomplekszat-zatdisebutactivator
prothrombineyang
timbulsebagaireaksiterhadappecahnyapembuluhdarahkemudianme
ngkatalisaperubahanprothrombinemenjadithrombine.Thrombinebe

kerjasebagaienzimuntukmengubahfibrinogen

menjadibenang-

benangfibrin yang menjaringtrombosit, seldarah, dan plasma


sehinggaterjadilahbekuandarah (Guyton and Hall,2006)

Gambar 2.2: kaskadepembekuandarah (Hoffbrand, 2005)


Faseselanjutnyaadalahpembentukanjaringanikatkedalam
bekuandarahuntukmenutuplubangpadapembuluhdarahsecaraperman
en,
faseiniterjadisetelahbekuandarahterbentukdanmenandaiberakhirnya
proses hemostasistubuh.
LO 3 Diagnosa, DD dandefinisi ITP + epidemiologi
Diagnosa
Diagnosis

ditegakkanmelaluiriwayatpenyakitpenderita

penderitasertamelaluipemeriksaanfisik.

(ataukeluarga)

Beliau

juga

akanmenganalisahasilpemeriksaanlaboratoriumterhadapsampeldarahpenderita.
Gejalaterombositopeniabisatimbulsecaratiba-tiba (akut) ataumunculsecaraperlahan (kronik).
Gambaranklinis

yang

biasanyaditemuiberupaadanyatandaperdarahan

yang

tiba-

tibamunculpadaanak yang sehat. Misalnya, bintik-bintikperdarahan (sepertidigigitnyamuk),


lebamkebiruan,

perdarahangusidanmimisan,

darahdalamtinja,

sampai

yang

paling

beratadalahperdarahan di otak. Perdarahanintrakranialmerupakankomplikasi ITP paling


serius, hampirmengenai 1% pasiendengantrombositopeniaberat. Perdarahanbiasanya di

subarachnoid,
yang

luas.

seringmultipeldanukurannyabervariasidaripetekiesampaiekstravasasidarah
Hal

inimerupakanpenyebabkkematianpada

2,2%

padausialebihdari

40

tahundansampai 47,8% untukusialebihdari 60 tahun(Stevens, 2006).


Lamanyaperdarahandapatmembantuuntukmembedakan

PTI

akutdankronik,

sertatidakterdapatnyagejalasistemikdapatmembantudokteruntukmenyingkirkanbentuksekunde
rdan

diagnosis

lain.

Pentinguntuk

anamnesis

pemakaianobat-obatan

yang

dapatmenyebabkantrombositopeniadanpemeriksaanfisikhanyadidapatkanpendarahan Karena
trombosit yang rendah (peteki,purpura,pendarahankonjungtivadanpendarahanselaputlendir
yang lain). Purpura Thrombocytopenic Immunedewasaterjadiumumnyapadausia 18-40
tahundan 2-3 kali lebihseringmengenaiwanitadaripadapria(Setiati, 2015).
Padapemeriksaandarah, hanyaditemuitrombositopenia, yang jumlahnyabisamencapai
20.000/mm-kubikdanbahkanbisalebihrendah.
minggudanberangsur-angsur

naik,

Kenaikanjumlahtrombosit,

seiringhilangnyaantibodi

tentunya,

dandalamwaktumaksimal

Namunjumlahinibiasanyahanyabertahan

1-2

anti-trombosittersebut.

diiringidenganhilangnyatanda-tandaperdarahan,
bulan,

ITP

akutakansembuhsempurna.

Secaraumumhubunganantarajumlahtrombositdangejalaperdarahansalingberkorelasiantara lain
bilapasiendengan AT > 50.000 /uLmakabiasanyaasimptomatik, AT 30.000 50.000
/uLterdapatlukamemar/hematom, AT 10.000 30.000 /uLterdapatperdarahanspontan,
menoragiadanperdarahanmemanjangbilaadaluka, AT < 10.000 /uLterjadiperdarahanmukosa
(epistaksis,

perdarahan

gastrointestinal

dangenitourinaria)

danrisikoperdarahan

intracranial(Stevens, 2006).
Pengukurantrombositdihubungkandenganantibodi,
secaralangsungujiuntukmengukurtrombosit

yang

berkaitandenganantibodiyaknidenganMonoclonal-Antigen-Capture Assaysensitivitas 45-66%,


spesifisitasnya

78-92%

Ujinegatiftidakmenyingkirkan

dandiperkirakanbernilaipositif

diagnosis

deteksi

yang

80-83%.

tanpaikatanantibodi

plasma

tidakdigunakan. Ujiinitidakmembedakanbentuk primer maupunsekunder PTI(Setiati, 2015).


Splenomegaliringan
Trombositopeniabersifat

(hanyaruangtraube
isolated,

hitungdarah

yang

terisi),

yang

lain

danataunitropeniamenunjukkankearahpenyakit

tidakadalimfadenopati.

normal,

adanya

yang

Pemeriksaanmorfologidarahtepimenunjukkaneritrositdanleukosit

anemia
lain.
normal,

dandiperlukanuntukmenyingkirkanpseudotrombositopeniadankelainanhematologi yang lain.


Megatrombositseringterlihatpadapemeriksaandarahtepi.

Trombositmudaini

bias

dideteksiolehflow

sitometriberdasarkan

messenger

RNA

yang

menerangkanbahwapendarahanpada

PTI

tidaksejelasgambaranpadakegagalansumsumtulangpadahitungtrombosit yang serupa. Salah


satu

diagnosis

pentingadalahfungsisumsumtulang.

