Anda di halaman 1dari 12

SATUAN ACARA PENYULUHAN

Pokok pembahasan

: Pemeliharaan kesehatan Bayi

Sasaran

: Ibu Ibu Yang Mempunyai Anak Bayi

Hari/tanggal

: Selasa , 1 september 2015

Tempat

Pelaksana

: Hammi Efrina Hasibuan

A. Tujuan
1. Tujuan intruksional umum
Setelah dilakukan penyuluhan mengenai Pemeliharaan Kesehatan Bayi
audiens diharapkan dapat mengerti dan memahami tentang Pemeliharaan
Kesehatan Bayi.
Tujuan intruksional khusus
Setelah dilakukan penyuluhan selama 20 menit diharapkan :
1. Audiens dapat mengetahui tentang Pemeliharaan Kesehatan Bayi
2. Audiens dapat mengetahui tentang tanda tanda bayi sehat
3. Audiens dapat mengenali tanda- tanda bahaya pada bayi
4. Audiens dapat mengetahui pentingnya Pemberian Vitamin A
1. Audiens dapat mengetahui pentingnya ASI EKSLUSIF
2. Audiens dapat mengetahui pentingnya IMUNISASI
B. Materi terlampir
C. Metode
Ceramah
Tanya jawab

D. Media
lefleat
Flip cart
TAHAP-TAHAP PENYULUHAN

No Waktu
1. Pembukaan

Kegiatan penyuluhan
5 1. Memberikan salam
1

Kegiatan peserta
1. Menjawab salam

2. Mendengarkan
menit

2. Perkenalan
3. Menjelaskan pada ibu

dan
memperhatikan

1. Menanyakan

kepada

audiens

tentang

pemelihara
2.

Penyajian10
menit

kesehatan

bayi
2. Menjelaskan
yang

1. Menjawab
pertanyaan

materi

penyuluh
2. Mendengarkan
3. Bertanya kepada

pada

penyuluh jika ada

terdapat

brosur

yang belum jelas

1. Meminta audiens untuk

3.

Evaluasi 3 menit

menjawab pertanyaan.
2. Memberikan
reward
dan membetulkan jika

1. Merespon dengan
baik

masih ada kekurangan.


4.

Penutup 2 menit

1. Menyimpulkan
2. Mengucapkan salam

1. Memperhatikan
2. Menjawab salam

BAB II
PEMBAHASAN
2.1 Definisi pemeliharaan kesehatan bayi
menurut kamus besar bahasa Indonesia pemiliharaan adalah rawat
dan jaga , sedangkan kesehatan menurut undang undang adalah keadaan
dimana seseorang sejahtera badan , jiwa dan social yang memungkinkan
seseorang hidup produktif secara social maupun ekonomis .
2

pemeliharaan kesahatan bayi adalah menjaga dan merawat sedini


mungkin kesehatan pada bayi agar terjangkau terhadap kelainan ataupun
resiko terbesar seperti cacat bahkan kematian pada bayi.
Dalam pemeliharaan kesehatan pada bayi

, bayi mendapatkan

pelayanan kesehatan dari bidan , dokter , perawat serta tenaga medis


lainnya yaitu :
a.
b.
c.
d.

pemberian vitamin A
Pelayanan imunisasi
Jika belum di suntik vitamin k1, minta petugas kesehatan
Pemeriksaan rutin/berkala terhadap bayi dan balita

2.2 Tanda tanda bayi sehat


a.
b.
c.
d.
e.
f.

