Anda di halaman 1dari 10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME
0

Lainnya BlogBerikut

AQUACULTURE
Akutakpernahmemikirkanmasadepan,iaakandatangsegera(AlbertEeinstein)

Jumat,20November2015
TentangKu...

PERSIAPANLAHANBUDIDAYAUDANGVANAME

Arsip...
2015

I.PENDAHULUAN
IsmailFishery
Ikuti

Lihatprofil
lengkapku

1.1LatarBelakang
Udang adalah komoditas andalan dari sektor perikanan yang merupakan salah satu penghasil devisa bagi
negara. Permintaan pasar domestik maupun dari manca negara cenderung mengalami peningkatan, sehingga usaha
membudidayakan udang memiliki prospek yang cerah untuk dijadikan bisnis yang menguntungkan. Menurut
Kusnendar,Indonesiapernahmenikmatimasakeemasandalambidangbudidayaudang,yaitupadawaktuudangwindu
masihmudahuntukdipelihara,sekitartahun80anhinggapadaawal90an.Namunpadapertengahantahun90andunia
pertambakandiguncangpraharayangmemilukan.Hampirsemuapetambakdiseluruhtanahairbahkanjugapetambak
udangdiluarnegerimengalamikerugianyangtidaksedikit.Dikarenakanudangwinduyangdipeliharanyamatisecara
masalakibatseranganviruswhitespotyangmewabah.
Pemerintah dan petambak mencari solusi untuk memecahkan permasalahan tersebut, salah satunya dengan
memeliharaspesiesbaruyaituudangvaname(Litopenaeusvannamei).UdangvanamemasukkeIndonesiapadatahun
2001. Pada Mei 2002, pemerintah memberikan izin kepada dua perusahaan swasta untuk mengimpor induk udang
vanamesebanyak2000ekordanbenursebanyaklimajutaekor.Indukdanbenurtersebutkemudiandikembangbiakan
oleh hatchery pemula. Sekarang usaha tersebut sudah dikomersialkan dan berkembang pesat karena peminat udang
vaname semakin menigkat. Udang vaname di kalangan petambak semakin popular, seiring dengan menurunya
produksiudangwinduakibatkondisilngkunganyangburuk.Udangwindusangatrentanterhadapseranganpenyakit,
ituberbedadenganudangvannameiyanglebihtahanterhadapseranganpenyakit.Selainituudangvannameijugalebih
tahan terhadap goncangan kondisi lingkungan yang ekstrim, bahkan sekarang sudah ada yang melakukan uji coba
membesarkan udang vaname pada perairan yang kadar garamnya 0 ppm, yang kondisi lingkunganya sangat jauh
berbedadenganhabitataslinya.
Dengansemakinbertambahbanyaknyapengusahatambakditanahair,makadiperlukanteknikbudidayaudang
vaname yang tepat dan harus ramah lingkungan, agar hasil produksi dapat optimal dan berkesinambungan. Karena
dengan memelihara udang secara besarbesaran dikhawatirkan limbah dari proses budidaya akan mencemari
lingkungan, dan akan mempengaruhi keberhasilan usaha budidaya tersebut. Salah satu teknik budidaya yang ramah
lingkungandandapatditerapkanialahbudidayapembesarandenganteknologisupraintensif.
1.2TujuandanKegunaan
Adapuntujuandaripenulisanakhirinibertujuanuntukmengetahuitentangbudidayaudangvanamedengan
teknologisupraintensifkhususnyapersiapankolamditambakbudidayaudangvanamesupraintensif.
Adapunmanfaatdalampenyusunantugasakhiriniyaitusebagaisumbaganinformasikepadamasyarakatdan
menambahwawasanmahasiswasertaacuandalamusahapembesaranudangvanamedenganteknologisupraintensif.

II.TINJAUANPUSTAKA
2.1Klasifikasi
MenurutBoone(1931),udangvanamemempunyaiklasifikasidantatanamasebagaiberikut:
Kingdom:Animalia
Filum:Arthropoda
Subfilum:Crustacea
Kelas:Malacostraca
Subkelas:Eumalacostraca
Superordo:Eucarida
Ordo:Decapoda
Subordo:Dendrobrachiata
Famili:Penaeidae
Genus:Litopenaeus
Species:Litopenaeusvannamei
2.2Morfologi
MenurutWibandanSweeny(1991),vanamesecaramorfologisdapatdibedakandalamduabagianyaitubagian
kepala yang menyatu dengan dada disebut chepalotorax dan bagian belakang bagian perut disebut abdomen. Pada
bagian kepala terdapat mata majemuk yang bertangkai, rostrum, dimana gerigi rostrum pada bagian atas biasanya
terdiridarisembilanbuahdanbagianbawahterdiridaritigabuahdandilengkapipuladengansepasangantennayang
http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

2013

1/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

panjang. Pada bagian perut terdapat lima pasang kaki renang (pleopoda) yang terletak di masingmasing ruas,
sedangkanpadaruaskeenamterdapatkakirenangyangtelahberubahbentukmenjadikipas(uropoda)yangujungnya
membentukujungekoryangdisebutdengantelsondandibawahnyaterdapatlubangdubur(anus).Alatkelaminjantan
disebutpetasma,yangterletakdiantarakakirenangpertama,sedangkanalatkelaminudangbetinadisebutthelicum
yang terletak antara kaki jalan dan kaki renang. Morfologi udang vaname serta bagian organ tubuhnya dapat dilihat
padagambarberikutini:

