Anda di halaman 1dari 28

LAPORAN PEMBUATAN SILASE

BAB 1
PENDAHULUAN

1.1.Latar Belakang
Faktor utama penentu keberhasilan dalam usaha peternakan adalah penyediaan
pakan. Salah satu penyediaan pakan bagi ternak ruminansia adalah dengan pemanfaatan
pakan asal sisa hasil pertanian, perkebunan maupun agroindustri. Salah satu sisa tanaman
pangan dan perkebunan yang mempunyai potensi cukup besar adalah jagung. Apabila limbah
yang banyak tersebut tidak dimanfaatkan, maka akan memicu terjadinya pencemaran
lingkungan. Pencemaran lingkungan merupakan masalah kita bersama, yang semakin penting
untuk diselesaikan, karena menyangkut keselamatan, kesehatan, dan kehidupan kita.
Siapapun bisa berperan serta dalam menyelesaikan masalah pencemaran lingkungan ini,
termasuk kita. Dimulai dari lingkungan yang terkecil, diri kita sendiri, sampai ke lingkungan
yang lebih luas. Untuk itu, agar pencemaran limbah dapat diminimalisir perlu adanya
pemanfaatan limbah agar mempunyai daya guna.
Tanaman jagung merupakan salah satu tanaman serelia yang tumbuh hampir di
seluruh dunia dan tergolong spesies dengan variabilitas genetic tebesar. Di Indonesia jagung
merupakan bahan makanan pokok kedua setelah padi. Banyak daerah di Indonesia yang
berbudaya mengkonsumsi jagung, antara lain Madura, Yogyakarta, Sulawesi Selatan, Maluku
Utara, Nusa Tenggara Timur, dll.
Seiring dengan kebutuhan jagung yang cukup tinggi, maka akan bertambah pula
limbah yang dihasilkan dari industri pangan dan pakan berbahan baku jagung. Salah satu
contoh sampah organik adalah kulit jagung yang merupakan limbah sector pertanian. Limbah
kulit jagung yang sudah tak terpakai ini bisa dimanfaatkan sebagai kerajinan tangan.
Sehingga limbah kulit jagung ini tidak menjadi sampah yang mencemari lingkungan.
Kerajinan tangan dari kulit jagung bisa bernilai ekonomis. Namun pada dasarnya limbah
jagung berupa kulit jagung atau klobot jagung sampai saat ini pemanfaatannya kurang
maksimal, padahal jumlahnya sangat melimpah ruah. Jika dibakar menimbulkan pencemaran
udara, jika dibuang ke sungai menyebabkan banjir, tumpukannya bisa menyebabkan sarang
penyakit.
Limbah yang dihasilkan diantaranya adalah jerami, klobot, dan tongkol jagung yang
biasanya tidak dipergunakan lagi ataupun nilai ekonominya sangat rendah dan jumlahnya
sangat banyak sehingga ternak tidak dapat menghabiskannya dalam satu waktu tertentu
sehingga takutnya nanti terbuang percuma- Cuma atau pakannya rusak,Oleh karena itu pada
mata kulia tekhnik pengelolah limbah pertanian ini diadakan praktikum tentang pembuatan
silase terutama pembuatan silase pada jerami jagung,agar jerami jagung yang banyak dan
tidak dapat dihabiskan langsung oleh ternak, dapat disimpan sebagai cadangan makanan pada
saat pakan mulai mengurang terutama pada musim kemarau dengan kandungan nutrisi dan
palatabilitas yang tinggi pula.
1.2.Tujuan dan Kegunaan praktikum
1.2.1.Tujuan Praktikum
Adapun tujuan dalam melakukan praktikum ini adalah sebagai berikut:
1.Untuk mengetahui bagaimana prinsip pembuata silase jerami jagung dengan baik dan sesuai
dengan prosedur kerja.
2.Untuk mengurangi atau meminimalisir limbah jaggung yang terbuang percuma-cuma

1.2.2.Kegunaan Praktikum
Adapun kegunaan dalam melakukan praktikum ini adalah sebagai berikut:
1.Agar mahasiswa atau praktikan mengetahui langsung cara pembuatan silase tampa belajar
teoritisnya saja.
2.Agar mahasiswa atau praktikan dapat memenuhi persaratan 3 sks dari mata kulia tekhnik
pengelolah limbah dan industri pertanian
3.Agar sumber pakan ternak dapat tersedia pada saat pakan mulai berkurang

BAB II
TINJAUAN PUSTAKA
2.1.Pengertian Silase
Silaseadalahpakanyangberbahanbakuhijauan,hasilsampingpertanianataubijian
berkadarairtertentuyangtelahdiawetkandengancaradisimpandalamtempatkedapudara
selamakuranglebihtigaminggu.Penyimpananpadakondisikedapudaratersebut
menyebabkanterjadinyafermentasipadabahansilase.Tempatpenyimpanannyadisebutsilo.
Silobisaberbentukhorizontalataupunvertikal.Siloyangdigunakanpadapeternakanskala
besaradalahsiloyangpermanen,bisaberbahanlogamberbentuksilinderataupunlubang
dalamtanah(kolambeton).Silojugabisadibuatdaridrumataubahkandariplastik.
Prinsipnya,silomemungkinkanuntukmemberikankondisianaerobpadabahanagarterjadi
prosesfermentasi.Bahanuntukpembuatansilasebisaberupahijauanataubagianbagianlain
daritumbuhanyangdisukaiternakruminansia,sepertirumput,legume,bijibijian,tongkol
jagung,pucuktebu,batangnanasdanlainlain.Kadarairbahanyangoptimaluntukdibuat
silaseadalah6575%.Kadarairtinggimenyebabkanpembusukandankadarairterlalu
rendahseringmenyebabkanterbentuknyajamur.Kadarairyangrendahjugameningkatkan
suhusilodanmeningkatkanresikokebakaran(Heinritz,2011).
Teknologi silase adalah suatu proses fermentasi mikroba merubah pakan menjadi
meningkat kandungan nutrisinya (protein dan energi) dan disukai ternak karena rasanya
relatif manis. Silase merupakan proses mempertahankan kesegaran bahan pakan dengan
kandungan bahan kering 30 35% dan proses ensilase ini biasanya dalam silo atau dalam
lobang tanah, atau wadah lain yang prinsifnya harus pada kondisi anaerob (hampa udara),
agar mikroba anaerob dapat melakukan reaksi fermentasi. Keberhasilan pembuatan silase
berarti memaksimalkan kandungan nutrien yang dapat diawetkan. Selain bahan kering,
kandunganm gula bahan juga merupakan faktor penting bagi perkembangan bakteri
pembentuk asam laktat selama proses fermentasi (Khan et al., 2004).
Silase adalah makanan ternak yang dihasilkan melalui proses fermentasi hijauan
dengan kandungan uap air yang tinggi. Pembuatan silase tidak tergantung kepada musim jika
dibandingkan dengan pembuatan hay yang tergantung pada musim (Sapienza dan Bolsen,
1993).
2.2.MetodedanPrinsipDasarPembuatanSilase
1. Metode Pemotongan
-

Hijauan dicincang dahulu dengan ukuran 3-5 cm.