Setelah lahir bayi segera menangis


Pernafasannya teratur
Warna kulit kemerahan, jika kuning itu tanda ada kelaianan
Minimal berat badan baru lahir yang sehat 2,5 Kg 4kg
Bayi menyusu dari payudara ibu dengan kuat
Bayi bergerak aktif

2.3 Tanda bahaya pada bayi


a. Tidak mau menyusui atau memuntahkan semua yg diminum itu di karenakan
bayi terinfeksi berat
b. Anak terlihat kejang-kejang
c. Nafas terlihat cepat dan sesak
d. Anak mengalami diare secara terus menerus
e. Bayi lemah dan bergerak hanya saat di pegang saja itu karenakan bayi sakit
berat.
f. Pusar kemerahan dan
Hal lain yang paling perlu diperhatikan tentang kondisi dan penyakit yang
serius dapat menyebabkan kematian pada bayi adalah:
Anak yang lahir dengan berat badan rendah atau kurang dari 2500
gram
terkena tetanus
3

ditemukan diare
serta adanya infeksi di daerah saluran pernafasan yang akut.
Secara umum bayi sehat akan segera menangis sesudah lahir, bila
tangisan tidak terdengar berarti ada kelainan. Adapun manfaat tangisan
pertama adalah untuk melonggarkan saluran pernafasan sehingga berjalan
dengan baik.
Biasanya anak baru lahir yang tidak menangis dokter atau bidan akan
melakukan tindakan resusitasi yang berguna untuk merangsang mereka
menangis. Caranya adalah dengan menepuk-nepuk kaki bayi baru lahir
tersebut sambil diberi stimulus dan juga menghisap lendir di tenggorokan
anak

2.4 Pemberian Kapsul Vitamin A


VitaminAadalahsalahsatuzatgizidarigolonganvitaminyangsangat
diperlukanolehtubuhyangbergunauntukkesehatanmata(agardapatmelihat
denganbaik)danuntukkesehatantubuhyaitumeningkatkandayatahantubuh,
jaringanepitel,untukmelawanpenyakitmisalnyacampak,diaredaninfeksilain.

Upayaperbaikangizimasyarakatdilakukanpadabeberapasasaranyang

diperkirakanbanyakmengalamikekuranganterhadapVitaminA,yangdilakukan
melalui pemberian kapsul vitamin A dosis tinggi pada bayi dan balita yang
diberikansebanyak2kalidalamsatutahun.(DepkesRI,2007)
VitaminAterdiridari2jenis:
KapsulvitaminAbiru(100.000IU)diberikanpadabayiyangberusia
611bulansatukalidalamsatutahun
Kapsul vitamin A merah ( 200.000 IU ) diberikan kepada balita
KekuranganvitaminAdisebutjugadenganxeroftalmia(matakering).
Hal ini dapat terjadi karena serapan vitamin A pada mata mengalami
pengurangan sehingga terjadi kekeringan pada selaput lendir atau
konjungtiva dan selaput bening ( kornea mata ).

Pemberian vitamin A termasuk dalam program Bina Gizi yang

dilaksanakan oleh Departemen Kesehatan setiap 6 bulan yaitu bulan


FebruaridanAgustus,anakanakbalitadiberikanvitaminAsecaragratis
dengan target pemberian 80 % dari seluruh balita. Dengan demikian
diharapkanbalitaakanterlindungidarikekuranganvitaminA terutama
bagibalitadarikeluargamenengahkebawah.

2.5 ASI EKSLUSIF


Air Susu Ibu (ASI) adalah suatu emulsi lemak dalam larutan protein,
laktosa dan garam-garam anorganik yang sekresi oleh kelenjar mamae ibu, yang
berguna sebagai makanan bagi bayinya. ASI eksklusif adalah pemberian ASI
tanpa makanan dan minuman tambahan lain pada bayi berumur nol sampai enam
bulan. Bahkan air putih tidak diberikan dalam tahap ASI eksklusif ini.
ASI dalam jumlah cukup merupakan makanan terbaik pada bayi dan dapat
memenuhi kebutuhan gizi bayi selama 6 bulan pertama. ASI merupakan makanan
alamiah yang pertama dan utama bagi bayi sehingga dapat mencapai tumbuh
kembang yang optimal. Pada tahun 2001 World Health Organization/Organisasi
Kesehatan Dunia menyatakan bahwa ASI eksklusif selama enam bulan pertama
hidup bayi adalah yang terbaik.
Kebaikan Asi dan Menyusui
ASI sebagai makanan bayi mempunyai kebaikan/sifat sebagai berikut:
a.

