Anda di halaman 1dari 55

LAPORANKASUS

DEMAMBERDARAHDENGUE

Pembimbing:

Dr.MasWisnuwardhana,Sp.A

Disusunoleh:

BrendaShahnazQurrotaAinaBaihaqi
03011057

KEPANITERAANKLINIKILMUKESEHATANANAK

RUMAHSAKITUMUMDAERAHBEKASI

PROGRAMSTUDIPENDIDIKANDOKTER

FAKULTASKEDOKTERANUNIVERSITASTRISAKTI

JAKARTA
2016

DAFTARISI

BABI PENDAHULUAN
BABII LAPORANKASUS
IdentitasPasien
Anamnesis
PemeriksaanFisik
PemeriksaanPenunjang
Resume
DiagnosisKerja
DiagnosisBanding
PemeriksaanAnjuran
Penatalaksanaan
Prognosis
BABIII ANALISISKASUS
BABIV TINJAUANPUSTAKA
Definisi
Epidemiologi
Etiologi
Patofisiologi
ManifestasiKlinis
Diagnosis
PemeriksaanPenunjang
Penatalaksanaan
BABV DAFTARPUSTAKA

BABI
PENDAHULUAN

Infeksivirusdenguepadamanusiamengakibatkanspectrummanifestasiklinisyang
bervariasi antara penyakit paling ringan (mild undifferentiated febrile illness), demam
dengue,demamberdarahdengue (DBD),sampai demamberdarah denguedisertaishock
(Dengue Shock Syndrome = DSS). Gambaran manifestasi klinis yang bervariasi ini
menggambarkanfenomenagununges.DengankasusDBDdanDSSyangdirawatdirumah
sakit sebagai puncak gunung es yang terlihat di atas permukaan laut. Sedangkan kasus
dengueringan(silentdengueinfectionataudemamdengue)sebagaidasarnya.1

DemamDengue,sindromjinakyangdisebabkanolehbeberapavirusyangdibawa
arthropoda,ditandaidengandemambifasik,mialgiaatauartralgia,ruam,leukopenia,dan
limfadenopati.EpidemilazimadapadadaerahberiklimsedangdiAmerika,Eropa,Australia,
dan Asia sampai pada awal abad ke 20. Demam dengue dan penyakit seperti dengue
sekarang adalah endemik di Asia tropik, Pulau Pasifik Selatan, Australia Utara, Afrika
tropik, Karibia, dan Amerika Tengah dan Selatan. Demam dengue sering terjadi pada
wisatawan.Sekurangkurangnyaadaempattipeantigenvirusdengueberbeda.Lagipulatiga
virusyangdibawaarthropoda(arbo)lainmenyebabkanpenyakitdemamserupaatauidentik
denganruam.2
Demam berdarah dengue, suatu penyakit demam berat yang sering mematikan,
disebabkan olehvirus,ditandai olehpermeabilitas kapiler, kelainanhemostasis danpada
kasus berat, sindrom syok kehilangan protein. Sekarang diduga mempunyai dasar
imunopatologis.Sekurangkurangnyaadaempattipevirusdengueyangberbedayangtelah
diisolasidaripenderitademamberdarah.2
Materi patologis insufisien telah diambil dari kasus demam dengue yang telah
dikonfirmasisecaravirologisuntukmemungkinkangambaranyangluas.Kematianjarang
denganinfeksicikungunya.Kematianyangdicatattelahdianggapberasaldariensefalitis
virus,perdarahan,ataukejangdemam.2

BABII
LAPORANKASUS

BAGIANILMUKESEHATANANAK
FAKULTASKEDOKTERANUNIVERSITASTRISAKTI
RSUDKOTABEKASI

STATUSPASIEN
NamaMahasiswa :BrendaShahnazQ.A.B Pembimbing:dr.MasWisnu,SpA
NIM :030.11.057 Tandatangan:

I. IDENTITASPASIEN
NomorRekamMedik :09.77.xx.xx
Nama :An.AS
JenisKelamin :Lakilaki
Usia :14tahun
Alamat :Kp.PintuAirRT04/03,Bekasi
Agama :Islam
Pendidikan :SD
Pekerjaan :

II. ANAMNESIS

Anamnesisdilakukansecara AlloanamnesisdenganIbu kandungpasien,kemudian


dilanjutkandenganpemeriksaanfisikyangdilakukanpada:
Lokasi :BANGSALMELATI07
Tanggal/Waktu :Sabtu/13Agustus2016
Tanggalmasuk :Rabu/10Agustus2016
Keluhanutama :demamsejak1minggusebelummasukrumahsakit(SMRS)
Keluhantambahan :lemas,menggigil,mual,muntah,nyeriuluhati,bintikmerahpada
kulit,perutkembung,nafsumakanmenurun.