Dimasukkan kedalam lubang galian (silo) beralas plastik

Tumpukan hijauan dipadatkan (diinjak-injak)

Tutup dengan plastik dan tanah

2. Metode Pencampuran
Hijauan dicampur bahan lain dahulu sebelum dipadatkan (bertujuan untuk
mempercepat fermentasi, mencegah tumbuh jamur dan bakteri pembusuk, meningkatkan
tekanan osmosis sel-sel hijauan. Bahan campuran dapat berupa: asam-asam organik (asam
formiat, asam sulfat, asam klorida, asam propionat), molases/tetes, garam, dedak padi,
menir /onggok.
3. Metode Pelayuan
-

Hijauan dilayukan dahulu selama 2 hari (kandungan bahan kering 40% 50%)

Lakukan seperti metode pemotongan

Proses pembuatan silase secara garis besar terdiri atas empat fase : (1) fase aerob; (2)
fase fermentasi; (3) fase stabil dan (4) fase pengeluaran untuk diberikan kepada ternak. Setiap
fase mempunyai ciri-ciri khas yang sebaiknya diketahui agar kualitas hijauan sejak dipanen,
pengisian ke dalam silo, penyimpanan dan periode pemberian pada ternak dapat dipelihara
dengan baik agar tidak terjadi penurunan kualitas hijauan tersebut (Sapienza dan Bolsen,
1993).
Prosespembuatansilase(ensilage)akanberjalanoptimalapabilapadasaatproses
ensilasediberipenambahanakselerator.Akseleratordapatberupainokulumbakteriasam
laktatataupunkarbohidratmudahlarut.Fungsidaripenambahanakseleratoradalahuntuk
menambahkanbahankeringuntukmengurangikadarairsilase,membuatsuasanaasampada
silase,mempercepatprosesensilase,menghambatpertumbuhanbakteripembusukdanjamur,
merangsangproduksiasamlaktatdanuntukmeningkatkankandungannutriendarisilase
(Schroeder,2004).
Selamaprosesfermentasiasamlaktatyangdihasilkanakanberperansebagaizat
pengawetsehinggadapatmenghindarkanpertumbuhanmikroorganismepembusuk.Bakteri
asamlaktatdapatdiharapkansecaraotomatistumbuhdanberkembangpadasaatdilakukan
fermentasisecaraalami,tetapiuntukmenghindarikegagalanfermentasidianjurkanuntuk
melakukanpenambahaninokulumbakteriasamlaktat(BAL)yanghomofermentatif,agar
terjaminberlangsungnyafermentasiasamlaktat.InokulumBALmerupakanadditivepaling
populerdibandingkanasam,enzimataulainnya.PerananlaindariinokulumBALdiduga
adalahsebagaiprobiotik,karenainokulumBALmasihdapatbertahanhidupdidalamrumen
ternakdansilasepakanternakdapatmeningkatkanproduksisusudanpertambahanberat
badanpadasapi(Weinbergetal.,2004).
2.3.KriteriaSilaseYangBaik
Berdasarkan informasi dari (Kartadisastra, 2004) bahwa tempaeratur yang baik untuk
silase berkisar 270C hingga 350C. pada temperature tersebut, kualitas silase yang dihasilkan
sangat baik. Kualitas tersebut dapat diketahui secara organoleptik, yaitu:
Mempunyai tekstur segar
Berwarna kehijau-hijauan

Tidak berbau busuk


Disukai ternak
Tidak berjamur
Tidak menggumpal
Silaseyangbaikbiasanyaberasaldaripemotonganhijauantepatwaktu(menjelang
berbunga),pemasukankedalamsilodilakukandengancepat,pemotonganhijauandengan
ukuranyangmemungkinkannyauntukdimampatkan,penutupansilosecararapat
(tercapainyakondisianaerobsecepatnya)dantidakseringdibuka.Silaseyangbaik
beraromadanberasaasam,tidakberbaubusuk.Silasehijauanyangbaikberwarnahijau
kekuningkuningan,dipegangterasalembutdanempuktetapitidakbasah(berlendir).Silase
yangbaikjugatidakmenggumpaldantidakberjamur.Kadarkeasamanya(pH)apabila
dilakukananalisalebihlanjutadalah3,24,5.Silaseyangberjamur,warnakehitaman,berair
danaromatidaksedapadalahsilaseyangmempunyaikualitasrendah(Rukmana,2005).
Silasebisadigunakansebagaisalahsatuatausatusatunyapakankasardalamransum
sapipotong.Pemberianpadasapiperahsebaiknyadibatasitidaklebih2/3darijumlahpakan
kasar.Silasejugamerupakanpakanyangbagusbagidombatetapitidakbagusuntukkuda
maupunbabi.Silasemerupakanpakanyangdisukaiternakterutamabilacuacapanas.Ternak
yangbelumterbiasamengkonsumsisilase,makapemberiannyadapatdilakukansecara
sedikitdemisedikitdicampurdenganhijauanyangbiasadimakan(Hanafi,2008).
Keberhasilan pembuatan silase berarti memaksimalkan nutrien yang dapat
diawetkan. Silase yang baik diperoleh dengan menekan berbagai aktivitas enzim yang berada
dalam tanaman dan yang tidak dikehendaki serta mendorong berkembangnya bakteri asam
laktat (Sapienza dan Bolsen, 1993).
Mikroba yang tidak diinginkan bersaing menggunakan karbohidrat yang terlarut
dengan bakteri penghasil asam laktat sehingga hasil akhir metabolismenya tidak
menghasilkan bahan-bahan yang bersifat mengawetkan. Silase yang baik mempunyai cirriciri yaitu rasa dan bau asam, warna masih hijau, tekstur hijauan masih jelas, tidak berjamur
atau berlendir, banyak asam laktat, kadar ammonia rendah (kurang dari 10%), tidak
mengandung asam butirat dan pH rendah dengan kisaran 3,5-4 (Aksi Agraris Kanisius, 1983).
2.4.Bakteri Asam Laktat(BAL) Dan Asam Format
Bakteri asam laktat (BAL) sangat dibutuhkan untuk menghasilkan silase yang
berkualitas baik. Bila bakteri ini terlibat dalam proses ensilase, maka akan terjadi fermentasi
asam laktat. Jenis bakteri asam laktat yang bekerja dalam fermentasi termasuk genus
Lactobacillus, Streptococcus, Leuconostoc, Pediococcus. Genus-genus ini dikelompokkan
menjadi dua golongan berdasarkan produk akhir fermentasinya yaitu bakteri homofermentatif
dan heterofermentatif (Ross, 1984).
Bakteri asam laktat (BAL) ini selalu ditemukan pada hijauan bagian luar tetapi
peranannya belum dapat diketahui dengan jelas. Diduga keberadaan BAL ini dalam tanaman
untuk melindungi tanaman dari serangan pathogenik mikroorganisme dengan memproduksi
antagonistik komponen seperti beberapa asam, bakteriosin dan agen anti-fungal. Hal ini
mungkin ada benarnya setelah ditemukan BAL dalam jumlah yang banyak pada bagian
tanaman yang rusak (Bolsen, 1985).
Keberhasilan pembuatan silase tergantung dari besarnya populasi bakteri asam
laktat, sifat fisik antara lain karbohidrat, temperatur, pH dan juga perbandingan antara sumber
karbohidrat dan protein. Kadar air bahan untuk pembuatan silase sebaiknya berkisar dari 65 75% (Bolsen, 1985). Bila kadar air lebih rendah dari 65%, keadaan anaerob sukar dicapai
sehingga jamur akan tumbuh. Namun bila kadar air lebih dari 75%, Clostridia dapat