ASI merupakan makanan alamiah yang baik untuk bayi, praktis, ekonomis,
mudah dicerna untuk memiliki komposisi, zat gizi yang ideal sesuai dengan
kebutuhan dan kemampuan pencernaan bayi.

b. ASI mengadung laktosa yang lebih tinggi dibandingkan dengan susu buatan.
c. ASI mengandung zat pelindung (antibodi) yang dapat melindungi bayi selama
5-6 bulan pertamad.

ASI tidak mengandung beta-lactoglobulin yang dapat

menyebabkan alergi pada bayi.


e.

Proses pemberian ASI dapat menjalin hubungan psikologis antara ibu dan
bayi.
Selain memberikan kebaikan bagi bayi, menyusui dengan bayi juga dapat

memberikan keuntungan bagi ibu, yaitu:


5

a. Suatu rasa kebanggaan dari ibu, bahwa ia dapat memberikan kehidupan

kepada bayinya.
b. Hubungan yang lebih erat karena secara alamiah terjadi kontak kulit yang
erat, bagi perkembangan psikis dan emosional antara ibu dan anak.
c. Dengan menyusui bagi rahim ibu akan berkontraksi yang dapat
menyebabkan pengembalian keukuran sebelum hamil
d. Mempercepat berhentinya pendarahan post partum.
e. Dengan menyusui maka kesuburan ibu menjadi berkurang untuk beberpa

bulan (menjarangkan kehamilan)


f. Mengurangi kemungkinan kanker payudara pada masa yang akan datang.
g. Menambah panjang kembalinya kesuburan pasca melahirkan, sehingga
h. Memberi jarak antar anak yang lebih panjang alias menunda kehamilan
i.

berikutnya
Karena kembalinya

j.

membutuhkan zat besisebanyak ketika mengalami menstruasi


Ibu lebih cepat langsing. Penelitian membuktikan bahwa ibu menyusui

menstruasi

tertunda,

ibu

menyusui

tidak

enam bulan lebih langsing setengah kg dibanding ibu yang menyusui


empat bulan.

2.6 IMUNISASI
Imunisasi

adalah

upaya

pencegahan

penyakit

infeksi

dengan

menyuntikkan vaksin kepada anak sebelum anak terinfeksi .


Vaksin adlh bahan yg dipakai utk merangsang pembentukan zat anti yg
dimasukkan ke dlm tubuh,sprti vaksinBCG,DPT,campak,Hepatitis B dan polio
Tujuan imunisasi :
-Kebal terhadap penyakit
-Morbiditas dan mortalitas
-Mengurangi kecacatan
Penyakit yang dapat di cegah Imunisasi adalah :
1. Penyakit TBC

Penyakit TBC sangat menular dan menyerang semua umur. Banyak terdapat
pada masyarakat dengan ekonomi rendah, kurang gizi dan pada daerah
perumahan padat. Ditandai dengan:
a. Batuk lebih dari 2 minggu, dahak dapat bercampur darah.
b. Nafsu makan menurun, BB menurun.
c. Berkeringat malam tanpa aktifitas.
Tes Mantoux : untuk menguji apakah pernah terinfeksi kuman TBC.

2. Penyakit Difteri
Difteri merupakan penyakit menular, teutama menyerang anak kecil.
Ditandai dengan:
a. Leher bengkak, terbentuk selaput putih kelabu dikerongkongan dan
hidung sehingga menyumbat jalan napas.
b. Anak gelisah karena sesak napas yang makin berat.
c. Anak tekak dan amandel membengkak dan merah.
3. Penyakit Batuk Rejan / Batuk Seratus Hari
Batuk Rejan adalah penyakit menular yang menyerang anak-anak.
Ditandai dengan :
a. Diawali batuk pilek biasa yang berlangsung sekitar 7 - 14 hari. Kemudian
diikuti batuk hebat yaitu lebih keras dan menyambung terus 10 - 30 kali
disertai tarikan napas dan berbunyi, kemudian muntah, muka merah
sampai biru dan mata berair.
b. Batuk batuk berlangsung beberapa minggu kemudian berkurang. Penyakit
ini dapat menyebabkan radang apru-paru dan terjadi kerusakan otak
sehingga dapat menyebabkan kejang, pingsan sampai terjadi kematian.
4. Penyakit Tetanus

Penyakit Tetanus menyerang semua umur, yang menyebabkan masalah yang


cukup besar di Indonesia karena banayk bai yang baru lahir mati akibat penyakit
tersebut. Ditandai dengan :
a.
b.
c.
d.

