Anda di halaman 1dari 18

Anotao funcional de

protenas baseada em
sequncia e estrutura
Marcelo Querino Lima Afonso - Mestrando em
Bioinformtica

>Aluno14_AA
MSALVLHDDELDEECYRARLFLSLLGLKARIVAVDVVPGGLQDSPSFRAVSPAGLLPVLRIEGQEICGAGAVLLALAHKRGNWLP
DEPGAFAQVAHWLHFASGPLRPAIAARRASLFGGGEPDAALQRQGEAALRIMEDHMAHRRLDGGSWFVGDAPSVADIALFPSF
ALSRDWGVDHAFYPALRRWMRAVRTVPGFVGMSGIPEYA - 207AAs
Description

Max

Total Query

E value

Ident

Accession

score score cover


hypothetical protein [Gluconacetobacter diazotrophicus]

409

409

100%

1e-144

100%

WP_012227621.1

hypothetical protein [Gluconacetobacter diazotrophicus]

404

404

100%

2e-142

98%

WP_012554786.1

glutathione S-transferase [Rhizobium sp. AC44/96]

209

209

99%

1e-65

52%

WP_065692721.1

glutathione S-transferase [Agrobacterium vitis]

207

207

99%

1e-64

50%

WP_070165291.1

glutathione S-transferase [Agrobacterium vitis]

207

207

99%

1e-64

51%

WP_071206777.1

glutathione S-transferase [Rhizobium leguminosarum]

206

206

99%

3e-64

52%

WP_037060144.1

glutathione S-transferase [Bradyrhizobium elkanii]

206

206

99%

3e-64

53%

WP_028162669.1

glutathione S-transferase [Rhizobium sp. Root1203]

206

206

99%

4e-64

52%

WP_057471795.1

glutathione S-transferase [Agrobacterium vitis]

206

206

99%

5e-64

50%

WP_071584469.1

glutathione S-transferase [Agrobacterium vitis]

203

203

99%

5e-63

49%

WP_012653792.1

Nome: Putative G. diazotrophicus GST


Cdigo Acesso

Identidade

Similaridade

Gaps

Cobertura

WP_012227621.1

207/207(100%)

207/207(100%)

0/207(0%)

100%

WP_012554786.1

203/207(98%)

205/207(99%)

0/207(0%)

98%

WP_065692721.1

108/209(52%)

138/209(66%)

3/209(1%)

52%

WP_070165291.1

104/209(50%)

137/209(65%)

3/209(1%)

50%

WP_071206777.1

106/209(51%)

137/209(65%)

3/209(1%)

51%

WP_037060144.1

108/209(52%)

134/209(64%)

3/209(1%)

52%

WP_028162669.1

111/209(53%)

137/209(65%)

3/209(1%)

53%

WP_057471795.1

109/209(52%)

134/209(64%)

3/209(1%)

52%

137/209(65%)

3/209(1%)

50%

136/209(65%

3/209(1%)

49%

WP_071584469.1
WP_012653792.1

105/209(50%)
102/209(49%)

Glutationa transferases
Estas enzimas esto envolvidas em diversos processos de destoxificao
celulares tais como a reduo de molculas afetadas por radicais livres
decorrentes da respirao celular, a bioativao de compostos xenobiticos para
a formao de produtos de menor toxicidade que podem ser excretados.
Os dois tpicos domnios dessas protenas so encontrados em nossa sequncia.
Seu domnio N-terminal (enovelamento do tipo Tioredoxina) interage com uma
molcula de Glutationa enquanto um substrato hidrofbico se liga ao domnio
C-terminal cuja estrutura secundria descrita como completamente composta
por alpha hlices .

Uniprot
Entry

Entry name

A9H0N0

A9H0N0_GLUDA

Protein names

Uncharacterized
protein

Gene
names

Length
Organism

GDI3206 Gluconacetobacter
diazotrophicus (strain
ATCC 49037 / DSM
5601 / PAl5)

207

PSIPRED
Predio confirmou topologia esperada da
reviso bibliogrfica: No domnio N-terminal
(Resduos 6-82 ), vemos uma topologia do tipo
j anteriormente descrita. O domnio
C-terminal (resduos 92-191) apresenta um
conjunto de cinco -helices tambm j
caracterizado para esta famlia de protenas

Metacyc, BRENDA, KEGG, COG


Metacyc: Buscas no Metacyc pelo nome completo do gene (WP_012227621.1) ou cdigo Uniprot da
protena (A9H0N0) no exibiram nenhum resultado. No existem tambm vias metablicas curadas ou
conhecidas
para
o
gnero
Gluconacetobacter
Uma busca no BRENDA pelo cdigo Uniprot no retornou Hits para a mesma. Porm uma busca por
Glutathione-S-Transferase resultou no E.C 2.5.1.1. Quatro vias metablicas foram descritas como
relacionadas a este nmero E.C. pelo BRENDA.
A anlise desse E.C pelo KEGG evidencia sua importncia no metabolismo de Glutationa,
particularmente na via de produo do cido Mercaptrico, e no metabolismo de drogas e xenobiticos
por enzimas do citocromo P450.
No Uniprot, o grupo COG dessa protena o COG0625, descrito no eggNOG 4.5 como um grupo de
Glutathione S Transferases de 894 espcies diferentes e tambm o grupo exclusivo de 131 espcies de
Bactrias ENOG4108RYS.