Gambar1.MorfologiUdangVaname
2.3HabitatdanSiklusHidup
Menurut Briggs dkk (2004), udang vaname hidup di habitat laut tropis dimana suhu air biasanya lebih dari
20C sepanjang tahun. Udang vaname dewasa dan bertelur di laut terbuka, sedangkan pada stadia postlarva udang
vanameakanbermigrasikepantaisampaipadastadiajuvenil.Udangvanamemerupakanbagiandariorganismelaut.
Beberapa udang laut menghabiskan siklus hidupnya di muara air payau. Perkembangan Siklus hidup larva udang
vanameadalahdaripembuahantelurberkembangmenjadinaupli,mysis,postlarva,juvenil,danterakhirberkembang
menjadiudangdewasa.Masukkestadialarva,daristadianauplisampaipadastadiajuvenilberpindahkeperairanyang
lebihdangkaldimanaterdapatbanyakvegetasiyangdapatberfungsisebagaitempatpemeliharaan.Setelahmencapai
remaja,merekakembalikelautlepasmenjadidewasadansiklushidupberlanjutkembali.
Siklus hidup udang vaname sebelum ditebar di tambak yaitu stadia naupli, stadia zoea, stadia mysis, dan
stadiapostlarva.Padastadianauplilarvaberukuran0,320,59mm,sistimpencernaanyabelumsempurnadanmasih
memiliki cadangan makanan berupa kuning telur. Stadia zoea terjadi setelah larva ditebar pada bak pemeliharaan
sekitar1524jam.Larvasudahberukuran1,053,30mmdanpadastadiainibenihmengalami3kalimoulting.Pada
stadiainipulabenihsudahbisadiberimakanyangberupaartemia.Padastadiamysis,benihudangsudahmenyerupai
bentuk udang. Yang dicirikan dengan sudah terluhatnya ekor kipas (uropoda) dan ekor (telson). Selanjutnya udang
mencapaistadiapostlarva,dimanaudangsudahmenyerupaiudangdewasa.Hitunganstadianyasudahmenggunakan
hitunganhari.Misalnya,PL1berartipostlarvaberumursatuhari.Padastadiainiudangsudahmulaibergerakaktif
2.4MakandanKebiasaanMakan
Menurut Haliman dan Dian (2005), udang vaname termasuk golongan omnivora atau pemakan segala.
Beberapa sumber pakan udang antara lain udang kecil (rebon), fitoplankton, copepoda, polyhaeta, larva kerang dan
lumut. Selanjutnya menjelaskan bahwa udang vaname mencari dan mengidentifikasi pakan menggunakan sinyal
kimiawi berupa getaran dengan bantuan organ sensor yang terdiri dari bulubulu halus (setae). Organ sensor ini
terpusat pada ujung anterior antenula, bagian mulut, capit, antena, dan maxilliped. Dengan bantuan sinyal kimiawi
yangditangkap,udangakanmeresponuntukmendekatiataumenjauhisumberpakan.Untukmendekatisumberpakan,
udang akan berenang menggunakan kaki jalan yang memiliki capit, kemudian dimasukkan ke dalam mulut.
Selanjutnya,pakanyangberukurankecilmasukkedalamkerongkongandanoesophagus.Bilapakanyangdikonsumsi
terlalubesar,akandicernasecarakimiawiterlebihdahuluolehmaxillipeddidalammulut.
2.5KelangsunganHidupdanPertumbuhan
Kelangsungan hidup dan pertumbuhan udang vannamei adalah dua parameter tingkat keberhasilan proses
budidaya. Karena dua faktor tersebut yang mempengaruhi tonase biomas yang dihasilkan dari proses budidaya.
Kelangsunganhidup(survivalrate)adalahbanyaknyaudangyangberhasilhiduphinggamasapanentiba.Yangpaling
mempengaruhi kelangsungan hidup udang yang dipelihara ialah kondisi lingkungan perairan tambak dan kondisi
benur, terutama pada waktu penebaran benur dilakukan. Selain itu terdapatnya predator di tambak juga sangat
mengancam kelangsungan hidup udang.(anonim, 2007) Maka sebelum ditebar kualitas air di tambak harus
diperhatikan, diusahakan kondisi perairan tambak hampir sama dengan kondisi air pada bak pembenihan benur
tersebut.Sertasebelumbenurditebar,hamapredatormaupunkompetitorharusdibasmi.
Pertumbuhan udang merupakan proses pertambahan panjang dan berat yang terjadi secara bertahap, dimana
prosesinisangatdipengaruhi oleh frekwensi ganti kulit (moulting). Moultingakanterjadisecarateraturpadaudang
yangsehat.Bobotudangakanbertambahsetiapkalimengalamimoulting.Moultingdapatterjadisecaramasal,yang
dipengaruhi oleh kondisi lingkungan yang berubah secara tibatiba, seperti terjadinya pasang surut, pergantian air
maupun jika terjadi perubahan suhu secara mendadak. Kualitas dan kuantitas pakan yang diberikan juga sangat
mempengaruhipertumbuhanudang.Udangakantumbuhjikapakanyangdikonsumsimelebihiyangdibutuhkanuntuk
mempertahankanhidupdanpakantersebutharusmemilikikandunganproteinyangtinggi(minimal35%).Kualitasair
tambakyangbaikakanmendukungperkembangandanpertumbuhanudangvannameisecaraoptimal.(anonim,2007)
Olehkarenaitukualitasairharusdimonitorsecaraberkala.
2.6PemilihanLokasiBudidaya