Padasumsumtulangdijumpaibanyakmegakariositdanagranuleratautidakmengandungtrombosit(
Setiati, 2015).
Secarapraktispemeriksaansumsumtulangdilakukanpadapasienlebihdari
pasiendengangambarantidakkhas

(misalnyadengangambaransitopenia)

tidakberesponbaikdenganterapi.

40

ataupasien

tahun,
yang

Meskipuntidakdianjurkan,

banyakahlipediatrihematologimerekomendasikandilakukanpemeriksaansumsumtulangsebelu
mmulaiterapikortikosteroiduntukmenyingkirkankasus leukemia akut(Setiati, 2015).
ITP

akutlebihseringterjadipadaanak-anak,

jarangpadaumurdewasa,

awitanpenyakitbiasanyamendadak,
riwayatinfeksiseringmengawaliterjadinyaperdarahanberulang,
seringdijumpaieksantemadaanak-anak (rubeoladan rubella) danpenyakitsalurannapas yang
disebabkanoleh virus merupakan 90% darikasustrombositopeniaimunologik. Virus yang
paling

banyakdiidentifikasiadalahvarisella

zoster

danEbsteinbarr.

ITP

akupadaanakbiasanyaself limiting (sembuhsendiri), remisispontanterjadipada 90% pasien,


60% sembuhdalam 4-6 minggudanlebihdari 90% sembuhdalam 3-6 bulan. Pada ITP dewasa,
bentukakutjarangterjadinamundapatmengalamiperdarahandanperjalananpenyakitlebihfulmina
n(Stevens, 2006).
Diagnosis Banding
Diagnosis banding PTI antara lain: anemia aplastik, leukemia akut, demamberdarahdan
trombositopenia.

Untukmenentukan

diagnosis

banding

PTI

tersebutperlumeninjaukembalipatofisiologiklasifikasitrombositopeniapadabuku Buku Ajar


IlmuPenyakitDalamEdisiKeenamJilid

II,

Beberapapemeriksaanlaboratoriumditambahkanantara

lain

pemeriksaanbiopsidan

Pemeriksaan

2015.
BMP.
BMP

sebelummenjalanipengobatandapatuntukmenyingkirkanpenyakithematologi lain seperti MDS


atau leukemia(Setiati, 2015).
Definisi
Purpura

TrombositopeniaImun

ditandaidengantrombositopenia

yang

(PTI)
menetap

adalahsuatuganguanautoimun

yang

(angkatrombositdarahperiferkurangdari

150.000/)

akibatautoantibodi

yang

mengikat

antigen

trombositmenyebabkandestruksiprematurtrombositdalamsistemretikuloendotelterutama

di

limpa(Setiati, 2015).
Epidemiologi
Insidensi PTI padaanakantara 4,0-5,3 per 100.00, PTI akutumumnyaterjadipadaanakanakusiaantara 2-6 tahun. 7-28% anak-anakdengan PTI akutberkembangmenjadikronik 1520%.

Purpura

TrombositopeniaImun

kronikpadabeberapakasusmenyerupai

(PTI)
PTI

padaanakberkembangmenjadibentuk
dewasa

yang

khas.

PTI

Insiden

PTI

kronispadaanakdiperkirakan0,46 per 100,000 anak per tahun(Setiati, 2015).


ITP padaanak yang terseringterjadiantaraumur 2-8 tahun, lebihseringpadawanita. ITP
merupakangangguanperdarahan
lebihseringpadawanita.

yang
ITP

seringdijumpaipadaanakusia

2-4

tahun,

dapatdibagimenjadiakutdankronik.

ITP

akutbiasanyasembuhsendiridalam 6 bulan,sedangkan ITP kronik, seringditemukanpadausia<


1 tahunatau> 10 tahun, umumnyadihubungkandengankelainanimun yang umum(Stevens,
2006).
Insiden ITP padaanakantara 4 5,3 per 100.000, ITP akutumumnyaterjadipadaanakanakusiaantara 2-6 tahun. 7-28% anak-anakdengan ITP akutberkembangmenjadikronik
5-20% apabilaterjadi paling lama 6 bulan. Sisanyaakansembuhsendiri.Insiden ITP
kronikdewasaadalah 58-66 kasusbaru per satujutapopulasipertahun di Amerika danserupa
yang ditemukan di Inggris. ITP kronikumumnyaterdapatpada orang dewasadenganusia
rata-rata 40-45 tahun. Rasioantaraperempuandanlaki-lakiadalah 1:1 padapasien ITP
akutsedangkanpada ITP kronikadalah 2-3:1. Satu hallagiistilah yang terdapatpada ITP
yakniistilah

ITP

refrakter

yang

gagalditerapidengankortikosteroiddosis

didefinisikansebagaisuatu
standard

an

ITP

splenektomi

yang
yang

selanjutnyamendapatterapikarenaangkatrombosit di bawah normal atauadaperdarahan.


Pasien

ITP

refrakterditemukankira-kira

Kelompokinimempunyairespon

yang

25-30%

darijumlahpasien

ITP.

jelekterhadappemberianterapidenganmorbiditas

yang cukupbermaknadanmortalitaskira-kira 16%.(Stevens, 2006).