berkembang biak sehingga banyak dihasilkan asam butirat dan senyawa-senyawa nitrogen
yang terlarut yang akan menurunkan kandungan nutrisi yang dihasilkan. Untuk mencapai
kadar air yang dianjurkan perlu dilakukan pelayuan dahulu sebelum bahan dibuat silase.
Asam format adalah jenis asam karboksilat yang paling sederhana. Asam format
secara alami terdapat antara lain pada sengat lebah dan semut. Asam format juga merupakan
senyawa intermediet atau senyawa antara yang penting dalam banyak sintesis kimia. Rumus
kimia asam format dapat dituliskan sebagai HCOOH atau CH2O2. Asam format ditemukan
secara alami pada sengatan dan gigitan banyak serangga dari ordo Hymenoptera, misalnya
lebah dan semut. Asam format juga merupakan hasil pembakaran yang signifikan dari bahan
bakar alternatif, yaitu pembakaran metanol (dan etanol yang tercampur air), jika dicampurkan
dengan bensin. Nama asam format berasal dari kata Latin formica yang berarti semut. Pada
awalnya, senyawa ini diisolasi melalui distilasi semut. Senyawa kimia turunan asam format,
misalnya kelompok garam dan ester, dinamakan format atau metanoat. Ion format memiliki
rumus kimia HCOO.
2.5.Jerami Jagung
Jerami jagung/brangkasan adalah bagian batang dan daun jagung yang telah
dibiarkan mengering di ladang dan dipanen ketika tongkol jagung dipetik. Jerami jagung
seperti ini banyak diperoleh di daerah sentra tanaman jagung yang ditujukan untuk
menghasilkan jagung bibit atau jagung untuk keperluan industri pakan; bukan untuk
dikonsumsi sebagai sayur (Mariyono et al., 2004).
Kulit buah jagung/klobot jagung adalah kulit luar buah jagung yang biasanya
dibuang. Kulit jagung manis sangat potensial untuk dijadikan silase karena kadar gulanya
cukup tinggi (Anggraeny et al., 2005; 2006).
Tongkol jagung/janggel adalah limbah yang diperoleh ketika biji jagung dirontokkan
dari buahnya. Akan diperoleh jagung pipilan sebagai produk utamanya dan sisa buah yang
disebut tongkol atau janggel (Rohaeni et al., 2006b).
2.6.Kandungan Nutrisih Jerami Jagung
Tongkol jagung atau janggel, merupakan bagian dari buah jagung setelah biji dipipil.
Kandungan nutrisi tongkol jagung berdasarkan analisis di Laboratorium Ilmu Makanan
Ternak meliputi kadar air, bahan kering, protein kasar dan serat kasar berturut-turut sebagai
berikut 29,54; 70,45; 2,67 dan 46,52% dalam 100% bahan kering BK).
Jerami jagung yang kering ataupun yang dibuat silase tidak dapat digunakan sebagai
sumber karotenoid karena kandungan karotenoidnya sangat rendah yaitu 70 80 mg/kg,
terdiri dari 3 10 mg/kg epilutein, 25 37 mg/kg lutein, 6 10 mg/kg zeaxanthin, 24 35
mg/kg - karoten (Noziere et al., 2006).
Oleh sebab itu, bila sapi perah diberi silase jerami jagung sebagai sumber hijauan,
sangat dianjurkan untuk memberikan tambahan -karoten dari sumber lain karena kebutuhan
karoten dan vitamin A sapi perah yang tinggi yaitu masing-masing 280 IU/kg bobot hidup
dan 110 IU/ kg bobot hidup per hari (NRC, 2001).
Dari hasil analisis proksimat (%) yang dilakukan oleh Akil, et al (2004), bahwa
kelobot jagung lebih rendah dari brangkasan, kandungan protein kasar kelobot jagung 3 kali
protein kasar brangkasan, dan lemak kasar kelobot 2 kali lemak kasar brangkasan.
Nilai nutrisi dari limbah tanaman dan hasil samping industri jagung sangat bervariasi
(Tabel 1 dan 2). Kulit jagung mempunyai nilai kecernaan bahan kering in vitro yang tertinggi
(68%) sedangkan batang jagung merupakan bahan yang paling sukar dicerna di dalam rumen
(51%) (Mccutcheon dan Samples, 2002). Nilai kecernaan kulit jagung dan tongkol (60%) ini
hampir sama dengan nilai kecernaan rumput Gajah sehingga kedua bahan ini dapat

menggantikan rumput Gajah sebagai sumber hijauan. Total nutrien tercerna (TDN) yang
tertinggi terkandung pada silase tanaman jagung termasuk buah yang matang sedangkan yang
terendah dijumpai pada tongkol (Tabel 2). Faktor yang penting dalam menyusun ransum
komplit adalah nilai TDN. Kebutuhan TDN untuk penggemukan sapi potong maupun sapi
perah cukup tinggi dan syarat minimum TDN dapat dilihat dalam NRC (2001).
Tabel . Kandungan Nilai Nutrisi Jerami Jagung
Nutrien (Kandungan Zat)

Kadar Zat

Bahan Kering
50,00 a
Serat Kasar (%)
33,58 b
Protein Kasar (%)
5,56 b
Lemak (%)
1,25 b
Abu (%)
8,42 a
BETN
53,32 b
Sumber : a). Laboratorium Nutrisi Departemen Peternakan FP USU (2001).
Sudirman dan Imran (2007), menambahkan bahwa kandungan zat makanan hijauan
jagung muda pada BK 90% adalah PK 11,33%, SK 28,00%, LK 0,68%, BETN 49,23%, Abu
10,76%, NDF 64,40%, ADF 32,64% dan TDN 53,00%.

BAB III
MATERI DAN METODE PRAKTIKUM
3.1.Waktu dan Tempat Praktikum
3.1.1.Waktu Praktikum
Adapun waktu praktikum ini dilaksanaka pada hari Kamis Tanggal 08 Oktober 2015
pukul 07.00 WITA sampai selesai.
3.1.2.Tempat Praktikum
Adapun tempat praktikum ini dilaksanakan yaitu di BLPKH Banyu Mulek,Kediri
Lombok Barat.
3.2.Materi Praktikum
3.2.1.Alat-Alat Praktikum
Adapun Alat-Alat yang digunakan dalam melakukan praktikum ini adalah sebagai
berikut:
1.Silo
2.Mesin pencacah (chopper)
3.Spreier(alat penyemprot)
4.Plastik penutup.
5.Sekop
6.Terpal

3.2.2.Bahan Bahan Praktikum


Adapun Bahan-Bahan yang digunakan dalam melakukan praktikum ini adalah sebagai
berikut
1.Jerami jagung basah
2.Dedak Sumber energi (tetes, dedak, jagung) 3-5 %.)
3. Inoculum
3.3.Metode Praktium
Adapun metode atau cara kerja dalam melakukan praktikum ini adalah sebagi
berikut:
1.Memotong jerami jagung dengan panjang 3- 5cm.
2. Menyiapkan dedak halus/bekatul/tetes/jagung.
3. Menyampurkan potongan jerami dengan dedak secara merata kemudia menyemprotkan
dengan inoculum.
4. Memasukkan potongan jerami jagung sedikit demi sedikit.
5. Menginjak injak jerami yang telah dimasukan ke dalam silo sehingga menjadi padat.
6. Tutup rapat dengan plastik, proses ensilase selesai setelah 21 hari.

BAB IV
HASIL DAN PEMBAHASAN
4.1.Hasil Praktikum
Tabel 4.1.Hasil pengamatan silase jerami jagung
Warna

Wangi/Bau

Hijauan
kekuningkuningan

buahbuahan dan
sedikit asam

Penggumpala
n
Tidak Ada

Tekstur

Ph

Lembut,
4
tidak
berjamur dan
disukai
ternak.

4.2.Pembahsan
Silase merupakan salah satu teknik pengawetan hijauan pakan ternak untuk mengatasi
kekurangan pakan di musim kering dengan prinsip pemeraman dalam kondisi anaerob. Hal
ini sesuai dengan pendapat Syarifuddin (2001) bahwa proses ensilase terjadi dalam kondisi
anaerob karena bakteri yang bekerja dalam memproduksi asam laktat adalah bakteri anaerob.
Kualitas silase dipengaruhi oleh beberapa faktor yaitu asal atau jenis hijauan, temperatur
penyimpanan, dan lama penyimpanan. Hal ini sesuai dengan pendapat Regan (1997) yang
menyatakan bahwa faktor-faktor yang mepengaruhi kualitas silase adalah jenis hijauan, suhu