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

2/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

MenurutBuwono(2001),halyangperludipertimbangkandalammenetapkanlokasiarealpertambakanadalah
jaringan pendukung dan penunjang usaha pertambakan. Areal pertambakan hendaknya juga telah dirintis pendirian
pabrikpakanudang,usahapembenihanatauhatchery,coldstorage(sebagaipenampunghasilpascapanenudang)dan
saranatransportasisepertidekatdenganpelabuhanlaut.
MenurutBuwono(2001),persyaratanlokasitambakudangvanamesecarateknissebagaiberikut:
1.Terletakdidaerahpantaidenganfluktuasiairpasangdansurut.
2. Jenis tanah sebaiknya liat berpasir untuk menghindari kebocoran. Jenis tanah gambut atau masam biasanya
menyebabkanairmenjadiasam.
3. Mempunyai sumber air tawar dengan debit atau kapasitas cukup besar sehingga kebutuhan air tawar cukup
terpenuhi. Minimal 15 % air tambak harus terganti dengan air baru setiap hari. Udang vaname tumbuh optimal
padasalinitas1520ppt.
Lokasitambakharusmemilikigreenbeltyangberupahutangbakauyangterletakdiantaralokasitambakdanpantai.
2.7KonstruksiTambak
Halhalyangperludiperhatikandalampembuatantambakdilihatdarisegikonstruksinya.Konstruksitambak
merupakan faktor penting karena kesalahan dan ketidak sempurnaan konstruksi tambak akan berdampak besar bagi
pemeliharaan, investasi, bahkan keberhasilan usaha sendiri. Konstruksi tersebut diantaranya pematang, saluran
pemasukanairdansaluranpembuangan.Perangutamadaripematangyaitumemisahkanataumenahanairdarisatu
petakantambakdenganpetakantambakyanglain(Amri,2008).
2.8PemilihanBenihdanPenebaran
Benurmerupakanfaktorutamadalampenentuankeberhasilan.Olehkarenaitu,agardalambudidayatingkat
keberhasilannyatinggimakaharusdigunakanbenuryangberkualitasbaik(Suprapto,2005).
MenurutArifindkk.(2009),penebaranbenurdilakukanpadapagiharipadasaatsuhumasihrendah,dengan
tujuan untuk mengurangi stress akibat pemanenan, transportasi ataupun akibat dari perlakuan dengan formalin.
Penebarandilakukansecaraperlahanlahanataumelaluiprosesadaptasiterhadapsuhudansalinitas.
2.9Pemeliharaan
2.8.1.PengelolaanKualitasAirTambak
Menurut Sulistinarto (2008), dalam budidaya udang ditambak, dinamika kualitas air merupakan faktor yang
pentinguntukdijagamengingatbahwaairmerupakanmediahidupsekaligussebagaihabitatpenyediamakananalami
serta sebagai tempat terkumpulkannya limba sisasisa metabolisme dan sisa pakan. Beberapa parameter kualitas air
yangperludiperhatikansertadimonitoringuntukmengetahuidinamikanyaadalahoksigenterlarut,salinitas,pH,suhu,
alkalinitas,amoniak,nitrit,phosphatdanplankton.
a.Oksigen
Oksigen terlarut merupakan farameter utama kualitas air yang sangat berpengaruh terhadap pertumbuhan dan
kelangsungan hidup udang. Pengaruh langsung oksigen adalah efektifitas penggunaan pakan serta prosesproses
metabolismudangdansecaratidaklangsungberpengaruhterhadapkondisikualitasair.Tujuanpengukuraniiniadalah
untuk mengetahui perkembangan akan ketersediaan aksigen didalam air. Pengukuran dilakukan didasar tambak
denganmenggunakanalatoksigenmeter.(Sulistinarto,2008)
b.Salinitas
Menurut Sulistinarto (2008), salinitas merupakan parameter air yang penting bagi udang meskipun
pengaruhnyatidakspontansepertihalnyaoksigen.Udangdapathiduppadasalinitasairantara540ppt.Salinitasyang
optimal untuk pertumbuhan udang adalah 1525 ppt. Meskipun udang merupakan biota euryhaline namun
pertumbuhannya akan terlambat apabila dipelihara pada salinitas lebih rendah atau lebih tinggi dari kadar optimal
dalamwaktuyanglama.Pengukuransalinitasairdilakukansatukalisehariyaitupadasiangharibersamaandengan
pengukuranoksigen(sianghari)denganmenggunakanrefraktometer.