RIWAYATPENYAKITSEKARANG
PasiendatangkeIGDRSUDBekasidengankeluhandemamsejak1minggusebelum
masukrumahsakit(SMRS).Demamdirasakannaikturunsepanjanghari,demamnaiksaat
malamdanturunapabilapasienminumobatpanas,pasienlupanamaobatnya,demamtidak
pernahdiukurdirumah,hanyadirasakandenganperabaantangan. Pasienjugamengeluh
lemas,menggigil,nafsumakanmenurun,perutkembung,dannyeripadauluhati.Pasien
merasakanadanyamualdanmuntah,muntahberisiairdanmakanan,lebihdari5kalidalam
sehari.Terdapatbintikbintikmerahpadakulitpasienyaitupadawajah,tangan,dankakinya.
Pasienmengakudilingkunganrumahpasienadayangmengalamipenyakitdemamberdarah,
yaitutemansepermainanpasien.Pasienseringterlambatmakanseharihari,danmenyukai
makananyangpedas.Pasienmenyangkaladanyamimisan,gusiberdarah,danperdarahan
lain.Pasientidakmengalamibatuk,pilek,dansesak.BABpasienlancar,konsistensilunak.
BAKlancar,warnakuningjernih.

RIWAYATPENYAKITDAHULU
Menurut kedua ibu pasien, anaknya belum pernah mengalami keluhan seperti ini
sebelumnya.Pasienpernahmengalamisakitmagh,namuntidaksampaidirawatdirumah
sakit.Riwayatasmadanalergidisangkaldisangkal.
RIWAYATKEHAMILANDANKELAHIRAN

KEHAMILAN Morbiditaskehamilan Tidakada.Anemia(),HT(),DM(),


penyakitjantung(),penyakitparu(),
infeksi().

Perawatanantenatal 9xkontrolketempatpraktekbidantiap1
bulansekalidansudahmelakukan
imunisasi

KELAHIRAN Tempatpersalinan BidanNeneng

Penolongpersalinan Bidan

Carapersalinan PartusSpontan

Masagestasi CukupBulan(40minggu)

Keadaanbayi Beratlahir:2600gram

Panjanglahir:Tidaktahu

Lingkarkepala:Tidaktahu

Segeramenangis
Kemerahan(+)
NilaiAPGAR:(tidaktahu)
Kelainanbawaan:tidakada

RIWAYATPERKEMBANGAN
PertumbuhangigiI:umur6bulan(Normal:59bulan)
Gangguanperkembanganmental:Tidakada
Psikomotor:

- Tengkurap:umur4bulan(Normal:34bulan)
- Duduk:umur8bulan(Normal:710bulan)

- Berdiri:umur11bulan(Normal:1012bulan)

- Berjalan:umur12bulan(Normal:1218bulan)

- Pengucapankatakata:umur12bulan(Normal:912bulan)

Kesimpulan riwayat pertumbuhan dan perkembangan: perkembangan pasien baik,


sesuaiusia,tidakadaketerlambatan.

RIWAYATMAKANAN

Umur(bulan) ASI Buah/Biskuit BuburSusu NasiTim

02 +

24 +

46 + +

68 + +

810 + +

1012 + +

1224 Susuformula + + +

JenisMakanan FrekuensidanJumlah

Nasi/Pengganti Nasi12x/hari
Sayur 2x/minggu

Daging 12x/tahun

Telur 2x/minggu

Ikan 2x/minggu

Tahu 12x/minggu

Tempe 12x/minggu

Susu(merk/takaran) Susu1x/minggu

Lainlain Biskuit/roti/buah1x/hari.

Kesimpulanriwayatmakanan:PasienmendapatkanASIeksklusif.Susuformuladiberikan
saatusia6bulan.Makananpendampingsepertibubursususudahdiberikansejakpasien
berumur5bulan.