Existem pelo menos quatro classes distintas de GSTs bacterianas (beta, chi, theta e zeta)
que tambm exibem funes de desintoxicao tais como as GSTs presentes em
Eucariotos.
So envolvidas em:
- Proteo contra o estresse oxidativo, na desintoxicao de agentes antimicrobianos
(especialmente antibiticos).
- Metabolismo basal e no suprimento de fontes de carbonos a clulas bacterianas
(incluindo a quebra de lignina e a utilizao de isopreno).
- Degradao de compostos monocclicos aromticos (tolueno, xilenos, fenois, e
atrazina) e de hidrocarbonetos aromticos policclicos
Buscas no banco de dados eggNOG 4.0 pelo cdigo Uniprot resultaram no grupo
aproNOG09855 contendo 15 protenas de 17 espcies diferentes. Interessantemente, neste
ltimo podemos ver a presena marcante de outras bactrias fixadoras de nitrognio tais
como as dos gneros: Agrobacterium, Gluconacetobacter, Rhodospirillum, Rhizobium,
Sinorhizobium, Novosphingobium e Methylobacterium.

SCOP, BLAST-SCOP
A busca no banco de dados SCOP por "uniprot=A9H0N0" no obteve nenhum
resultado para esta sequncia. Um blastp utilizando a sequncia desta protena
atravs do site: http://phosphatome.net/2.0/blast-scop/ no foi capaz de obter
bons alinhamentos com as protenas do banco de dados. O melhor hit de outra
GST (Class zeta GST Homo sapiens) possui E-valor de 0.022, Identidade em
21/66 resduos (31%), 39/66 resduos positivos (59%), e 1 gap em 66 posies
(1%).

Localization Scores:
Cytoplasmic
2.00
CytoplasmicMembrane 2.00
Periplasmic
2.00
OuterMembrane
2.00
Extracellular
2.00
Final Prediction:
Unknown
-----------------------PSORTb

Duas
GMP
sintases
(inferidas por redes gnicas
de
co-expresso;
score
0.757), duas subunidades
beta da fenilalanil-tRNA
sintase
(inferidas
experimentalmente;
score
0.678), trs outras GSTs e
duas protenas que contm
domnios
GST
(todas
determinadas
por
co-ocorrncia gnica; scores
0.729, 0.659, 0.646; e
scores 0.661. 0.650).

Description

Max Total Query E value Ident Accessio


score score cover
n

Res.

Chain A, Crystal Structure Of Glutathione


S-Transferase From Pseudomonas Fluorescens [pf-5]

84.7

84.7

88%

4e-20

31% 3M3M_A

1.75A

Chain A, Crystal Structure Of A Possible Gutathione


S-Tranferase From Rhodopseudomonas Palustris

72.8

72.8

98%

1e-15

30% 3M8N_A

2.04A

Chain A, Crystal Structure Of Glutathione


S-Transferase Xaut_3756 (Target Efi- 507152) From
Xanthobacter Autotrophicus Py2

67.4

67.4

88%

1e-13

32% 4HZ2_A

1.5A

Chain A, Crystal Structure Of A Glutathione


Transferase Family Member From Xenorhabdus
Nematophila, Target Efi-507418, With Two Gsh Per
Subunit

66.2

66.2

86%

4e-13

25% 4L8E_A

1.7A

Chain A, Crystal Structure Of A Glutathione


Transferase Family Member From Salmonella
Enterica Ty2, Target Efi-507262, With Bound
Glutathione

50.4

50.4

79%

2e-07

26% 4KH7_A

1.5A

Modelo

RMS
modelo 6

RMS
molde

SWISS

0.268

MHOnl

Ramachandran
R4

DOPE SCORE

GA341

-25089.498047

1.00000

R1

R2

R4-AAs

0.183

93.7%

4.3%

2.0% E62, P85, R113

0.449

0.321

93.2%

6.3%

0.5% R80

-21277.2344

1.00000

0.281

95.1%

3.4%

1.5% P36, S46, R113

-22424.87891

1.00000

0.237

96.6%

1.0%

2.4% R113, G119, G120, H143,


R144

-22105.44922

1.00000

0.335

94.6%

3.9%

1.5% R113, R128, Q129

-21941.46680

1.00000

0.261

94.1%

4.9%

1.0% G119,D177

-21994.42383

1.00000

0.296

94.1%

3.4%

2.4% D86, R113, H143, R144,


G148

-22405.14648

1.00000

0.242

95.6%

3.9%

0.5% R113

-22322.34961

1.00000

0.285

96.6%

1.0%

2.4% F117, A125, H143

-22397.67383

1.00000

3.40.30.10

1.20.1050.10