c.DerajatKeasaman(pH)
DerajatKeasaman(pH)merupakanparameterairuntukmengetahuitingkatkeasamanairtambak.pHidealair
tambakberkisar7,58,5.UmumnyaperubahanpHairdipengaruhiolehsifattanahnya.(HalimandanDian,2005)
MenurutSulistinarto (2008), dinamika pH air berpengaruh nyata terhadap nafsu makan udang dan pelarutan
unsurunsurhara.pHairyangterlalutinggiatauterlalurendahdaripHoptimumakanmempersulitpelarutanbeberapa
unsurharapentinguntukphytoplankton.
d.Suhuair
Menurut Sulistinarto (2008), sama halnya dengan pH air, suhu air juga berpengaruh terhadap cepat atau
lambatnya reaksi kimiawi air. Suhu optimum bagi udang adalah 2632 oC. Suhu air diukur dengan menggunakan
termometer air raksa dan diukur 2 kali sehari bersamaan dengan pengukuran oksigen. Suhu air tambak tergantung
cuaca dan berpengaruh langsung terhadap nafsu makan. pada suhu 26oC nafsu makan turun hingga 50 %. Suhu air
terutama pada bagian dasar juga dipengaruhi oleh kepadatan partikel yang dapat diukur dari tingkat kecerahan air
denganalatsecchidisk.Kepadatanpartikeldalamairtermasukplanktonakanmenghalangipenetrasicahayamasukke
dalamair.
e.Amoniak
http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

3/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

MenurutSulistinarto(2008),amoniamerupakanhasilekskresiataupengeluarankotoranudangyangberbentuk
gas.Selainitu,amoniabisaberasaldarisisapakanyangtidaktermakanolehudangvanamesehinggalarutdalamair.
Amoniaakanmengalamiprosesnitrifikasidandenitrifikasisesuaidengansiklusnitrogendalamairsehinggamenjadi
nitrit(NO2)dannitrat(NO3)(Amri,2006).
f.Nitrit(NO2)
Senyawainijugamerupakanhasilsampingandariprosesperombakanbahanorganik.Dalamkondisinormal,
konsentrasinitritsangatjarangmencapaikonsentrasimematikanudang.Bilakadaroksigendalamairtinggi,senyawa
ini akanteroksidasi menjadi nitrat (NO3)yangdapatdimanfaatkanolehphytoplanktonsebagainutrien.Senyawaini
diukur sebagai salah satu indikator kesuburan tambak. Kekurangan unsur N ini dapat disuplai dengan pemupukan
(Urea).Samahalnyadengansenyawaamoniak,pengukuransenyawainimenggunakanspectrofotometeratautestnitrit
kitair(Sulistinarto,2008).
2.8.2.MenejemenPakan
Menurut Haliman dan Dian (2005), pakan merupakan sumber protein, lemak, karbohidrat, vitamin, dan
mineral.Pakanjugamerupakanfaktoryangsangatpentingdalambudidayaudangvanamekarenamenyerap6070%
dari total biaya operasional. Kebutuhan pakan yang diberikan sesuai dengan kebutuhannya dan akan memacu
pertumbuhandanperkembanganudangvanamesecaraoptimalsehinggaproduksinyabisaditingkatkan.
a.PemberianPakan
Pemberianpakanbuatandapatmulaidilakukansejakbenurditebarhinggaudangsiappanen.Namunukuran
dan jumlah pakan yang diberikan harus dilakukan secara cermat dan tepat sehingga udang tidak mengalami
kekurangan pakan (underfeeding) atau kelebihan pakan (overfeeding). Underfeeding dapat meenyebabkan
pertumbuhanudangmenjadilambat,ukuranudangtidakseragam,tubuhtampakkeropos,dantimbulsifatkanibalisme.
Sedangkanoverfeedingdapatmenyebabkankualitasairmenjadijelek.(Suprapto,2005)
b.FrekuensiPemberianPakan
Menurut Suprapto (2005), seperti udang pada umumnya, vaname bersifat nokturnal atau aktif makan pada
malam hari. Frekuensi pemberian pakan dapat diperkirakan dengan memperhitungkan sifat tersebut untuk
mendapatkannilaifeedconvertionratio(FCR)ataunilaikonversiyangideal.Pakanyangdikonsumsisecaranormal
akan diproses selama 34 jam setelah pakan tersebut dikonsumsi, kemudian sisanya akan dibuang sebagai kotoran.
Dengan pertimbangaan sifat biologis tersebut, pemberian pakan dapat dilakukan dengan interval tertentu. Frekuensi
pemberian pakan pada udang kecil cukup 23 kali sehari karena masih mengandalkan pakan alami. Setelah terbiasa
denganpakanbuatanberbentukpellet,frekuensipemberianpakandapatditambahmenjadi46kalisehari.
c.Anco
Ancoadalahsejenisjaringyangberbentukbujursangkarataulingkaranyangdipasanghinggakedalaman1020
cmdaridasarperairandanditempatkanpadabeberapatempatdipetakantambak.Ancomerupakanalatbantuuntuk
memantaudanmendugakebutuhanpakansecaraakurat(Suprapto,2005).
2.8.3.HamadanPenyakit
MenurutHalimandanDian(2005),hamadapatdibedakanmenjaditigagolonganyaknipredator(pemangsa),
competitor (penyaing) dan penggangu. Selanjutnya menjelaskan bahwa gangguan terhadap udang dapat disebabkan
olehorganismelain,pakanmaupunkondisilingkunganyangkurangmenunjang,sehinggaakanmenimbulkanserangan
penyakit. Serangan penyakit pada udang dapat disebabkan oleh interaksi yang tidak serasi antara udang, kondisi
lingkungandanorganismpenyakit.
Menurut Haliman dan Dian (2005), jenis jenis predator, parasit, jamur dan virus yang sering menyerang
udangvannamesebagaiberikut:
a.Predator
Predator adalah segala jenis hewan yang dapat memangsa udang vanname yang dipelihara dalam petakan
tambaksepertiikankakap,ikanmujair,ikankerongkerongdanlainlain.
b.Parasit
Parasitmudahmenyerangudangvannamebilakualitasairtambakkurangbaik,terutamapadakondisikandungan
bahanorganikyangtinggi.Parasitbiasanyamenempelpadainsang,kakirenang,dankakijalan.
c.BakteridanJamur
Bakteri dan jamur tumbuh optimal di perairan yang mengandung bahan organik yang tinggi (sekitar 50 ppm).
Bakteri yang perlu diwaspadai dalam budidaya udang vanname yaitu bakteri vibrio yang menyebabkan penyakit
vibriosis.Lebihlanjutmenjelaskanbahwa
Jamur(cendawan)seringdijumpaipadaudangsakit.Infeksicendawanlebihseringmenyerangtubuhudangbagian
luar,seperticarapaksdaninsangbagiandalam,terutamastomack.Umumnyajamuryangmenyerangsebagaiinfeksi
sekunderdariseranganutamaolehbakteriataupatogenlain,sepertivirus.
d.Virus
Virus merupakan ancaman yang serius karena dapat menyebabkan kematian udang secara massal dalam waktu
yangsingkat.Beberapavirusyangperludiwaspadaipadabudidayaudangvannameyaituwhitespotsyndromevirus
(WSSV),Taurasyndromevirus(TSV)danInfectionhypodermalhematopoeticnecrosisvirus(IHHNV).(Halimandan
Dian,2005)
http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