pemeraman, lama pemeraman, tingkat pelayuan sebelum ensilase, umur tanaman, bahan
pengawet, panjang pemotongan, dan kepadatan hijauan dalam silo.
4.2.1.Wangi/Bau
Berdasarkan praktikum pengujian bau diperoleh bau/ wangi hasil silase jerami jagung
seperti bau buah-buahan dan sedikit asam.Hal ini sesuai dengan pendapat Syarifuddin
(2001) yang menyatakan bahwa bau asam dapat dijadikan sebagai indikator untuk melihat
keberhasilan proses ensilase, sebab untuk keberhasilan proses ensilase harus dalam suasana
asam, bau yang sedikit asam dikarenakan pada proses ensilase terdapat sedikit oksigen.
Hasil silase yang buruk atau berkualitas rendah baunya busuk,Bau busuk pada proses
ensilase terjadi karena masih terdapat oksigen saat pemadatan hijauan dalam silo sehinga
dapat mengganggu proses dan hasil yang diperoleh. Hal ini sesuai dengan pendapat
Reksohadiprodjo (1998) yang menyatakan bahwa oksigen dalam proses ensilase dapat
mempengaruhi proses dan hasil yang diperoleh karena proses respirasi hijaun akan tetap
berlangsung selama masih tersedia oksigen. Respirasi tersebut dapat meningkatkan
kehilangan bahan kering, menganggu proses ensilase, menghilangkan nutrisi dan kestabilan
silase.
4.2.2.Tekstur
Berdasarkan hasil pengamatan terhadap tekstur silase diketahui bahwa teksturnya
Lembut, tidak berjamur dan disukai ternak.Seperti bahan asal karena proses ensilase adalah
proses pengawetan sehingga hasil awetan yang berhasil harus mempunyai tekstur yang sama
dengan bahan asal. Hal ini sesuai dengan pendapat Syarifuddin (2001) yang menyatakan
bahwa silase adalah hasil pengawetan melalui proses pemeraman sehingga silase yang
berhasil harus awet dalam bentuk dan teksturnya. Siregar (1996) menambahkan bahwa
secara umum silase yang baik mempunyai ciri-ciri yaitu tekstur masih jelas seperti asalnya.
Sedangkan dilihat dari ada atau tidaknya jamur hasil silase jerami jagung sama sekali
tidak terdapat jamur.Tidak terdapatnya jamur pada hasil silase ini disebabkan karena saat
memasukan jerami pada silo sangat padat sehingga udara tidak dapat masuk,sehingga tidak
dapat menyebabkan timbulnya jamur. Hal ini sesuai dengan pendapat Regan (1997) yang
menyatakan bahwa kualitas silase yang baik dipengaruhi oleh faktor-faktor seperti : asal atau
jenis hijauan, temperatur penyimpanan, tingkat pelayuan sebelum pembuatan silase, tingkat
kematangan atau fase pertumbuhan tanaman, bahan pengawet, panjang pemotongan, dan
kepadatan hijauan dalam silo. Melayu (2010) menambahkan bahwa pemberian bahan
tambahan (asam-asam organik, molases, garam, tepung shorgum, onggok) bertujuan untuk
mencegah tumbuh jamur dan bakteri pembusuk, kriteria silase yang baik yaitu tidak
terdapat jamur. Maka dilihat dari teksturnya hasil silase yang kita dapatkan sangat baik dan
sangat disukai ternak karena teksturnya lembut dan tidak berjamur sehinnga disukai ternak.
4.2.3Warna
Berdasarkan hasil praktikum didapatkan hasil silase bewarna hijau kekining-kuningan
seperti daun direbus . Warna hijau kekuning-kuningan pada silase yang ini dikarenakan
kandungan kadar air dalam rumput gajah yang dimampatkan dalam suasana anaerob sehingga
tidak terjadi proses fotosintesis dan menyebabkan warna menjadi hijau pucat atau
kekuningan. Hal ini sesuai dengan pendapat Melayu (2010) bahwa ciri silase yang baik
berwarna hijau atau hijau kekuningan. Menurut Reksohadiprodjo (1998) perubahan warna

yang terjadi pada tanaman yang mengalami proses ensilase yang disebabkan oleh perubahan
yang terjadi dalam tanaman karena proses respirasi aerobik yang berlangsung selama
persediaan oksigen masihada, sampai gula tanaman habis.Maka dilihat dari warna hasil
silase yang hijau kekuning-kuningan maka hasil silase di katakan berkualitas baik sehinnga
dapat diberikan pada ternak.
4.2.4.Penggumpalan
Berdasarkan hasil praktikum diketahui bahwa tidak ada penggumpala,hal ini
dikarenakan jerami jagung yang dipakai untuk silase terlebih dahulu dilayukan, proses
pelayuan ini dilakukan supaya kadar air silase rendah sehinnga terjadi penggumpalan.Hal ini
sesuai dengan yang dikatakan Syarifuddin (2001) yang menyatakan bahwa hijauan harus
dilayukan terlebih dahulu sampai mencapai kadar air normal yaitu 60-65% sebelum
dilakukan proses ensilase. Ditambahkan oleh Melayu (2010) yang menyatakan bahwa silase
yang baik teksturnya kering, apabila dipegang terasa lembut dan empuk serta tidak terjadi
penggumpalan. Maka dilihat dari teksturnya hasil silase yang kita dapatkan sangat baik dan
sangat disukai ternak.
4.2.5.pH
Berdasarkan hasil praktikum diketahui bahwa pH hasil silase adalah 4 hal ini
menandakan bahwa hasil silase sangat asam.Ini dikarenakan tidak ada udara dalam silo yang
menyebabkan tidak adanya populasi jamur. Hal yang sangat berpengaruh pada pH adalah ada
atau tidaknya udara yang masuk dalam silo,udara dalam silo akan meningkatkan populasi
yeast atau jamur yang menyebabkan meningkatnya pH dan suhu dalam silo.
pH hasil silase yang kita peroleh sesuai dengan apa yang dikatakan oleh Kartadisastra
(1997) yang menyatakan bahwa silase yang baik memiliki pH 4-4,8.Semakin rendahnya pH
yang diperoleh maka kualitas hasil silase yamg kita dapatkan sangat baik,ini dikarenaka hasil
silase dalam suasana sangat asam,dimana hasil silase yang baik jika dalam suasana asam.
Tingginya pH silase yang dihasilkan sesuai dengan pendapat Crowder dan Chheda
(1982) bahwa tingginya nilai pH silase yang dibuat didaerah tropis dibanding dengan nilai pH
silase yang dibuat di daerah temperate disebabkan oleh rumput tropis pada umumnya
berbatang, serat kasarnya tinggi, dan kandungan karbohidratnya rendah.

BAB V
KESIMPULAAN DAN SARAN
5.1.Kesimpulan
Adapun kesimpulan yamg didapatkan dalam melakukan praktikum ini adalah sebagai
berikut:
1.Silase adalah makanan ternak yang dihasilkan melalui proses fermentasi hijauan dengan
kandungan uap air yang tinggi. Pembuatan silase tidak tergantung kepada musim jika
dibandingkan dengan pembuatan hay yang tergantung pada musim.

2.Proses pembuatan silase secara garis besar terdiri atas empat fase : (1) fase aerob; (2) fase
fermentasi; (3) fase stabil dan (4) fase pengeluaran untuk diberikan kepada ternak.
3.Kualitas dan nilai nutrisi silase dipengaruhi sejumlah faktor seperti spesies tanaman yang
dibuat silase, fase pertumbuhan dan kandungan bahan kering saat panen, mikroorganisme
yang terlibat dalam proses dan penggunaan bahan tambahan.
4.hasil silase yang baik adalah bewarna hijau kekuning-kuningan,teksturnya yang lembut dan
tidak berjamur,baunya yang seperti buah-buahan dan asam ,tidak ada penggumpalan ,dan
pH yang sangat rendah sehingga suasana yang sangat asam.
5.Hasil silase yang didaptkan sangat berkualitas baik.
5.2.Saran
Adapun saran dalam melakukan praktikum ini adalah sebagai berikut:
1.Mahasiswa atau Praktikan diharapkan berhati- hati dalam melakukan pembuatan silase
2.Mahasiswa atau Praktikan diharapkan agar mengikuti apa yang dikatakan oleh pembimbing
yang lebih paham dalm pembuatan silase ,supaya hasil yang didapatkan sesuai dengan yang
diharapkan.