LEARNING OBJECTIVE
Etiopatogenesis ITP
Disregulasi imun pada ITP
Mekanisme patogen ITP primer belum diidentifikasi. Sekitar 80% pasien dengan
ITP primer dan 20% bisa diidentifikasi sebagai ITP sekunder. Kategori pasien yang memiliki
ITP primer atau sekunder, meskipun berbeda di beberapa tahap, karena keberhasilan
identifikasi dari etiologi terbaru atau kondisi terkait dari hasil ITP di klasifikasi ulang pada
pasien ITP sekunder. Tanpa memperhatikan nomenclatur, masih ada satu set terbatas yang
memicu mekanisme umum untuk subset dari pasien yang ditunjuk sebagai ITP primer,
sedangkan pasien yang didiagnosis dengan ITP sekunder dapat berbagi mekanisme patogen
ketika proses penyakit yang mendasari ITP-terkait adalah sama.
Identifikasi faktor yang mempercepat ITP sangat berbeda karena sifat sementara
cenderung dari peristiwa yang memicu, kesulitan dalam mendiagnosis ITP awal dalam
perjalanannya, dan jangka waktu yang lama di mana monitoring perlu terjadi untuk
mengetahui timbulnya ITP. Bahkan diketahui berisiko tinggi untuk ITP karena riwayat
penyakit dahulu ITP, riwayat keluarga yang kuat dari ITP (jarang), atau komorbiditas dengan
kondisi predisposisi ITP sekunder. Karena itu, study mengenai disregulasi imun pada ITP
tentu terbatas pada karakteristik dari kelainan setelah proses autoimun berjalan dengan baik
dan toleransi untuk trombosit sudah rusak.
Meskipun keterbatasan ini, data dari berbagai studi dalam beberapa tahun terakhir
mulai datang bersama-sama untuk membentuk gambar dari respon imun yang tidak
seimbang. Disamping ini, bukti mendukung berbagai macam perubahan kekebalan tubuh
yang melibatkan semua komponen dari sistem kekebalan tubuh, termasuk pertahanan
trombosit memendek dan penghambatan produksi trombosit.

Antibodi Sel B dan Antiplatelet


Meskipun hal pemicu awal yang memprovokasi dari antiplatelet Abs masih
belum diketahui, autoantibodi trombosit sering hadir pada saat diagnosis. Makrofag dan
sel dendritik dari RES (seperti: sistem fagosit monosit) berfungsi untuk sirkulasi fagosit
antigen terikat Ab, termasuk trombosit terget Ab. Opsonisasi kompleks trombosit Ab oleh

APC ini memfasilitasi pengolahan intraseluler trombosit dan dapat menyebabkan


penyajian oleh sel T melalui MHC II sebagai array dari peptida trombosit asing. Penyajian
peptida trombosit oleh MHC II di konteks stimulasi aktivitas sel T, yang mengarah ke
peningkatan respon imun antitrombosit dan kemungkinan epitop menyebar ke antigen
trombosit tambahan.
Pada pasien dengan ITP, autoantibodi sering tampaknya untuk diarahkan
melawan GpIb/IX dan GPIIb/IIIa, meskipun spesififitas untuk antigen trombosit lain dapat
terjadi. Meskipun autoantibodi antitrombosit muncul untuk memainkan pathogenesis ITP,
beberapa pasien tidak terdeteksi Abs saat didiagnosis. Ini mungkin dijelaskan dengan
keterbatasan metode pengujian laboratorium dan biologi ITP: pembersihan cepat dari
beberapa jenis kompleks trombosit Ab dapat mengurangi deteksi sirkulasi titer
antitrombosit Ab ke batas ambang bawah; terikat erat Abs antitrombosit mungkin sulit
dipisahkan untuk studi; Abs dengan kekhususan antigen minor atau samar pada trombosit
atau antigen yang terutama berada pada megakaryocytes mungkin terlewatkan; dan
mungkin hanya menjadi bagian dari pasien yang Abs antitrombosit tidak hadir. Karena itu,
meskipun mayoritas pasien ITP ditunjukkan melalui fitur konsisten dengan mediasi
autoimunitas Ab sebagai fitur utama dari penyakit mereka, terdapat heterogenitas yang
cukup besar dalam jenis, titer, dan kemungkinan biologi, dari antiplatelet Abs di ITP.

FcR dan RES


Di ITP, trombosit terikat oleh Abs antitrombosit diarahkan untuk melawan
permukaan membran glikoprotein trombosit diperkirakan akan dibersihkan oleh hubungan
makrofag FcR di RES (seperti : di sel fagosit monosit). FcR adalah reseptor di sel
fagosit monosit, dimana mereka mengikat daerah Fc konstan Abs dan mediasi opsonisasi.
Sistem FcR adalah tersusun atas aktivasi (seperti : FcR1, FcRII, dan FcRIII) dan
inhibitor (seperti : FcRIIb) FcRs. Reseptor mengaktifkan FcRII dan FcRIIIa yang
keduanya secara tidak langsung mengimplikasi di fagositosis dari trombosit dilapisi Ab,
dimana beberapa data menunjukkan penurunan FcRIIb di ITP. Karena itu, ada bukti
bahwa keseimbangan dari FcRs ditunjukkan di sel fagosit monosit adalah bergeser di ITP
ke arah kecenderungan untuk hilangnya mediasi FcRs dari kompleks antigen Ab.