4/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

2.10.MonitoringdanSampling
Menurut Departemen Kelautan dan Perikanan (2006), pada masa pemeliharaan udang vaname dilakukan
pengamatan dan monitoring mengenai kondisi dan kesehatan selama masa pemeliharaan di tambak. Selanjutnya
menjelaskan bahwa sampling dilakukan pada saat udang vaname berumur 30 hari dan alat yang paling baik untuk
sampling dengan menggunakan jala lempar. Waktu sampling udang sebaiknya dilakukan pada pagi atau sore hari,
mengingatpadawaktutersebutudanglebihaktifdanmeratapenyebarannya.
2.11.PanendanPascaPanen
Menurut Haliman dan Dian (2005), panen merupakan akhir suatu periode budidaya udang vaname yang
ditunggutunggu oleh petambak. Udang vaname dapat dipanen setelah berumur sekitar 120 hari dengan berat tubuh
berkisar 1620 gram/ekor. Selanjutnya menyatakan bahwa pasca panen bertujuan untuk menjamin mutu udang tetap
tinggidenganpertimbanganbeberapapaktor,sepertiudangtidakmembahayakankesehatankonsumenkarenaudang
termasuk produk makanan yang mudah rusak (busuk). Oleh karena itu, sejak dari panen hingga pasca panen harus
dalamkondisidingin.
III.METODOLOGI
3.1.WaktudanTempat
Kegiatan Pengalaman Kerja Praktek Mahasiswa yang rencananya akan dilaksanakan pada bulan Februari
sampaibulanApril2015,diPT.EsaputliPrakarsaUtama,Barru,SulawesiSelatan.

3.2.MetodePengambilanData
Metode yang dipakai dalam praktek kerja lapang ini adalah metode deskriptif. Metode deskriptif merupakan
metodepenelitianyangberusahamenggambarkandanmenginterpretasiobjeksesuaidenganapaadanya(Soehardjan,
M.1994).Deskriptifpadaumumnyadilakukandengantujuanutama,yaitumenggambarkansecarasistematisfaktadan
karakteristik objek dan subjek yang diteliti secara tepat. Dalam perkembangan akhirakhir ini, metode penelitian
deskriptif juga banyak di lakukan oleh para penelitian karena dua alasan. Pertama, dari pengamatan empiris didapat
bahwasebagianbesarlaporanpenelitiandilakukandalambentukdeskriptif.Kedua,metodedeskriptifsangatberguna
untukmendapatkanvariasipermasalahanyangberkaitandenganbidangpendidikanmaupuntingkahlakumanusia.
3.2.1.DataPrimer
Data primer, yaitu data yang diperoleh langsung dari lapangan melalui wawancara dengan responden
menggunakankuisionerdanpengamatan(observasi)langsungdilapangan.
3.2.1.DataSekunder
Data sekunder didapatkan dan disusun berdasarkan hasil wawancara dengan pembimbing lapangan (Teknisi),
dosen pembimbing serta berbagai literatur pendukung yang berkaitan dengan tugas akhir ini melalui penelusuran
pustaka.