DAFTAR PUSTAKA
Aksi Agraris Kanisius. 1983. Hijauan Makanan Ternak Potong kerja dan perah. Penerbit Kanisius.
Yogyakarta.
http://jajo66.files.wordpress.com/2008/06/prinsip-pembuatan-silase.pdf
http://library.usu.ac.id/download/fp/ternak-Nevy.pdf
Kartadisastra, H.R.2004.Penyediaan dan Pengelolaan Pakan Ternak Ruminansia. Penerbit Kanisius,
Jakarta.
Melayu, S.R. 2010. Pembuatan Silase Hijauan. Universitas Andalas. Sumatra Barat.
Reksohadiprodjo, S. 1994. Produksi Tanaman Hijauan Makanan Ternak Tropik. Badan Penerbit
Fakultas Ekonomi (BPFE) UGM, Yogyakarta.
Reksohadiprodjo, S. 1998. Pakan Ternak Gembala. BPFE, Yogyakarta.
Ross, G. D. 1984. The Microbiology of Silage. Hawkesbury Agricultural Research Unit, New South
Wales Departement of Agricultural, New Jersey.
Sapienza, D. A dan K. K. Bolsen. 1993. Teknologi Silase. Terjemahan : Martoyoedo RBS. Pioner-HiBerd International, Inc. Kansas State University, England.
Schroeder, J.W. and C.S.Park. 1997. Using a total mixed ration for dairy cows. North
Dakota States University (NDSU). http: /www.ext.nodax.edu/expubs/ansci/dairy/as769w.ht
Siregar, M. E. 1996. Produksi dan Nilai Nutrisi Tiga Jenis Rumput Pennisetum dengan Sistem potong
Angkut. Prosiding Pertemuan Ilmiah Ruminansia. Jilid. I. Pusat Penelitian dan Pengembangan
Pertanian, Departemen Pertanian, Bogor.

Syarifuddin, N. A. 2001. Karakteristik dan Persentase Keberhasilan Silase Rumput Gajah pada
Berbagai Umur Pemotongan. Fakultas Pertanian Universtas Lambung Mangkurat.
Banjarbaru.

PEMBUATAN SILASE
Salah satu kendala pada peternakan ruminansia adalah ketersediaan pakan kasar.
Ketersediaan pakan kasar berkualitas bagi ternak ruminansia di Indonesia sangatlah
fluktuatif. Pada musim hujan, hijauan berproduksi tinggi sehingga melimpah. Sedangkan
pada musim kemarau, hijauan merupakan pakan yang sulit didapat. Salah satu cara untuk
mengawetkan hijauan adalah dengan membuat silase.
a. Pengertian
Silase adalah pakan yang berbahan baku hijauan, hasil samping pertanian atau bijian berkadar
air tertentu yang telah diawetkan dengan cara disimpan dalam tempat kedap udara selama
kurang lebih tiga minggu. Penyimpanan pada kondisi kedap udara tersebut menyebabkan
terjadinya fermentasi pada bahan silase.
Tempat penyimpanannya disebut silo. Silo bisa berbentuk horisontal ataupun vertical.
Pada peternakan skala besar, silo biasanya permanen. Bisa berbahan logam berbentuk silinder
ataupun lubang dalam tanah (kolam beton). Tetapi silo juga bisa dibuat dari drum atau bahkan
dari plastik . Prinsipnya, silo memungkinkan untuk memberikan kondisi anaerob pada bahan
agar terjadi proses fermentasi.
Bahan untuk pembuatan silase bisa berupa hijauan atau bagian bagian lain dari
tumbuhan yang disukai ternak ruminansia, seperti rumput, legume, biji bijian, tongkol
jagung, pucuk tebu, batang nenas dan lain-lain. Kadar air bahan yang optimal untuk dibuat
silase adalah 65-75% . Kadar air tinggi menyebabkan pembusukan dan kadar air terlalu
rendah sering menyebabkan terbentuknya jamur . Kadar air yang rendah juga meningkatkan
suhu silo dan meningkatkan resiko kebakaran.
Jika dibandingkan dengan pembuatan hay, pembuatan silase memiliki kelebihan yaitu:
Hijauan tidak mudah rusak oleh hujan pada waktu dipanen
Tidak banyak daun yang terbuang
Silase umunya lebih mudah dicerna dibandingkan hay
Karoten dalam hijauan lebih terjaga dengan dibuat silase dibanding hay
Sedangkan kelemahan pembuatan silase adalah perlunya ongkos panen, perlunya
mengisi silo dan biaya pembuatan silo sebagai tempat penyimpanan
b. Tujuan
Tujuan pembuatan silase adalah untuk mengawetkan hijauan atau bijian yang
berlimpah untuk digunakan pada saat kesulitan untuk mendapatkan hijauan tersebut. Di
negara yang memiliki 4 musim silase sangat popular bagi peternak ruminansia karena

tanaman hanya berproduksi pada musim tertentu. Jadi silase bisa menjadi cadangan pakan
untuk ternak mereka.
Di Indonesia, hijauan melimpah pada musim hujan dan kurang pada musim kemarau.
Tetapi pengawetan hijauan seperti dengan pembuatan silase belum banyak dilakukan oleh
peternak skala kecil di negara kita. Akibatnya peternak kita sering mengalami kesulitan
penyediaan pakan bagi ternaknya.
Di Kalimantan Selatan, salah satu tanaman yang banyak dibudidayakan dan bisa
digunakan sebagai pakan tetapi

belum banyak pemanfaatannya adalah kelapa sawit.

Penggunaan daun dan pelepah kelapa sawit sudah banyak diteliti oleh para ahli. Kita bisa
membuatnya menjadi silase.
c. Proses Ensilase
Agar berhasil membuat silase, kita harus memahami proses ensilase. Proses ensilase
yaitu proses selama pembuatan silase. Proses ini memerlukan waktu 2-3 minggu.
Setelah suatu produk pertanian dipanen, misalnya rumput dipotong, proses respirasi
akan tetap terjadi sampai sel sel tanaman mati. Respirasi merupakan pengubahan karbohidrat
menjadi energi maka apabila berjalan lama akan menurunkan kandungan karbohidrat pakan.
Proses respirasi memerlukan oksigen sehingga untuk menghentikan proses ini dapat
dilakukan dengan menempatkan bahan pada kondisi anaerob.

Oleh karena itu kita

memampatkan bahan silase dan menutup rapat silo agar proses respirasi tidak berlangsung
lama.
Hijauan biasanya dipotong 3-5 cm sebelum dibuat silase. Tujuannya agar lebih mudah
memampatkannya. Apabila pemampatan maksimal, maka oksigen dalam silo akan rendah
sehingga respirasi cepat terhenti.
Setelah respirasi terhenti, proses yang terjadi selanjutnya adalah fermentasi. Proses
ini menyebabkan turunnya pH (derajat keasaman) bahan baku silase hingga tidak ada lagi
organisme yang bisa tumbuh. Proses fermentasi bisa terjadi karena adanya bakteri pembentuk
asam laktat yang mengkonsumsi karbohidrat dan menghasilkan asam laktat. Asam laktat
akan terus diproduksi hingga tercapai pH yang rendah (<5) yang tidak memungkinkan bakteri
beraktifitas lagi dan tidak ada lagi perubahan .