Sistem Complement / Pelengkap


Pada umumnya, Abs khusus terikat pada permukaan sel antigen tidak hanya
pembersihan mediasi dari sirkulasi FcRs, tetapi juga dapat berfungsi untuk memperbaiki
komplemen. Baru-baru ini, plasma dari pasien ITP ditunjukkan oleh 2 kelompok untuk
mampu memperbaiki komplemen trombosit in vitro. Selanjutnya, trombosit dari pasien
ITP juga menunjukkan komplemen terdeteksi, dan kemampuan untuk memperbaiki
komplemen berkorelasi dengan hadirnya deteksi Abs antitrombosit. Oleh karena itu, imun
komplemen mediasi, baik dengan pembersihan ditingkatkan atau kerusakan sel langsung,
merupakan mekanisme lain dimana autoantibodi trombosit dapat menyebabkan kerusakan
imun trombosit mediasi.

Fenotipe sel T pada ITP


Dari studi tentang sistem imun pada hewan, homeostasis imun diduga
dipertahankan melalui keseimbangan respon tipe 1 (terkait IFN, IL-2, TNF, dan TNF1)
dan tipe 2 (terkait IL-4, IL-5, IL-6, IL-10, dan IL-13). Meskipun perbedaan antara tipe 1
dan tipe 2 sel T dan profil sitokin pada manusia kurang jelas, kategori ini membantu dalam
menempatkan pola imunitas umum dalam konteks yang luas. Reaksi tipe 1 secara klasik
dianggap terlibat dalam menanggapi patogen intraseluler, dan respon tipe 1 adalah salah
satu yang umumnya meningkatkan pro-inflamasi, sel-mediasi, memperbaiki komplemen
fenotipe. Di sisi lain, imun tipe 2 diduga berfungsi dalam memerangi patogen
ekstraseluler, dan respon tipe 2 biasanya memunculkan respon tipe hipersensitif. Selama
inflamasi, dominasi profil karakteristik baik tipe 1 atau 2, karena jenis dominan baik
mengembang dan terlibat dalam umpan balik negatif loop untuk menekan T sel jenis lain.
Resolusi imun dari peristiwa inflamasi ditandai dengan penekanan fenotip jenis dominan
dan pemulihan keseimbangan tipe 1 / tipe 2. Oleh karena itu, perpindahan keseimbangan
tipe 1 dan tipe 2 memungkinkan menyesuaikan dari respon imun terhadap ancaman yang
dirasakan.
Pada ITP, rasio tipe 1 / tipe 2 tidak seimbang. Dalam ITP primer, pasien dewasa
dengan ITP primer kronis memiliki rasio tinggi Th1 / Th2 (pembantu sel CD4+) dan rasio
tinggi Tc1 / Tc2 (Sitotoksik sel CD8+). Selanjutnya, ketidakseimbangan rasio Th1 / Th2 ini
berbanding terbalik dengan tingkat keparahan penyakit, berarti semakin tinggi rasio Th1 /

Th2, makin rendah jumlah trombosit. Pasien ITP juga menunjukkan penurunan jumlah
CD4+CD25+ sel T regulator (Tregs), yang berfungsi untuk menurunkan respons regulasi
sel T. Tidak mengherankan, tingkat penurunan jumlah Tregs dikaitkan dengan penyakit
yang lebih parah di ITP. Selain jenis perubahan 1/2 spesifik, total rasio CD4:CD8 juga
diketahui dapat berkurang di ITP dan membaik dengan remisi penyakit.
Baru-baru ini, substrat lain dari sel T berbeda dari tipe 1 dan tipe 2 yang juga
telah di terlibat dalam penyakit autoimun, termasuk ITP. Mirip dengan tipe 1 dan tipe 2,
himpunan sel T ini didefinisikan oleh profil sekresi sitokin. Sel T, yang mengeluarkan IL17, yang pro-inflamasi dan di ITP menarik sebagian besar bukti yang melibatkan IL-17 di
autoimun. Dalam IL-17 yang mensekresi himpunan sel T, sel Th17 (CD4+) meningkat
pada ITP, seperti sel Tc17 (CD8+). Selain itu, peningkatan sel Tc17 berkorelasi dengan
skewing dari rasio CD4:CD8 di ITP. Tambahan diskrit himpunan sel T, Th22 (CD4+IFN
IL17IL22+), barubaru ini telah diidentifikasi dan ditemukan peningkatan regulasi
dalam beberapa penyakit autoimun. Sel Th22 juga meningkat secara signifikan pada
pasien ITP, dan peningkatan ini berkorelasi dengan peningkatan jumlah sel Th1 dan Th17.
Sitokin lain, IL21, diproduksi oleh beberapa CD4+ sel T dan pembunuh alami sel T dan
mampu meningkatkan regulasi kedua sel Th17 dan sel B. Pada ITP, ekspresi IL21 pada
sel T meningkat pada pasien ITP yang baru didiagnosis yang tidak diobati, meskipun
beredar IL21 tidak berubah.
Singkatnya, bukti mendukung respon sel T tipe 1 dengan respon peningkatan
regulasi Th17 dalam ITP. Menariknya, pola seperti disregulasi imun juga dapat dilihat
pada gangguan autoimun lainnya. Jenis respon, stereotip proinflamasi, mediasi sel,
komplemen perbaikan fenotipe, akan diharapkan untuk menyebarkan dan meningkatkan
proses kekebalan autoantibody mediasi platelet yang sedang berlangsung.