RIWAYATIMUNISASI

Vaksin Dasar(umur) Ulangan(umur)

HepatitisB 0bulan 1bulan 6bulan

Polio 0bulan 2bulan 4bulan 6bulan 2tahun 5tahun

BCG 2bulan

DPT/PT 2bulan 4bulan 6bulan 2tahun

Campak 9bulan 6tahun


Kesimpulanriwayatimunisasi:imunisasidasarlengkapsesuaijadwal

RIWAYATKELUARGA

CorakReproduksi

No Tanggallahir Jenis Hidup Lahir Abortus Mati Keterangan


(umur) kelamin mati (sebab) kesehatan

1. 2292002 Lakilaki Ya Pasien

2. 2262006 Lakilaki Ya Adikpasien

3. 552010 Lakilaki Ya Adikpasien

4. 442015 Perempuan Ya Adikpasien

RiwayatPernikahan

Ayah Ibu

Nama Tn.A Ny.D

Perkawinanke 1 1

Umursaatmenikah 35tahun 19tahun

Pendidikanterakhir TamatSMP TamatSMP

Agama Islam Islam

Sukubangsa Betawi Betawi

Keadaankesehatan Meninggal Sehat

RiwayatPenyakitKeluarga
Pada anggota keluarga pasien, tidak ada yang mengalami keluhan serupa seperti
pasien.Ayahpasienmeninggalkarenariwayatdarahtinggidanstroke.
RiwayatKebiasaanKeluarga

Keluargapasienmenyangkaladanyakebiasaan jarangmembuangsampahdirumah
dan membiarkan air tergenang di lingkungan rumah. Keluarga pasien juga menyangkal
adanya kebiasaan minum minuman beralkohol, merokok, dan penggunaan obatobatan
terlarang.

RIWAYATPENYAKITYANGPERNAHDIDERITA

Penyakit Umur Penyakit Umur Penyakit Umur

Alergi () Difteria () Penyakit ()


jantung

Cacingan () Diare () Penyakitginjal ()

DBD () Kejang () Radangparu ()

Otitis () Rubeola () TBC ()

Parotitis () Operasi () Lainlain: Gastritis(+)

KesimpulanRiwayatPenyakityangpernahdiderita:
Pasien belum pernah menderita penyakit yang sama sebelumnya. Pasien pernah
mengalamisakitmagh,namuntidakpernahsampaidirawatdiRS.

RIWAYATLINGKUNGANPERUMAHAN

Menurutpengakuanibupasien keadaanlingkunganrumah cukup padat penduduk.


Padarumahpasienhanyaterdapat1jendeladidepandan1jendeladibelakangrumah.
Ventilasi udara, dan pencahayaan kurang. Sumber air berasal dari air mesin sanyo.
Pembuangan sampah rutin setiap hari. Membersihkan genangan air di kamar mandi dan
lingkunganrumahkurangrutin.
RIWAYATSOSIALEKONOMI
Ayah tiri pasien bekerja sebagai petugas keamanan dan kebersihan dengan
penghasilan kurang lebih Rp. 1.000.000/ bulan. Sedangkan ibu pasien adalah ibu rumah
tangga. Menurutibupasienpenghasilantersebutmasihbisamemenuhikebutuhanpokok
seharihari.

Kesimpulansosialekonomi: penghasilanAyahtiripasienmasihcukupuntukmemenuhi
kebutuhanpokokseharihari.

III. PEMERIKSAANFISIK

STATUSGENERALISATA
KeadaanUmum
KesanSakit :tampaksakitsedang
Kesadaran :composmentis
KesanGizi :gizibaik
Keadaanlain :pucat(),ikterik(),sesak(),sianosis()

DataAntropometri
BeratBadansekarang :31kg
TinggiBadan :140cm

StatusGizi(CDC)
- BB/U=31/51x100%=60,7%

- TB/U=140/164x100%=85,3%

- BB/TB=31/33x100%=93,9%(gizinormal)

Berdasarkan kurva CDC, status gizi pasien masuk dalam kategori gizi normal dengan
perhitunganBB/TB93,9%.

TandatandaVital

- Nadi:90x/menit,reguler,kuat,isicukup,ekualkanandankiri

- Nafas:20x/menit,regular

- Suhu:36,9C

Pemeriksaanfisik
Kepala :Normosefali
Rambut : Rambut hitam, lurus, lebat, distribusi merata, dan tidak mudah
dicabut
Wajah :Wajahsimetris,edema(),ptechie(+)
Mata
Visus:tidakdilakukan Ptosis:/
Edemapalpebral:/ Skleraikterik:/
Lagofthalmus:/ Konjungtivapucat:/
MataCekung:/ Exophthalmus:/
Korneajernih :+/+ Endophtalmus:/
Strabismus:/ Nistagmus:/
Lensajernih:+/+ Pupil:bulat,isokor,diameter3mm/3mm
Reflekscahaya:langsung+/+,tidaklangsung+/+

Telinga
Bentuk:normotia
Nyeritarikaurikula:/ Nyeritekantragus:/
Liangtelinga:lapang Membrantimpani:sulitdinilai
Serumen:/ Reflekscahaya:sulitdinilai
Cairan:/

Hidung
Bentuk:simetris Napascupinghidung:/
Sekret:/ Deviasiseptum:
Mukosahiperemis:/