Kejang / kaku seluruh tubuh.


Mulut kaku dan sukar dibuka, punggung kaku dan melengkung.
Kejang dirasakan sangat sakit.
Pada bayi yang baru lahir (5 - 28 hari) mendadak tidak dapat menetek
karena mulutnya kaku dan mencucu seperti mulut ikan.

5. Penyakit Polimielitis
Polimielitis sanagt cepat menular di daerah perumahan padat dan lingkungan
kumuh. Ditandai dengan:
a. Anak rewel, panas dan batuk, dua hari kemudian leher kaku, sakit kepala,
otot badan dan kaki terasa kaku.
b. Lumpuh anggota badan tetapi biasanya hanya satu sisi.
c. Penyakit ini dapat menyerang otot pernapasan dan otot menelan yang
dapat menyebabkan kematian.
6. Penyakit Campak
Penyakit ini sangat menular dan menyerang hampir semua bayi.Tanda- tanda
campak:
a. Badan panas, batuk, pilek, mata merah dan berair.
b. Mulut dan bibir kering serta merah.
c. Beberapa hari kemudian keluar bercak-bercak di kulit dimulai di belakang telinga,
leher muka, dahi dan seluruh tubuh.
d. Akibat lanjut dari penyakit ini adalah radang telinga sampai tuli,radang mata
sampai terjadi kebutaan, diare dan menyebabkan radang paru-paru serta radang
otak yang dapat menyebabkan kematian.
7. Hepatitis Virus B
Penyakit ini adalah penyakit menular yang menyerang semua umur. Tandatandanya:
a. Mual, muntah serta nafsu makan menurun.
b. Nyeri sendi, nyeri kepala dan badan panas.
8

Sasaran Imunisasi
1. Bayi 0 - 9 bulan untuk imunisasi BCG, polio, DPT, HB, dan campak.
2. Anak SD kelas I untuk imunisasi DT.
3. Calon pengantin dan ibu hamil untuk imunisasi TT.
Macam imunisasi :
- Imunisasi aktif
Ialah pemberian zat sbg antigen yg diharapkan akan trjd suatu
proses infeksi buatan.
-Imunisasi pasif
Ialah pemberian zat yh dihasilkan melalui suatu proses infeksi yg
digunakan utk mengatasi mikroba yg diduga masuk dlm tubuh yg
terinfeksi
Jenis Imunisasi
1. Imunisasi BCG
Imunisasi BCG (Bacicile Calmette Guerin) utk mencegah
terjadinya penyakit TBC yg berat sebab TBC yg primer atau ringan
dpt terjadi walaupun sudah dilakukan imunisasi BCG.Contohnya:
TBC pd selaput otak,TBC milier pd lapang paru,TBC tulang .
Vaksin BCG merupakan vaksin yg mengandung kuman
TBC yg dilemahkan,diberikan melalui intradermal dg dosis 0,05
ml

Efek samping imunisasi BCG yaitu terjadinya ulkus pd


daerah suntikan,reaksi panas .

REKOMENDASI :
-

Imunisasi BCG diberikan saat bayi berusia 2 bln


Jangan melakukan imunisasi pd bayi dg imunodefisiensi

(HIV,gizi buruk).
Pd bayi yg kontak erat dg penderita TB,diberi INH
profilaksis,jika kontak sdh tenang dpt diberi BCG

2. Imunisasi Hepatitis B
Penyakit Hepatitis B sering menyebabkan hepatitis kronik yg
dlm kurun waktu 10-20 th dpt berkembang menjadi hepatitis akut.
Penularan

penyakit

melalui:

hub.seksual,dari

ibu

kpd

bayinya,melalui alat2 kedokteran.