Platelet sebagai sel imun


Platelet berperan dalam imun aktif dan mungkin berkontribusi untuk respon imun
di ITP. Khususnya, CXCL5, CCL5, EGF sitotoksin dan CD40L telah ditemukan
penurunan secara signifikan antara pasien ITP dan anemia aplastic, tingkatan sitotoksin
yang sangat terkait dengan tingkat trombositopenia. Para peneliti dari studi yang

mendalilkan bahwa penurunan sitokin platelet-derived ini bersama-sama bekerja untuk


kedua ujung keseimbangan Th1 / Th2 dan mempengaruhi hematopoiesis.

Ekspresi jaringan dalam gen ITP


Teknologi molecular yang muncul terbaru telah diterapkan untuk menginvestigasi ITP.
Baru-baru ini, salah satu upaya untuk menunjukkan ekspresi gen whole blood
(Transcriptome dari darah ITP) pada pasien ITP pada dewasa dan anak anak. Usaha ini
untuk mengidentifikasi baik untuk ekspresi gen yang unik dan jaringan ekspresi gen yang
berubah di ITP, meskipun tidak secara tiba-tiba, ada heterogenitas antar pasien.
Menariknya, profil transkrip gen ITP spesifik yang berbeda, khususnya dari regulasi gen
IFN, muncul kemiripan seperti dilaporkan pada penyakit autoimun lainnya, dan tanda
tersebut telah dibatalkan dengan terapi, menunjukkan bahwa profil ini tercermin pada
proses penyakit yang aktif. Data ini menunjukkan bahwa penerapan teknologi system
wide "omics" (yaitu, RNA, DNA, dan protein) menawarkan potensi wawasan baru ke
dalam mekanisme dan prospek dari patogen untuk mengidentifikasi sasaran terapi baru di
ITP.
PATFIS
Dalam tubuh seseorang yang menderita ITP, sel-sel darahnya kecuali keping darah
(trombosit) berada dalam jumlah yang normal. Keping darah (Platelets) adalah sel-sel sangat
kecil yang menutupi area tubuh pasca luka atau akibat teriris/ terpotong dan kemudian
membentuk bekuan darah. Seseorang dengan keping darah yang terlalu sedikit dalam
tubuhnya akan sangat mudah mengalami luka memar dan bahkan mengalami perdarahan
dalam periode cukup lama setelah mengalami trauma luka. Kadang bintik-bintik kecil merah
(Petechiae) muncul pula pada permukaan kulitnya. Jika jumlah trombosit ini sangat rendah,
penderita ITP bisa juga mengalami epistaksis (mimisan) yang sukar berhenti, atau mengalami
perdarahan dalam organ pencernaannya. (Ibnu Purwanto, 2007)

Bintik-bintik merah pada kulit (terutama di daerah kaki), seringnya bergerombol


dan menyerupai ruam. Bintik tersebut, dikenal dengan petechiae, disebabkan karena
adanya perdarahan dibawah kulit. Efek lokal perdarahan berkaitan dengan adanya darah
yang keluar dari pembuluh di dalam jaringan dan pengaruhnya dapat berkisar dari yang
ringan hingga yang mematikan. Pengaruh lokal yang ringan adalah timbulnya bercak-bercak
hitam kebiruan. Hal ini berkaitan dengan adanya eritrosit yang keluar dan terkumpul dalam
jaringan. Eritrosit yang keluar dari pembuluh ini dipecahkan dengan cepat dan difagosit oleh
makrofag. Pada saat Hb dimetabolisme dalam sel-sel makrofag ini, terbentuk suatu kompleks
yang mengandung besi yang dinamakan hemosiderin, bersamaan pula dengan terbentuknya
zat yang tidak mengandung besi yang dalam jaringan dinamakan hematoidin (secara kimia
identik dengan bilirubin). Hemosiderin berwarna coklat-karat dan hematoidin berwarna
kuning muda. Interaksi pigmen-pigmen ini berpengaruh pada warna bercak-bercak hitam
kebiruan kemudian memudar menjadi coklat dan kuning, dan akhirnya menghilang karena
makrofag mengembara dan pemulihan jaringan yang sempurna.

(Sylvia A. Price dan

Lorraine M. Wilson, 2005)


Diatesis hemoragik yang merupakan akibat yang timbul karena kelainan faal hemostasis
yaitu kelainan patologik pada dinding pembuluh darah mengakibatkan:

Simple easy bruising (mudah memar)

Purpura senilis, karena atrofi jaringan penyangga pembuluh darah kulit terlihat terutama

pada aspek dorsal lengan bawah atau tangan.

Purpura steroid, karena terpai steroid yang mengakibatkan atrofi jaringan ikat

penyangga kapiler bawah kulit sehingga pembuluh darah mudah pecah.

Scurvy, yaitu terjadi pada defisiensi vitamin C, zat intersel yang tidak sempurna dapat

menyebabkan petechie perifolikular, memar, dan perdarahan mukosa. Ditemukan adanya


petechie, yaitu perdarahan yang halus terjadi di bawah kulit yang akan manifes dengan
gesekan yang lemah. Petechie timbul sebab jumlah trombosit yang ada tidak mencukupi
untuk membuat sumbat trombosit dan karena penurunan resistensi kapiler darah.
(Rahajuningsih Setiabudy, 2007)
Perdarahan dihidung (epistaksis) atau gigi merupakan tanda-tanda utama penyakit ITP
namun kebanyakan penyakit hanya ada tanda-tanda lebam dan petekia dianggota badan.
Gejala umum yang sering tampak pada pasien trombositopenia adalah petekiae, ekimosis,
gusi dan hidung berdarah, menometorrhagia, sedangkan gejala yang jarang terjadi adalah