Keadaan inilah yang disebut keadaan

terfermentasi, dimana bahan dalam keadaan tetap atau awet. Pada kondisi anaerob silase
dapat disimpan bertahun-tahun.
Contoh bakteri asam laktat diantaranya adalah Streptococcus thermophillus,
Streptococcus lactis, Lactobacillus lactis, Leuconostoc mesenteroides .
Selain bakteri pembentuk asam laktat, dalam bahan baku silase terdapat juga bakteri
Clostridia. Bakteri ini mengkonsumsi karbohidrat, protein dan asam laktat sebagai sumber
energi dan memproduksi asam butirat. Bakteri ini merugikan karena menguraikan asam

amino (menurunkan kandungan protein dan menghasilkan ammonia) sehingga menyebabkan


pembusukan silase. Keadaan yang mendukung pertumbuhan bakteri Clostridia adalah
tingginya kadar air, terlalu lamanya proses respirasi, kurangnya bakteri asam laktat dan
rendahnya karbohidrat. Inilah yang menyebabkan perlunya pelayuan bila kadar air bahan
lebih dari 75% dan bahan tambahan dalam pembuatan silase hijauan.
Bahan tambahan untuk pembuatan silase dibedakan menjadi 2 jenis yaitu stimulant
dan inhibitor. Bahan yang masuk kategori stimulant adalah bahan pakan sumber karbohidrat
seperti molasses, onggok, dedak halus atau ampas sagu. Molasses dan onggok bisa
ditambahkan sebanyak 2,5 % dari berat hijauan. Sedangkan kalau dedak halus sebanyak 5%
dan kalau menggunakan ampas sagu diperlukan 7% dari berat hijauan. Urea juga bisa
ditambahkan untuk meningkatkan kandungan protein silase berbahan baku jagung. Bahan
stimulant lain yang juga bisa dipakai adalah enzim atau mikrobia yang biasa dijual di
pasaran.
Sedangkan bahan yang masuk kategori inhibitor diantaranya asam format, asam
klorida, antibiotik, asam sulfat dan formalin. Penambahan inhibitor bermanfaat untuk proses
ensilase tetapi masih asing bagi petani kita. Bahan stimulant lebih mudah didapatkan,
harganya juga lebih murah dan lebih ramah lingkungan.
Jadi prinsip pembuatan silase yang utama adalah:
Menghentikan pernapasan dan penguapan sel sel tanaman
Mengubah karbohidrat menjadi asam laktat melalui proses fermentasi kedap udara
Menahan aktivitas enzim dan bakteri pembusuk
Mencapai dan mempercepat keadaan hampa udara (anaerob)
d. Kualitas Silase
Silase yang baik biasanya berasal dari pemotongan hijauan tepat waktu (menjelang
berbunga), pemasukan ke dalam silo dilakukan dengan cepat, pemotongan hijauan dengan
ukuran yang memungkinkannya untuk dimampatkan, penutupan silo secara rapat
(tercapainya kondisi anaerob secepatnya) dan tidak sering dibuka.
Silase yang baik beraroma dan berasa asam, tidak berbau busuk. Silase hijauan yang
baik berwarna hijau kekuning-kuningan. Apabila dipegang terasa lembut dan empuk tetapi
tidak basah (berlendir) . Silase yang baik juga tidak menggumpal dan tidak berjamur. Bila
dilakukan analisa lebih lanjut, kadar keasamanya (pH) 3,2-4,5.
Apabila terlihat adanya jamur, warna kehitaman, berair dan aroma tidak sedap berarti
silase berkualitas rendah.
e. Penggunaan Silase
Silase bisa digunakan sebagai salah satu atau satu satunya pakan kasar dalam ransum
sapi potong . Pemberian pada sapi perah sebaiknya dibatasi tidak lebih 2/3 dari jumlah pakan

kasar. Silase juga merupakan pakan yang bagus bagi domba tetapi tidak bagus untuk kuda
maupun babi. Silase merupakan pakan yang disukai ternak terutama bila cuaca panas.
Apabila ternak kita belum terbiasa mengkonsumsi silase, maka pemberiannya sedikit
demi sedikit dicampur dengan hijauan yang biasa dimakan.
Anonimous, 2012. Determine The Characteristics of Good Silage and The Steps in Producing It.
http://forages.oregonestate.edu/nfgc/eo/onlineforagecurriculum
/instructurmaterials/availabletopics/mechaninalharvest/silage
Cullison, A.E. & Lowrey, R. S. 1987. Feeds and Feeding. Fourth Edition. (Page 234-245) A Resto
Book Prentice Hall. Englewood Cliffs.
Drake, D.J. Nader, G., Forero, L. 2011. Feeding Rice Straw to Cattle. University of California.
Ensminger, M.E. 1990. Animal Science. 8th Ed. Interstate Publisher, Inc. Dannville
Ensminger, M.E., et al. 1992. Feed and Nutrition. Second Edition. The Ensminger Publishing
Company. Clovis. California.
Hanafi, ND. 2008. Teknologi Pengawetan Pakan Ternak. Universitas Sumatera Utara.
Kartasudjana, D. 2001. Mengawetkan Hijauan Pakan Ternak. Modul Keahlian Budidaya Ternak.
Direktorat
Pendidikan
Menengah
Kejuruan.
http://files.ictpamekasan.nett/materikejuruan/pertanian/budi-daya-ternakruminansia/mengawetkan-hijauan-pakan.pdf
McDonald, P, et al. 1987. Animal Nutrition. Fourth edition. (Page 404-415) Longman Group,LTd.
Nista, D. dkk. 2007. Teknologi Pengolahan Pakan: UMB, fermentasi jerami,amoniasi jerami,
silage, hay. http://bptu_sembawa.net/VI/data/download/20090816160949.pdf.
Parakkasi, A. 1999. Ilmu Nutrisi dan Makanan Ternak Ruminant. UI Press. Jakarta.
Rukmana, R. 2005. Budi Daya Rumput Unggul Hijauan Makanan Ternak. (hal 51-57) Kanisius.
Yogyakarta.

Latar Belakang

Kekurangan hijauan segar sebagai pakan ternak sudah lama dirasakan oleh
peternak di Indonesia pada umumnya dan di NTT khususnya. Seringkali peternak
menanggulanginya dengan cara memberikan pakan seadanya yang diperoleh
dengan mudah dari lingkungan di sekitarnya. Pemberian pakan ternak yang
seadanya sangat mempengaruhi produktivitas ternak, terlihat dari lambatnya
pertumbuhan atau minimnya peningkatan berat badan (BB) bahkan sampai
mengalami sakit. Pengawetan hijauan pakan atau limbah pertanian dalam
bentuk silase merupakan salah satu alternative yang dapat ditempuh terutama
untuk mengatasi kesulitan pengadaan pakan di daerah yang mengalami musim
kemarau panjang. Perubahan musim akan mempengaruhi kualitas hijauan pakan
yaitu hilangnya fraksi yang mudah larut atau fraksi non structural akibat
respirasi yang meningkat dan penurunan netto fotosintesis.
Pengawetan hijauan sepeti silase diharapkan dapat mengatasi permasalahan
kekurangan hijauan segar terutama pada musim kemarau yang selanjutnya
dapat memperbaiki produktivitas ternak. Produktivitas ternak merupakan fungsi
dari ketersediaan pakan dan kualitasnya. Ketersediaan pakan dipengaruhi oleh
beberapa faktor di antaranya suhu harian, iklim, dan ketersediaan air tanah.
Faktor tersebut sangat mempengaruhi ketersediaan hijauan pakan ternak yang
diharapkan kontinyu sepanjang tahun (Ridwan dan Widyastuti, 2001).
B.

Tujuan Praktikum

Praktikum ini bertujuan untuk mengetahui prinsip pembuatan silase

BAB II
TINJAUAN PUSTAKA

I.

Pengertian Silase

Silase adalah makanan ternak yang dihasilkan melalui proses fermentasi hijauan
pakan dengan kandungan air yang tinggi. Silase adalah pakan yang telah
diawetkan yang di proses dari bahan baku yang berupa tanaman hijauan ,
limbah industri pertanian, serta bahan pakan alami lainya, dengan jumlah kadar /
kandungan air pada tingkat tertentu kemudian di masukan dalam sebuah tempat
yang tertutup rapat kedap udara , yang biasa disebut dengan Silo, selama
sekitar tiga minggu.
II.

Tujuan Pembuatan Silase

Tujuan pembuatan silase adalah 1). Memanfaatkan hijauan pada kondisi


pertumbuhan yang tertinggi baik dari segi kualitas maupun kuantitas, 2).

Menyediakan hijauan pakan yang berkualitas tinggi bagi ternak ruminansia dan
3). Mempertahankan atau meningkatkan produksi.
III.