Imunisasi diberikan melalui intramuskular dg dosis 0,5 ml dan
dapat menimbulkan efek samping yg pd umumnya ringan,hanya
berupa nyeri,bengkak,panas,mual & nyeri sendi maupun otot.
3. Imunisasi POLIO
Imunisasi

polio

digunakan

utk

mencegah

terjadinya

penyakit poliomyelitis yg dpt menyebabkan kelumpuhan pd


anak.Kandungan vaksin adlh virus yg dilemahkan.
Imunisasi polio diberikan melalui oral bersamaan dg suntikan
vaksin DPT & hepatitis B.

10

Vaksin yg digunakan scr rutin sejak bayi lahir dg dosis 2


tetes oral yg menempatkan diri di usus & memacu pembentukan
antibodi baik dalam darah maupun pd epitelium usus yg
menghasilkan pertahanan lokal trhdp virus polio liar yg datang
masuk kemudian

4. Imunisasi DPT
Imunisasi DPT (diphteria,pertusis,tetanus) digunakan utk
mencegah terjadinya penyakit difteri,pertusis & tetanus.
Vaksin mengandung racun kuman difteri yg telah dihilangkan sifat
racunnya,namun msih dpt merangsang pembentukan zat anti (toksoid).
Imunisasi DPT diberikan melalui intramuskular dg dosis 0,5 ml & dpt
menimbulkan

efek

samping

pembengkakan,nyeri&demam.Efek

ringan,misal:

samping

trjdi

berat,misal:terjadi

menangis hebat,kesakitan 4 jam,kesadaran menurun,kejang & syok


5. Imunisasi CAMPAK
Imunisasi

campak

digunakan

mencegah

terjadinya

penyakit

campak.Vaksin ini adlh virus yg dilemahkan.


Imunisasi campak diberikan melalui subkutan walaupun dpt jg
diberikan scr intramuskular (dosis 0,5 ml) dg efek samping seperti
terjadinya ruam pd tempat suntikan & panas.
Cara Pemberian Imunisasi
Pemberian imunisasi dapat diberikan secara suntikan maupun diteteskan ke dalam
mulut.
1.
2.
3.
4.

BCG : dengan suntikan ke dalam kulit pada lengan atas sebelah dalam.
DPT : suntikan ke dalam otot di pangkal paha.
Campak : suntikan ke bawah kulit di lengan kiri atas.
HB
: suntikan pada lengan.
11

5. DT / TT: suntikan ke dalam otot pada lengan, paha ataupun punggung.

Kapan Imunisasi Tidak Boleh Diberikan


Keadaan-keadaan di mana imunisasi tidak dianjurkan :
1. BCG, tidak diberikan pada bayi yang menderita sakit kulit lama, sedang sakit TBC
dan panas tinggi.
2. DPT, tidak diberikan bila bayi sedang sakit parah, panas tinggi dan kejang.
3. Polio, tidak diberikan bila diare dan sakit parah.
4. Campak, tidak diberikan bila bayi sakit mendadak dan panas tinggi.
Keadaan-Keadaan Yang Timbul Setelah Imunisasi
Keadaan-keadaan yang timbul setelah imunisasi berbeda pada masing-masing imunisasi,
seperti yang diuraikan di bawah ini. :
1.

BCG, dua minggu setelah imunisasi terjadi pembengkakan kecil dan


merah di tempat suntikan, seterusnya timbul bisul kecil dan menjadi luka

parut.
2. DPT, umumnya bayi menderita panas sore hari setelah mendapatkan
imunisasi, tetapi akan turun dalam 1 - 2 hari. Di tempat suntikan merah dan
bengkak serta sakit, walaupun demikian tidak berbahaya dan akan sembuh
sendiri.
3. Campak, panas dan umumnya disertai kemerahan yang timbul 4 - 10 hari
setelah penyuntikan.
Tempat Pelayanan Imunisasi
Pelayanan imunisasi dapat diperoleh pada:
a.
b.
c.
d.
e.

Posyandu
Puskesmas
Bidan / dokter praktek
Rumah bersalin
Rumah sakit

12