hematuria, perdarahan gastrointestinal, perdarahan intrakranial. Epistaksis terjadi karena


jumlah trombosit yang ada tidak mencukupi untuk membuat sumbat trombosit dan karena
penurunan resistensi kapiler darah serta lokasi pembuluh darah dihidung sangat superfisial dan
sangat tipis, membuatnya rawan terjadi perdarahan. Perdarahan biasanya terjadi bila jumlah
trombosit < 50.000/ mm3, dan perdarahan spontan terjadi jika jumlah trombosit
<10.000/mm3 dan umumnya terjadi pada leukimia. Perdarahan kulit bisa merupakan pertanda
awal dari jumlah trombosit yang kurang. Bintik-bintik keunguan seringkali muncul ditungkai
bawah dan cedera ringan bisa menyebabkan memar yang menyebar. Bisa terjadi perdarahan
gusi dan darah juga bisa ditemukan pada tinja atau air kemih. Pada penderita wanita, darah
menstruasinya sangat banyak. Perdarahan mungkin sukar berhenti sehingga pembedahan
dan kecelakaan bisa berakibat fatal. Jika jumlah trombosit semakin menurun, maka
perdarahan akan semakin memburuk. Jumlah trombosit kurang dari 5.000-10.000/mL bisa
menyebabkan hilangnya sejumlah besar darah melalui

saluran pencernaan atau terjadi

perdarahan otak (meskipun otaknya sendiri tidak mengalami cedera) yang bisa berakibat
fatal. (Arief mansoer, dkk.2001).
Tombositopenia bisa disebabkan karena penurunan produksi platelet dibawah normal
atau karena peningkatan destruksi dari platelet. (V. Roy, Sekhon SS, 2006).
GambaranklinisPTI

PTI Akut
PTI AkutlebihSeringdijumpaipadaanak, jarangpadaUmurdewasa, onset
penyakitbiasanyamendadak,
riwayatInfeksimengawaliterjadinyaperdarahanberulang,
seringdijumpaieksantempadaanak-anak
danpenyakitsalurannapasyang

(rubeoladan

disebabkanoleh

darikasuspediatriktrombositopeniaimunologik.

virus

rubella)

merupakan
Virus

90%
yang

palingbanyakdiidentifikasiadalahvarisellazoosterdanebsteinbarr.Manifestasiper
darahan

PTI

perdarahanintrakranialterjadikurangdari

akutpadaanakbiasanyaringan,
1%

pasien.Pada

PTI

dewasa,

bentukakutjarangterjadi,
namundapatmengalamiperdarahandanperjalananpenyakitlebihfulminan.

PTI

akutpadaanakbiasanyaself limiting, remisispontanterjadipada 90% penderita,

60% sembuhdalam 4-6 minggudanlebihdari 90% sembuhdalam 3-6 bulan.


(Purwanto, 2014)

PTI Kronik
PTI

kronikbiasanyaterdapatpadaumurdewasa,

kronikbiasanyatidakmenentu,

onset

PTI

banyakterjadipadawanita

di

umurpertengahanriwayatperdarahanseringdariringansampaisedang,
infeksidanpembesaran lien jarangterjadi, danmemilikiperjalananklinisyang
fluktuatif.

Episode

perdarahandapatberlangsungbeberapaharisampaibeberapaminggu,
mungkinintermittenataubahkanterusmenerus.Remisispontanjarangterjadidanta
mpaknyaremisitidaklengkap.
Manifestasiperdarahan

PTI

berupaekimosis,

peteki,

purpura.Padaumumnyaberatdanfrekwensiperdarahanberkorelasidenganjumlahtr
ombosit.Secaraumumhubunganantarajumlahtrombositdangejalaantara

lain

bilapasiendengan AT >50.000 / L makabiasanyaasimptomatik, AT 30.000 50.000 / L terdapatlukamemar/hematom, AT 10.000 - 30.000 / L


terdapatperdarahanspontan, menoragidanperdarahanmemanjangbilaadaluka, AT
<10.000 / L terjadiperdarahanmukosa (epistaksis, perdarahangastrointestinal
dangenitourinaria) danrisikoperdarahansistemsarafpusat.(Purwanto, 2014)
Perdarahangusidanepistaksisseringterjadi,
inidapatberasaldarilesipetekipadamukosanasal,
jugadapatditemukanpadatenggorokandanmulut.Traktusgenitourinariamerupaka
ntempatperdarahanyang
satunyadari

PTI

palingsering,

menoragidapatmerupakangejalasatu-

danmungkintampakpertamakali

jugamerupakangejalayang

padapubertas.Hematuria

sering.Perdarahan

gastrointestinal

bisanyabermanifestasi melena danlebihjaranglagidenganhematemesis.