3.2.2.AnalisaData
a.ABW(AverageBodyWeight)
ABWadalahBeratratarataudang/ekor.
Rumus=Berattimbanganudang(Gram):Jumlahudang(ekor)

b.ADG(AverageDailyGain)
ADGadalahPertambahanberatharian.
Rumus=ABWII(Gram)ABWI(Gram):Periodesampling(Hari)
c.SR(SurvivalRate)
SRadalahTingkatkelangsunganhidup.
Rumus=(Jumlahudangyanghidup:Jumlahtebar)100%.
d.Biomassa
BiomassaadalahJumlahtotalberatudangyangadaditambak(kg)
Rumus=Pakanperhari(kg)x100%FR
e.FR(FeedingRate)
FRadalahPersentasepakanudangperHari
Rumus=Pakanperhari(kg)x100Biomassa(kg)
g.FCR(FeedConvertionRatio)
FCRadalahPerbandinganantarajumlahpakanyangdigunakandenganberatudangyangdihasilkan.
Rumus=Jumlahpakanyanghabis(Kg):Biomassaudang(kg).
h.Populasi

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

5/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME
LebarJala
Populasi=
Jumlahudang
XLuasLahan

3.3.MetodeKerja
3.1.1.AlatdanBahan
Tabel1.Alatdanbahanyangdigunakanselamaprosesbudidayaudangvaname.
No

AlatDanBahan

Kegunaan

Alat
1.

Tambak

Sebagaiwadahbudidaya

2.

JalaLempar

3.

Kincir

4.

Ember

5.

Anco

6.

DoMeter

7.

pHmeter

8.

Handrepraktometer

Digunakandalampengambilansampling
Digunakanuntukmengsuplaioksigen
Sebagaitempatpakan
Digunakanuntukmengontrolpakan
Digunakanuntukmengukuroksigenterlarutdansuhu
DigunakanuntukmengukurpHair
Digunakanuntukmengukursalinitas

9.

Timbangan

10

Aerator

Digunakanuntukpengaktifanprobiotik

11

Gayung

Digunakanuntukmengambilpakan

12

Keranjang/Basket

13

Pompa

Digunakanuntukpengisiandanpengeluaranair

14

Genset

Sumbertenagalistrik

Digunakanuntukmenimbangpakan

Digunakanuntuktempatudang

Bahan

UdangVaname

Organismeyangdibudidayakan

Probiotik

Untukmenguraikanbahanorganikpadatambak

PakanBuatan

Sebagaipakanudangdalamprosespemeliharaan

AirTawar

AirLaut

Biofit

Suplemenuntukpertumbuhanudang

Efikor

Molase

Sebagaibahanprebiotikyangdidormankandungan
bakteribacillus
Sebagaibahanprebiotikuntukpenumbuhanbakteri
yangdikultur

Untukmembersihkanalatalatyangtelahdigunakan
Sebagaimediabudidaya

4.1ProsedurKerja
4.1.1PersiapanLahan
1.PerbaikanPematang
Alatdanbahandisiapkan
Pematang yang bocor digali terlebih dahulu dengan menggunakan saplak, kemudian ditambal dengan
menggunakanlumpurdancampurantanahyangkeras.
2.PencucianDasarTambak
Alatdanbahandisiapkan
Pintupengeluaranairditutupdenganrapatdanpintupemasukanairdibuka
Tambakdiisiairsampaisetinggi50cm,lalupintupemasukanditutup
Air dalam tambak dibiarkan 12 hari dan pintu pengeluaran dibuka untuk membuang semua air yang ada
dalamtambak
3.Pengeringan
Pintupengeluaranairdibukasampaiairyangterdapatdalampetakantambakhabisterkuraskeluar,proses
pengeringandibantuolehcahayamatahari.
Pengeringandilakukansampaitanahdasartambakbetulbetulkeringdantidakadalagiairdalampetakan
atausampaitanahdasartambakretakretak.
4.PemberantasanHama
Alatdanbahandisiapkan
Saponin(bungkilbijiteh)dimasukkankedalambaskom,kemudiandirendamairselamakuranglebih4jam
Saponinditebarsecarameratapadapetakantambak
5.Pengapuran
Alatdanbahandisiapkan
Kapurdolomitdimasukkankedalamember