Prinsip Dasar Fermentasi Silase

Prinsip dasar dari pengawetan dengan cara silase fermentasi adalah sebagai
berikut:

Respirasi
Sebelum sel-sel di dalam tumbuhan mati atau tidak mendapatkan oksigen, maka
mereka melakukan respirasi untuk membentuk energi yang di butuhkan dalam
aktivitas normalnya. Respirasi ini merupakan konversi karbohidrat menjadi
energi.
Respirasi ini di bermanfaat untuk menghabiskan oksigen yang terkandung,
beberapa saat setelah bahan di masukan dalam silo. Namun respirasi ini
mengkonsumsi karbohidrat dan menimbulkan panas, sehingga waktunya harus
sangat di batasi, seperti reaksi dibawah ini :
C2H12O6 + 6O2 6CO2 + 6H2O + panas

Respirasi yang berkelamaan di dalam bahan baku silase, dapat mengurangi


kadar karbohidrat, yang pada ahirnya bisa menggagalkan proses fermentasi.
Pengurangan kadar oksigen yang berada di dalam bahan baku silase, saat
berada pada ruang yang kedap udara yg disebut dengan Silo, adalah cara
terbaik meminimumkan masa respirasi ini.

Fermentatsi
Setelah kadar oksigen habis , maka proses fermentasi di mulai. Fermentasi
adalah menurunkan kadar pH di dalam bahan baku silase sampai dengan kadar
pH dimana tidak ada lagi organisme yang dapat hidup dan berfungsi di dalam
silo. Penurunan kadar pH ini dilakukan oleh lactic acid ( asam laktat ) yang di
hasilkan oleh bakteri Lactobacillus. Lactobasillus itu sendiri sudah berada
didalam bahan baku silase, dan dia akan tumbuh dan berkembang dengan cepat
sampai bahan baku terfermentasi. Bakteri ini akan mengkonsumsi karbohidrat
untuk kebutuhan energinya dan mengeluarkan asam laktat. Bakteri ini akan
terus memproduksi asam laktat dan menurunkan kadar pH di dalam bahan baku
silase sampai pada tahap kadar pH yang rendah, dimana tidak lagi
memungkinkan bakteri ini beraktivitas, sehingga silo berada pada keadaan
stagnant, atau tidak ada lagi perubahan yang terjadi, dan bahan baku silase
berada pada keadaan yang tetap. Keadaan inilah yang di sebut keadaan
terfermentasi, dimana bahan baku berada dalam keadaan tetap , yang disebut

dengan menjadi awet. Pada keadaan ini maka silase dapat di simpan bertahuntahun selama tidak ada oksigen yang menyentuhnya.

IV.

Bakteri Clostridia

Bakteri ini juga sudah berada pada hijauan atau bahan baku silase lainnya, saat
mereka di masukan kedalam silo. Bakteri ini mengkonsumsi karbohidrat, protein
dan asam laktat sebagai sumber energy, bakteri ini kemudian mengeluarkan
Butyric acid ( asam butirat ), dimana asam butirat bisa diasosiasikan dengan
pembusukan silase. Keadaan yang menyuburkan tumbuhnya bakteri clostridia
adalah kurangnya kadar karbohidrat untuk proses fermentasi , yang biasanya di
sebabkan oleh : kehujanan pada saat pencacahan bahan baku silase, proses
respirasi yang terlalu lama, terlalu banyaknya kadar air di dalam bahan baku.
Dan juga kekurangan jumlah bakteri Lactobasillus . Itulah sebabnya kadang di
perlukan penggunaan bahan tambahan atau aditive.

V.

Tahapan atau fase fermentasi silase

Fase I

Fase II

Fase III

Fase IV

Fase V

Fase VI
Respirasi sel, produksi CO2, panas dan air

Produksi asam asetat, asam laktat dan etanol

Pembentukan asam laktat

Pembentukan asam laktat

Penyimpanan material

Dekomposisi aerob saat silo dibuka


Perubahan suhu 20,60C

32,20C

28,90C

28,90C
Perubahan pH 6,0 6,5

5,0

4,0

7,0

Bakteri asam asetat asam laktat

Bakteri asam laktat

Bakteri asam laktat

Aktivitas ragi dan jamur


Umur silase 1 hari

2 hari

4 hari

21 hari

VI.

Bahan pembuatan Silase

Bahan untuk pembuatan silase adalah segala macam hijauan dan bahan dari
tumbuhan lainnya yang di sukai oleh ternak ruminansia, seperti : Rumput,
Sorghum, Jagung, Biji-bijian kecil, tanaman tebu, tongkol gandum, tongkol
jagung, pucuk tebu, batang nanas dan jerami padi, dll

VII.

Syarat hijauan (tanaman) yang dibuat Silase

Segala jenis tumbuhan atau hijauan serta bijian yang di sukai oleh ternak,
terutama yang mengandung banyak karbohidrat nya. Untuk penjelasan
mengapa dan apa sebabnya dapat lihat di bagian Prinsip Fermentasi.

VIII.

Bahan tambahan

Pemberian bahan tambahan secara langsung dengan menggunakan: Natrium


bisulfate, Sulfur oxide, Asam chloride, Asam sulfat, Asam propionate, dll.
Pemberian bahan tambahan secara tidak langsung ialah dengan memberikan
tambahan bahan-bahan yang mengandung karbohidrat yang siap diabsorpsi oleh
mikroba, antara lain molase (melas), onggok (tepung), tepung jagung, dedak
halus, ampas sagu.

IX.

Kriteria Silase yang baik :

Berdasarkan informasi dari (Kartadisastra, 2004) bahwa tempaeratur yang baik


untuk silase berkisar 270C hingga 350C. pada temperature tersebut, kualitas
silase yang dihasilkan sangat baik. Kualitas tersebut dapat diketahui secara
organoleptik, yaitu:

Mempunyai tekstur segar

Berwarna kehijau-hijauan

Tidak berbau busuk

Disukai ternak

Tidak berjamur

Tidak menggumpal

BAB III

MATERI DAN METODE

1.

Tempat dan Waktu Pelaksanaan Praktikum

Praktikum pembuatan silase dilaksanakan pada :


Hari / Tanggal

: Rabu, 17 Oktober 2012

Waktu

: pukul 10.00 selesai

Tempat

: Lab. Lapangan Fakultas Peternakan Undana

2.
*

Alat dan Bahan Praktikum


Alat Praktikum

o Parang, untuk mencacah rumput


o Timbangan, untuk menimbang bahan praktikum seperti : rumput, gamal, dan
dedak jagung
o Silo, sebagai media penyimpanan silase
o Tali raffia / ban dalam bekas, untuk mengikat silo
*

Bahan Praktikum

Praktikum ini menggunakan hijauan rumput raja ( Pennisetum purpurophoides )


sebanyak 4,5 Kg, yang dipersiapkan oleh mahasiswa setiap kelompok. Bahan lain
yaitu daun gamal ( Gliricidia sepium ) sebanyak 8,5 Kg yang diperoleh dari lab.
Lapangan fapet, sedangkan bahan tambahan ( additive ) yang digunakan adalah
dedak jagung halus.

3.

Langkah langkah kerja :

v Potong rumput raja, panjang 5 cm


v Gamal di ambil daunnya
v Jemur atau angin-anginkan selama 15 20 menit
v Timbang rumput dan daun gamal dengan perbandingan 60 : 40 % atau
rumput raja sebanyak 4,5 Kg dan daun gamal sebanyak 8,5 Kg
v Timbang dedak jagung halus sebanyak 10 % dari berat hijauan
v Campulah rumput yang telah dipotong dengan daun gamal secara baik dan
rata

v Setelah dicampur masukkan dalam silo sedikit-demi sedikit bersamaan


dengan dedak jagung sambil ditekan sampai padat betul sehingga tidak ada
udara dalam silo
v Segera tutup silo dan diikat yang kuat dengan ban dalam bekas atau tali raffia
sehingga silo tidak terbuka atau masuk udara
v Simpan ditempat yang aman dan tidak terkena sinar matahari langsung

BAB IV
HASIL DAN PEMBAHASAN

1.