Bibir :mukosaberwarnamerahmuda,kering(),sianosis(),pucat()

Mulut : trismus(), oral hygiene cukupbaik,halitosis(), mukosagusi berwarna


merahmuda,mukosapipiberwarnamerahmuda,arkuspalatumsimetris

Lidah :normoglosia,mukosaberwarnamerahmuda,hiperemis(),atrofipapil (),


tremor(),lidahkotor()

Tenggorokan :tonsilT2T2,hiperemis(),detritus(),dindingposteriorfaringtidak
hiperemis,arcusfaringtidakhiperemis,uvulaterletakditengah

Leher :bentuktidaktampakkelainan,edema(),massa(),tidaktampakdantidak
terabapembesarantiroidmaupunKGB,trakeatampakdanterabaditengah

Thoraks:
Jantung
- Inspeksi :ictuscordisterlihatpadaICSVlinea
midklavikularissinistra
- Palpasi :ictuscordisterabapadaICSVlinea
midklavikularissinistra

- Perkusi :

bataskirijantung :ICSVlineamidklavikularissinistra

bataskananjantung :ICSIIIVlineasternalisdextra

batasatasjantung :ICSIIIlineaparasternalissinistra
- Auskultasi :BJIIIreguler,murmur(),gallop()

Paru
- Inspeksi :bentuktorakssimetrispadasaatstatisdan
dinamis, tidak ada pernafasan yang tertinggal,
pernafasan abdominotorakal, pada sela iga tidak
terlihatadanyaretraksi,pembesaranKGBaksila/
- Palpasi : nyeri tekan (), benjolan (), gerak napas simetris
kanandankiri,vocalfremitussamakuatkanandankiri.
- Perkusi :
Sonordikedualapangparu.
Batasparulambung :ICSVIIlineaaksilarisanterior
Batasparuhepar :ICSVIlineamidklavikularisdextra
- Auskultasi :suaranapasvesikulerlemah/+,ronki/,
wheezing/
Abdomen
- Inspeksi :datar,warnakulitsawomatang,ruam
merah(),kulitkeriput(),gerakdindingperutsaat
pernapasansimetris,shaggingoftheflank(),venektasi
(),smilingumbilicus()
- Auskultasi :bisingusus(+)
- Perkusi :timpanipadaseluruhlapangperut,shifting
dullness(),undulasi()
- Palpasi :supel,nyeritekanepigastrium(+),hepartidak
terabamembesar,lientidakterabamembesar,ballotement()

Genitalia
Tidakdilakukanpemeriksaan

Kelenjargetahbening:
Preaurikuler :tidakterabamembesar
Postaurikuler :tidakterabamembesar
Submandibula :tidakterabamembesar
Supraklavicula :tidakterabamembesar
Aksila :tidakterabamembesar
Inguinal :tidakterabamembesar

Ekstremitas : Simetris, tidak terdapat kelainan pada bentuk tulang atau posisi
tangan, kaki, serta sikap badan, tidak terdapat keterbatasan gerak
sendi,akralhangatpadakeempatekstremitas,pittingedema pretibial
(/),edemadorsumpedis(/), sianosis (), capillaryrefilltime <2
detik,ptechie(+).
Kulit :warnasawomatangmerata,tidakikterik,tidaksianosis,lembab,Ptechie(+)

IV. PEMERIKSAANPENUNJANG

11/08/2016(8.00)

HEMATOLOGI Hasil NilaiRujukan

DarahLengkap

LajuEndapDarah 5mm 010mm

Leukosit 9.6ribu/l 510ribu/l

HitungJenis
Basofil 0% <1%
Eosinofil 0% 13%
Batang 2% 26%
Segmen 23% 5270%
69% 2040%
Limfosit
6% 28%
Monosit

Eritrosit 5.62juta/l 46juta/l

Hemoglobin 12.5g/dl 1317.5g/dl

Hematokrit 38.1% 4054%

Trombosit 50ribu/l 150400ribu/l

Bioserologi

TyphiO () ()1/80

ParatyphiAO () ()1/80

ParatyphiBO () ()1/80

ParatyphiCO () ()1/80

TyphiH () ()1/80

ParatyphiAH () ()1/80
ParatyphiBH 1/40 ()1/80

ParatyphiCH () ()1/80

Diabetes

GulaDarahSewaktu 95mg/dl 60110mg/dl

Elektrolit

Natrium(Na) 144mmol/L 135145mmol/L

Kalium(K) 4.1mmol/L 3.55mmol/L

Klorida(Cl) 100mmol/L 94111mmol/L

11/08/2016(18.45)