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

6/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

Kapurditebarsecarameratapadapetakantambakdanbagiankemiringanpematangdenganmengikutiarah
angin.
6.Pemupukan
Alatdanbahandisiapkan
SemuajenispupukdimasukkankedalambaskomyaitupupukNPKdengandosis5ppm,formulasiureadan
TSPmasingmasingdengandosis35ppmdan23ppm,Kemudianaduksecaramerata.
Pupukditebarsecarameratapadapetakantambak.
7.PengisianAir
Pintupengeluaranditutupdenganrapat
Pintu pemasukan air dibuka sampai air yang masuk ke dalam petak tambak mencapai 120150 cm.
Kemudianpintupemasukanairditutup.
8.PenumbuhanPakanAlami
a.PembuatanPermentasi
Alatdanbahandisiapkan
Semuabahanditimbangsesuaitakaran,kemudianmasukkansemuabahankedalambakfiber
Airlautdimasukkansecaraperlahanlahandenganmenggunakanember,berikanaerasiagarfermentasi
tersebutcepatbereaksi
Fermentasidibiarkanselama6jam
Hasilfermentasimenunjukkanwarnakuningkecoklatandanmengeluarkanbaukecut.
Fermentasisiapditebarpadapetakantambak
9.PemasanganJembatanPakanDanAnco
Jembatan yang terbuat dari papan dipasang pada bagian atas penyangga, kemudian jembatan dipaku pada
balokpenyangga.
Ancoyangtelahdibuatdiikatpadabagianujungjembatan.
10.PemasanganKincir
Kincirditurungkankedalampetakantambaksatupersatu
Jarakantarakincirdenganpematangadalah7meter
Kincirdipasangdengansearahjarumjam
Kabellistrikdipasangpadasakelardandisanbungkandengankincir.
4.1.2PemilihanBenurDanPenebaran
1.Benuryangdipilihadalahbenuryangberkualitasdenganukuranyangseragam,minimal(PL12),gerakan
lincah,tahanterhadapparasit,warnatubuhseragamdannecrosistidakada.
2. Kantong benur diambil dan diapungapungkan di atas air tambak 30 menit sampai suhu air tambak
dengansuhuairyangadapadakantongbenurkuranglebihsama.
3. Kantongtersebutdibukadandiisiairtambaksecaraperlahanlahansecaraterusmenerussampaisalinitas
airdalamkantongkuranglebihsamadengansalinitasairtambak.
4. Apabila benur telah beradaptasi, benur dilepaskan dengan cara memiringkan kantong dan membiarkan
benurkeluardengansendirinya.
5.Setelahsemuabenurditebarmakakincirdioperasikan
6.Penebarandilakukanpadapagiatausorehari

4.1.3Pemeliharaan
1.ManajemenKualitasAir
a.PergantianAir
Pintupengeluaranairdibukauntukmengeluarkansejumlahairsesuairencanapenggantian
Pintupengeluaranditutprapat
Pintupemasukanairdibukauntukmengalirkansejumlahairkepetakantambaksesuairencanapenggantian
Pintupemasukanairditutuprapat
b.PengukuranKualitasAir
Alatdanbahandisiapkan
Kecerahan air diukur dengan menggunakan secchi disk dengan cara menurungkan ke dalam air secara
perlahanlahansampaibundaranwarnaputihtidakkelihatan.Kemudiancatatskalayangterterapadatiang
secchidisktersebut.
DodansuhudiukurdenganDOmeterdiaktifkandenganmenekantombolON.Bagiansensordimasukkan
kedalamairpetakan10cmdaridasartambak,kemudianangkayangterterapadaDOmeterdicatat.
pHdiukurdengancarapHmeterdiaktifkandenganmenekantombolON.SensorpHyangadapadaujung
pH meter dicelupkan pada permukaan air petakan, kemudian angka yang tertera pada layar pH meter
dicatat.

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

7/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

Salinitas diukur dengan cara bagian sensor Handrefraktometer berupa layar ditetesi air tambak kemudian
ditutup.NilaipadalayarHandrefraktometerdapatdilihatdibawahsinarmatahari,kemudianhasilnyadicatat
2.ManajemenPakan
1.Pemberianpakan
Alatdanbahandisiapkan
Pakanditimbangsesuaidosis
Pakanyangtelahditimbangdimasukkankedalamemberyangtelahdisediakan
Pakanditebarsecarameratasearahdenganjarumjam
2.PemberianPakandanKontrolPadaAnco
Alatdanbahandisiapkan
1%daripakandiambildarisetiappemberianpakan,kemudiandimasukkankedalamanco.
Ancoditurungkankedalampetakantambaksecaraperlahanlahanagarpakanyangadadidalamancotidak
terhambur.
Ancodikontrolsesuaidenganjamkontrolyangtelahditentukandandiangkatsecaraperlahanlahan
Anco diangkat 10 cm dari bawah permukaan air, kemudian perhatikan kondisi pakan dan kondisi udang
yangadapadaanco
Ancoyangtelahdiangkatdibersihkandandiletakkanpadajembatanfeeding.
3.Sampling
Alatdanbahandisiapkan
Titiksamplingditentukan
Jalayangdilemparkedalampetakan,diusahakanselebarmungkin.
Jaladitarikdanudangyangtertangkapdiambillaludimasukkankedalamember
Udangyangadadalamemberditimbangdandicatatberatnya.
Samplingdilakukanpadapagihari.
4.1.4PanendanPascaPanen
1.Panen
Alatdanbahandisisapkan
Airpetakandikeluarkankuranglebih50%sebelumpanendimulai.
Jaring kondom dipasang pada bagian pintu pengeluaran air dengan rapat lalu filter pintu pengeluaran di
bukasecaraperlahanlahandandilakukanpengeluaranairsampaiudanghampirhabisterikutaliranairdan
masukkejarringkondom
Udang yang masih tersisa pada petakan tambak ditangkap dengan menggunakan tangan dan selanjutnya
digabungdenganudangyangditangkapdenganjariingkondom.
Udang yang masuk ke dalam jaring kondom dimasukkan kedalam basket sampai penuh dan udang yang
belumsempattersaringditangkapdenganmenggunakanseser.
Basketpenuhdiangkutdenganmenggunakantrolimenujuprosesing.
2.PacsaPanen
Alatdanbahandisiapkan
Udanghasilpanenditimbangdandicatat
Setelahditimbangudangtersebutdibilasdenganmenggunakanairtawar
Udang yang telah dibilas, dimasukkan ke dalam basket lalu disortir dan diberikan kepada pembeli untuk
diolahlebihlanjut.