Perdarahanintrakranialmerupakankomplikasi yang paling seriuspada
PTI.Hal

inimengenaihampir

penderitadengantrombositopeniaberat.Perdarahanbiasanya

1%
di

subarachnoid,

seringmultipeldanukuranbervariasidaripetekisampaiekstravasasidarah
luas. (Purwanto, 2014)

yang

Komplikasi ITP
Akibat dari ITP yang paling sering terjadi adalah pendarahan, apabila pendarahan terjadi di
otak atau pendarahan intracranial, efeknya bisa mematikan. Sedangkan komplikasi dari ITP
kronis akan muncul sebagai akibat dari pengobatan yang dilakukan. Kortikosteroid yang
cukup efektif mengobati ITP berpotensi menyebabkan efek samping yang berbahaya jika
dikonsumsi dalam jangka panjang misalnya, osteoporosis, katarak, kadar gula tinggi yang
bisa menyebabkan diabetes tipe 2.
Sedangkan prosedur splenektomi yang membantu mencegah hilangnya trombosit akan
membuat pasien lebih rentan terkena infeksi. Limpa bertanggung jawab melawan infeksi, jadi
apabila limpa diangkat, pasien akan kehilangan salah satu fungsi alami tubuh dalam melawan
infeksi.
Penderita ITP yang sedang hamil umumnya bisa menjalani proses kehamilan dan persalinan
yang normal. Namun jika jumlah trombosit yang sangat rendah pendarahan berlebih pada
saat melahirkan lebih berisiko untuk terjadi. Selain itu, wanita penderita ITP juga berpotensi
bahwa bayinya memiliki jumlah trombosit yang rendah pula. Jika ini terjadi, dokter bayi
tersebut akan mengawasi bayi selama beberapa hari. Jumlah trombosit bayi akan mengalami
penurunan sebelum akhirnya naik kembali. Tetapi jika jumlah trombosit bayi sangat rendah,
penanganan akan dilakukan untuk mempercepat pengembalian jumlah trombosit pada bayi
(Spring, 2010).

Prognosis
Respon terapi dapat mencapai 50-70% dengan kortikosteroid. Pasien ITP dewasa hanya
sebagian kecil dapat mengalami remisi spontan, penyebab kematian ITP biasanya
disebabkan oleh perdarahan intra kranial yang berakibat fatal berkisar 2,2% untuk usia
lebih dari 40 tahun dan sampai 47,8% untuk usia lebih dari 60 tahun (Purwanto, 2014).
LO Terapi / Penatalaksanaan ITP
Sebagian besar kasus ITP pada anak tidak perlu dirawat di rumah sakit, oleh karena
dapat sembuh sempurna secara spontan dalam waktu kurang dari 6 bulan. Beberapa faktor
memainkan peran dalam penatalaksanaan ITP diantaranya pendarahan yang banyak,

predisposisi komorbiditas perdarahan, komplikasi dari pengobatan khusus, aktivitas dan gaya
hidup, dan toleransi terhadap efek yang merugikan (Provan, 2010). Pengobatan jarang
ditujukan pada pasien dengan jumlah trombosit di atas 50.000/mm3, tanpa pendarahan yang
berkaitan dengan disfungsi platelet atau cacat hemostatik lainnya, seperti trauma, dan operasi
(Provan, 2010., Yang, 2000). Penatalaksanaan ITP tergantung pada jumlah trombosit dan
tingkat peradarahan. Pengobatan ditujukan untuk mengganggu antibodi yang mampu
melakukan penghancuran platelet, dengan menghambat fungsi reseptor makrofag dan
penurunan produksi antibodi antiplatelet (Cheng, 2003). Lini pertama pengobatan meliputi
observasi, kortikosteroid, IVIg, atau anti-D (ASH, 2011). Penatalaksanaan ITP dapat dibagi
menjadi terapi farmakologi dan terapi bedah. Terapi farmakologi dibagi lagi menjadi lini
pertama dan lini kedua (Neunert, 2011).
1. Terapi Farmakologi
A. Lini Pertama
Terapi kortikosteroid pada pasien ITP bertujuan untuk meningkatkan jumlah
trombosit melalui beberapa mekanisme, yaitu dengan mengurangi penghancuran platelet
yang dilakukan oleh makrofag, mengurangi produksi autoantibody, menghambat pengikatan
platelet-autoantibodi, dan meningkatkan trombopeietin untuk menstimulasi pembentukan
megakaryosit. Pengobatan dengan kortikosteroid, seperti prednisone dengan dosis 1-2
mg/kg/hari dapat meningkatkan hitung jumlah platelet sekitar 75%. Prednisone sebagai
standar terapi lini pertama untuk pasien ITP biasanya diberikan dengan dosis 0,5-2
mg/kg/hari, sampai jumlah hitung platelet meningkat menjadi >30.000-50.000/mm3, yang
membutuhkan waktu beberapa hari samapai beberapa minggu. Untuk mencegah komplikasi
dari penggunaan kortikosteroid, prednisone mungkin diberikan dengan melakukan tapering
off dan sesudah itu berhenti, jika tidak ada respon setelah 4 minggu terapi (Provan, 2010).
Terapi parenteral dengan dosis tinggi methylprednison ditujukan untuk mengobati pasien
yang gagal merespon pengobatan lini pertama (Provan, 2010). Ada beberapa penelitian
tentang terapi kortikosteroid di pasien dewasa dengan ITP. Penelitian-penelitian tersebut
menemukan bahwa 51,9% - 80% pasien mempunyai respon yang baik terhadap
dexamethasone, dengan jumlah hitung platelet meningkat setelah terapi (George, 2002).
Imunoglobulin Anti-D adalah salah satu taerapi untuk ITP, setelah Food and Drug
Administration (FDA) melisensi penggunaan intravena dari Rh (D) immunoglobulin (anti-D
imunoglobulin) pada Maret, 1995. Anti-D immunoglobulin hanya efektif untuk pasien nonsplenentomized Rh (D) positif, dimana antibodi terikat pada D antigen dalam sel darah