Silase

Berdasarkan hasil praktikum pembuatan silase campuran rumpur raja dan daun
gamal adalah sebagai berikut :
Tabel 1. Data Hasil Pengamatan Silase campuran rumput raja dan daun gamal
Kriteria

Minggu 0

Minggu 1

Minggu 2

`Minggu 3

Karak-teristik

Karak-teristik

Karak-teristik

Karak-teristik
Bau

Khas daun gamal

Harum / khas silase


Tekstur

Kasar

remah, lembut
Warna

Hijau

Hijau

Seperti daun di rebus

Hijau kekuning kuningan / kocoklatan


Jamur

Tidak ada

Tidak ada

Tidak ada

Tidak ada
Penggumpalan

Tidak ada

Tidak ada

Tidak ada

Tidak ada

1.1.1

warna

Berdasarkan hasil praktikum warna dari silase campuran rumput raja dan daun
gamal, diperoleh hasil minggu ke-0 pada sampel masih seperti warna bahan asal
yaitu warna hijau , minggu ke-1 warna masih tetap hijau, minggu ke-2 berwarna
hijau seperti daun direbus sedangkan minggu ke-3 pada sampel berwarna hijau
kecoklatan. Hal ini menunjukkan bahwa silase memiliki kualitas yang kurang baik
pada minggu ke-3 karena warna yang dihasilkan sudah menjadi hijau kecoklatan,
namun pada minggu ke-2 masih tergolong bagus kualitasnya. Sesuai dengan

pendapat Febrisiantosa (2007) yang menyatakan bahwa silase yang berkualitas


baik mempunyai ciri-ciri teksturnya tidak berubah, tidak menggumpal, berwarna
hijau seperti daun direbus, berbau dan berasa asam. Ditambahkan oleh
pernyataan Susetyo et al., (1980) menyatakan bahwa silase yang baik memiliki
warna yang tidak jauh berbeda dengan warna bahan dasar itu sendiri, memiliki
pH rendah dan baunya asam.
1.1.2.

Bau

Berdasarkan hasil praktikum diperoleh bau dari silase campuran rumput raja dan
daun gamal, diperoleh hasil minggu ke-0 pada sampel masih seperti bau bahan
asal yaitu bau khas rumput dan gamal , minggu ke-1 hingga minggu ke-2 tidak
dilakukan pengamatan bau sebab silo tidak dibuka, sedangkan minggu ke-3 pada
sampel berbau harum / bau khas silase. Hal ini menunjukkan bahwa silase
minggu ke-3 memiliki kualitas yang baik karena berbau harum. Sesuai dengan
pendapat Febrisiantosa (2007) yang menyatakan bahwa silase yang berkualitas
baik mempunyai ciri-ciri teksturnya tidak berubah, tidak menggumpal, berwarna
hijau seperti daun direbus, berbau dan berasa asam. Ditambahkan oleh Foley et
al. (1973) yang menyatakan bahwa tahapan ensilase ada 5 yaitu 1) Hijauan akan
menghasilkan panas dan CO2 sampai proses respirasi terhenti. Respirasi aerob
oleh hijauan akan mengurangi udara dalam silo dan menyebabkan kondisi
anaerob. Proses ini berlangsung selama 3-5 hari pertama; 2) Fase produksi asam
asetat yang dihasilkan oleh bakteri; 3) Tahap ini dimulai saat konsentrasi asam
meningkat dengan pertambahan bakteri penghasil asam laktat; 4) Terjadi
penurunan bakteri pembentuk asam laktat karena bakteri asam asetat tidak
dapat hidup di lingkungan dengan asam laktat dan asetat tersedia cukup, tidak
akan terjadi perubahan lebih lanjut kamudian akan berreaksi dengan bahan yang
diawetkan sehingga terjadi pembusukan, asam amino dan protein akan berubah
menjadi ammonia dan amina yang akan menurunkan kualitas silase.
1.1.3.

Jamur

Berdasarkan hasil praktikum diperoleh hasil pengamantan jamur dari silase


campuran rumput raja dan daun gamal, diperoleh hasil minggu ke-0 tidak ada
jamur , minggu ke-1 belum ada jamur, minggu ke-2 tidak ada jamur yang
tumbuh pada silase tersebut hingga minggu ke-3 pada saat silase dibongkar
tidak terdapat jamur. Kualitas silase pada minggu ke-3 itu bagus karena silase
tersebut tidak terkontaminasi jamur. Hal ini sesuai dengan pendapat Regan
(1997) yang menyatakan bahwa silase dikatakan berkualitas baik, jika tidak
terdapat jamur. Faktor-faktor yang mempengaruhi kualitas silase seperti asal
atau jenis hijauan, temperatur penyimpanan, tingkat pelayuan sebelum
pembuatan silase, tingkat kematangan atau fase pertumbuhan tanaman, bahan
pengawet, panjang pemotongan, dan kepadatan hijauan dalam silo.
Ditambahkan oleh pendapat Zailzar et al. (2011) bahwa ciri-ciri silase yang baik
yaitu berbau harum agak kemanis-manisan, tidak berjamur, tidak menggumpal,
berwarna kehijau-hijauan dan memiliki pH antara 4 sampai 4,5.
1.1.4.

Tekstur

Berdasarkan hasil praktikum diperoleh hasil pengamantan tekstur dari silase


campuran rumput raja dan daun gamal, diperoleh hasil minggu ke-0 kasar ,
minggu ke-1 hingga minggu ke-2 tidak dilakukan pengamatan tekstur sebab silo
tidak dibuka. Sedangkan pada minggu ke-3 saat di buka tekstur silase tersebut
masih utuh, remah dan lembut. kualitas silase pada minggu ke-3 ini baik. Hal ini
sependapat dengan Zailzar et al. (2011) bahwa ciri-ciri silase yang baik yaitu
berbau harum dan bertekstur remah.

1.1.5.

pH

Berdasarkan hasil praktikum tidak dilakuan pengukuran pH dari silase, baik dari
minggu ke 1 hingga minggu ke-3. Silase yang baik itu harus dalam suasana
asam karena terjadi proses fermentasi. Hal ini sesuai dengan pendapat Siregar
(1996) yang menyatakan bahwa pada pembuatan silase perlu ditambahkan
bahan pengawet agar terbentuk suasana asam dengan derajat keasaman
optimal. Rasa asam dapat dijadikan sebagai indikator untuk melihat keberhasilan
proses ensilase, sebab untuk keberhasilan proses ensilase harus dalam suasana
asam. Diperkuat oleh pernyataan Hal ini sependapat dengan Zailzar et al. (2011)
bahwa ciri-ciri silase yang baik yaitu memiliki pH antara 4 sampai 4,5.

BAB V
PENUTUP

A.

Kesimpulan

Berdasarkan hasil praktikum dapat disimpulkan bahwa prinsip utama


pengawetan melalui teknologi silase adalah mempercepat kondisi anaerob dan
suasana asam didalam silo. Hal ini dapat terjadi apabila jumlah udara di dalam
silo minimal yaitu dengan pemadatan yang maksimal, disamping menekan
aktivitas mikroba yang menyebabkan kerusakan silase dengan mendorong
percepatan terbentuknya asam laktat.

Kualitas silase campuran rumput raja dan daun gamal menunjukkan hasil baik.
Hal ini dikarenakan memilki sifat berbau dan rasa asam, berwarna hijau seperti
daun direbus, tekstur hijau seperti bahan asal, tidak berjamur dan tidak
menggumpal sesuai dengan persyaratan silase yang baik.

DAFTAR PUSTAKA

Hartati, Erna. 2010. Bahan Ajar Mandiri Teknologi Pengolahan Pakan Fakultas
Peternakan
Universitas Nusa Cendana Kupang
Siregar, S.B. 1996. Pengawetan Pakan Ternak. Penebar Swadaya, Jakarta.
Widyastuti, Y. 2008. Fermentasi Silase dan Manfaat Probiotik Silase bagi
Rouminansia. Media Peternakan. 31 (3) : 225-232.
Zailzar, L., Sujono, Suyatno dan A. Yani. 2011. Peningkatan Kualitas Dan
Ketersediaan Pakan Untuk Mengatasi Kesulitan di Musim Kemarau Pada
Kelompok Peternak Sapi Perah.
Jurnal Dedikasi Vol. 8.