3.4JadwalPelaksanaanKegiatan
Jadwal Kegiatan Pengalaman Kerja Praktik Mahasiswa (PKPM) pada pembesaran Udang Vannamei di
tambaksupraintensifPT.EsaputliPrakarsaUtama,Barru.
Tabel.2JadwalpelaksanaankegiatanPenagalamanPraktikKerjaMahasiswa(PKPM).
Bulan
No

Kegiatan

Penyusunan

Januri

Februari

Maret

April

Mei

Proposal
2

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

8/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

Pelaksanaan
Praktek

Kerja

Lapangan
3

Konsultasi hasil

pakteklapangan
4

Penyusunan
laporan

BABIV
PENUTUP
Demikian usulan proposal ini kami ajukan untuk dijadikan sebagai acuan bahan pemikiran dalam kegiatan
PengalamanKerjaPraktekMahasiswadenganmengharappertimbangansertakerjasamayangsoliddemikesuksesan
dankelancaranPKPMini.
Akhirnya dengan berserah diri kepada Tuhan Yang Maha Esa yang melimpahkan Rahmat dan HidayahNya
kepadakitasemua,penulisakhiriusulanproposalPKPMini,mudahmudahanmampumemberikanmanfaatbagikita
semua,.Amin!
Billahitaufikwalhidayah
WassalamualaikumWrWb.
Mandalle,17Januari2015

DAFTARPUSTAKA
DepartemenKelautandanPerikanan,2006.PetunjukTeknisBudidayaUdangVnameSecaraIntensif.Jakarta
Matsudarmo, B dan B.S. Ranoemahardjo. 1980.Biologi Udang Penaeid. Direktorat Jenderal Perikanan Departemen
Pertanian.
StandarProsedurOperasionalPembesaranUdangVannamei.2007.DepartemenKelautandanPerikananDirektorat
JenderalPerikananBudidaya.
http://yaniberbagi.blogspot.com/2013/01/contohproposalprakteklapangan.html
Diaksespadatanggal27November2014
WibandanSweeny,1991.MorfologiUdangVanmae(Litopenaeusvannamei).DitjenPerikananDepartemenPertania,
Jakarta.
StandarProsedurOperasionalPembesaranUdangVannamei.2007.Departemen
KelautandanPerikananDirektoratJenderalPerikananBudidaya.
Arifin,dkk.,2009.TeknikProduksiUdangVname(Litopenaeusvannamei)SecaraSederhana,Jakarta
Buwono,D.W.,2001.TambakUdangWinduSistemPengelolaanBerpolaIntensif.Kanisius,Yogyakarta
Haliman,R.W,danDian,A.S.,2005.UdangVannamei.PenebarSwadaya,Jakarta.
Adijaya.D.S.danWidodoR.H.,2005.BudidayaUdangVannamei,Situbondo.
Boone.1931.Litopenaeusvannamei.http://www.itis.gov

Sulistinarto.D.,2008.ManajemenPemeliharaanBudidayaUdangBerwawasanLingkungan,BalaiBesarBudidayaAir
Payau,Jepara.
Amri.2008.BudidayaUdangVanamesecaraIntensif.SemiIntensifdanTradisional,RahasiaSuksesusahaperikanan
PT.Granmediapuatakautama.Jakarta
Briggs,dkk.2004.IntroductionsandMovementofPenaeusvannameiandPenaeusstylirostrisinAsiaandThePacific.
FAO.Bangkok
Suprapto,2005.PetunjukTeknisBudidayaUdangVannamei(Litopenaeusvannamei).BandarLampung.
Soehardjan,M.1994.Fungsidanstrukturartikeltinjauan(Reviewartikel).MakalahpadaseminarinternPuslitbangtri.
DiposkanolehIsmailFisherydi21.41

Rekomendasikan ini di Google

Tidakadakomentar:
http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

9/10

12/14/2016

AQUACULTURE:PERSIAPANLAHANBUDIDAYAUDANGVANAME

PoskanKomentar
MasukkankomentarAnda...

Berikomentarsebagai:

Publikasikan

Selectprofile...

Pratinjau

PostingLebihBaru

Beranda

PostingLama

Langganan:PoskanKomentar(Atom)

Ismail,Amd.Pi.TemplatePTKerenSekali.Gambartemplateoleh4x6.DiberdayakanolehBlogger.

http://ismailfishery.blogspot.co.id/2015/11/persiapanlahanbudidayaudangvaname.html

10/10