merah. Anti-D immunoglobulin bertindak dalam pemberi izin anti-D coated red blood cells
melalui reseptor makrofag Fc di sistem retikuloendotelial, yang akhirnya dapat menghasilkan
peningkatan jumlah hitung platlet (Gaines, 2005., Vesely, 2004).
Dosis standar untuk anti-D immunoglobulin intravena adalah 50mg/kg/hari dan
membutuhkan waktu 72 jam untuk memproduksi peningkatan jumlah platelet yang
signifikan. Terapi

dengan

anti-D

immunoglobulin

merupakan

terapi

yang

tidak

direkomendasikan sebagai terapi lini pertama untuk menigkatkan jumlah platelet dalam
pasien dengan trombositopenia berat (Stasi, 2004).
B. Lini Kedua
Dalam pengobatan lini kedua, cyclosporine A dapat diberikan dengan dosis 2,5-3
mg/kg/hari. Obat ini efektif sebagai agen tunggal pada pasien ITP, tetapi efek sampingnya
dapat membuat beberapa pasien tidak nayaman, terutama pasien usia lanjut (Provan, 2010).
Imunosupresi dengan cyclophosphamide per oral atau intravena bermanfaat untuk
pasien yang sulit di terapi dengan kortikosteroid dan/atau splenektomi (Provan, 2010).
Mycophenolate mofetil (MMF) adalah immunosupresan antiproliferatif yang bermanfaat
dalam pasien tertentu dengan ITP. Terapi ini diberikan dengan dosis meningkat (250 mg
sampai dengan dosis optimal 1000 mg/2 kali sehari), dan meningkatkan produksi trombosit
dalam 39% pasien dengan ITP refrakter (Provan, 2010).
2. Terapi Bedah
Splenektomi bukanlah pilihan yang direkomendasikan untuk terapi ITP pada anakanak, seperti yang terdapat dalam berbagai Guidelines (Neunert, 2011) yang lebih memilih
perawatan medis dibanding terapi bedah. Tujuan terapi bedah, seperti splenektomi pada
pasien ITP adalah untuk mencapai pengingkatan jumlah trombosit. Splenektomi
diindikasikan pada pasien yang gagal merespon terapi kortikosteroid atau yang terus-menerus
membutuhkna terapi trombosit. Splenektomi mengurangi interaksi antara sel B dan sel T
yang terlibat dalam sintesis antibodi. Indikasi dari splenektomi setelah terapi kortikosteroid
adalah sebagai berikut: a). jumlah trombosit <50.000/mm3 setelah 4 minggu terapi; b). jumlah
hitung platelet tetap di bawah normal setelah 6-8 minggu; dan c). jumlah trombosit normal,
tetapi menurun seiring dengan penuruan dosis kortikosteroid (Purwanto, 2006).
Sekitar 80% pasien dengan ITP merespon splenektomi, dengan respon yang terusmenerus selama 5 tahun ditemukan dalam 66% pasien yang tanpa membutuhkan terapi
tambahan. Sekitar 14% pasien tidak responsif pada terapi dan sekitar 20% pasien kambuh
dalam beberapa minggu, bulan atau tahun kemudian. Splenektomi juga menimbulkan

komplikasi, seperti perdarahan, infeksi, dan thrombosis. Karena ITP dan splenektomi
keduanya terkait dengan resiko tromboemboli, pasien dengan ITP harus menerima
thromboprophylaxis tepat setelah operasi, dan tambahan antibiotik profilaksis jangka
panjang, seperti phenoxymethypenicillin 250-500 mg atau eritromisin 500 mg dua kali sehari
(Provan, 2010., ASH, 2011).

Keadaan darurat

Dalam kasus-kasus darurat, seperti pasien yang membutuhkan operasi segera, atau pasien
dengan perdarahan gastrointestinal atau traktus urinarius, dimana peningkatan jumlah
trombosit sangat penting, terapi kombinasi lini peryama dapat diberikan, seperti
prednisone dan IVIg. Dosis tinggi methylprednisone juga bermanfaat untuk keadaan
darurat, dan transfuse trombosit dengan atau tanpa IVIg akan meningkatkan jumlah
trombosit sampai lebih dari 20.000/L dalam 42% pasien ITP dengan perdarahan dan
mungkin dapat melemahkan perdarahan. Pemberian antifibrinolitik, seperti tranexamic
dan epsilon aminocaproic acid oral atau iv, dapat bermanfaat untuk mencegah perdarahan
berulang pada pasien dengan trombositopenia berat, meskipun efektivitas obat-obat
tersebut belum dievaluasi pada pasien ITP (Provan, 2010).

DAFTAR PUSTAKA
Guyton, A.C and Hall J.E. 2006. Textbook of Medical Physiology

th
11 Ed.

Philadelphia: Elsevier Inc. pp:457-468


Hoffbrand, A.V. AlihbahasaSetiawan. 2005. KapitaSelektaHematologiEdisi

4.Jakarta:

EGC. hal:178
Monroe, M.D and Hoffman, M. 2006. What Does It Take to Make the Perfect Clot?
Arterioscler Thromb Vasc Biol. American Heart Association Journal. Vol. 26. No.
81, pp. 41-48.
Rahajuningsih. 2007. Hemostasis dan Trombosis. Edisi 3. FKUI. Jakarta.hal:21
Sherwood, L. 2001. FisiologiManusiadariSelkeSistemEdisi 2.Terjemahan BU Pendit.

Jakarta. EGC. Hal.231