HEMATOLOGI Hasil NilaiRujukan

DarahRutinDHF

Leukosit 8.6ribu/l 510ribu/l

Hemoglobin 12.6g/dl 1317.5

Hematokrit 37.4% 4054%

Trombosit 41ribu/l 150400ribu/l

12/08/2016(6.34)

HEMATOLOGI Hasil NilaiRujukan

DarahRutinDHF

Leukosit 8.0ribu/l 510ribu/l

Hemoglobin 12.5g/dl 1317.5

Hematokrit 36.4% 4054%

Trombosit 60ribu/l 150400ribu/l


12/08/2016(16.25))

HEMATOLOGI Hasil NilaiRujukan

DarahRutinDHF

Leukosit 7.1ribu/l 510ribu/l

Hemoglobin 11.8g/dl 1317.5

Hematokrit 33.7% 4054%

Trombosit 82ribu/l 150400ribu/l

PEMERIKSAANRADIOLOGI

ThoraxPA(10/8/2016)

Cornormal,diafragmanormal

Pulmo:Corakannormal

Sinussuperposisidengancosta

RLD:Perselubungantipisdilapangbawah

Kesan:Efusidekstraminimal
PersentasePleuralEffusionIndeks :lebarmaksimumefusipleurax100%

Lebarmaksimumhemitoraks

:2,5cmx100%=25%(+jika>6%)

10cm

V. RESUME

PasiendatangkeIGDRSUDBekasidengankeluhandemamsejak1minggusebelum
masukrumahsakit(SMRS).Demamdirasakannaikturunsepanjanghari,demamnaiksaat
malamdanturunapabilapasienminumobatpanas,pasienlupanamaobatnya,demamtidak
pernahdiukurdirumah,hanyadirasakandenganperabaantangan. Pasienjugamengeluh
lemas,menggigil,nafsumakanmenurun,perutkembung,dannyeripadauluhati.Pasien
merasakanadanyamualdanmuntah,muntahberisiairdanmakanan,lebihdari5kalidalam
sehari.Terdapatbintikbintikmerahpadakulitpasienyaitupadawajah,tangan,dankakinya.
Pasienmengakudilingkunganrumahpasienadayangmengalamipenyakitdemamberdarah,
yaitu teman sepermainan pasien. Pasien menyangkal adanya nyeri kepala, nyeri otot,
mimisan,gusiberdarah,danperdarahanlain.
PadapemeriksaanFisik,didapatkankeadaanumumtampaksakitsedang,kesadaran
composmentis,HR:90x/menit,RR:20x/menit,suhu:36,9oC.Padakulitwajah,tangan,dan
kakipasienterdapatptechie,suaranapasvesikulerdekstramelemah,nyeritekanepigastrium
(+). Pada pemeriksaan Laboratorium, didapatkan Hb menurun: 12,5 g/dl, Ht menurun:
36,4%,dantrombositmenurun:60.000/l.PadapemeriksaanfotorontgenthoraxPA+RLD,
didapatkanefusipleuradekstraminimal.

VI. DIAGNOSISKERJA
DemamBerdarahDengueGradeII
Efusipleuradekstra

VII. DIAGNOSISBANDING
DemamDengue

VIII. PEMERIKSAANANJURAN
LaboratoriumDarah:DarahPeriferLengkap,elektrolit,GDS,Widal
LaboratoriumUrin:UrinLengkap
FotoRontgenThoraxAPdanRLD

IX. PENATALAKSANAAN
RehidrasiIVFD2Jalur:
I. RL75cc/jam
II. RL75cc/jam
Antibiotik:Anbacim2x1gr
Antipiretik:Sanmol350mginjIV

X. PROGNOSIS
AdVitam :Adbonam
AdFungtionam :Dubiaadbonam
AdSanationam :Dubiaadbonam

XI. FOLLOWUP

11/8/2016 S:Pasienmerasademam,lemas,mual,nyeriuluhati,menggigil,
dantidaknafsumakan
O:KU:tampaksakitsedang,Kes:Composmentis,HR:90x/menit,
Suhu:36,6oC,RR:20x/menit
Mata:SkleraIkterik/,ConjungtivaAnemis/
Thorax:BJ12reguler,murmur(),gallop(),SNVesikuler(lemah/
+),Wheezing(/),Rhonki(/)
Abdomen:Supel,Bisingusus(+),Hepatomegali(),Nyeritekan
epigastrium(+)
Ekstremitas:Akralhangat+/+,CRT<2detik,ptechie(+)

HEMATOLOGI Hasil NilaiRujukan

DarahRutinDHF

Leukosit 8.6ribu/l 510ribu/l

Hemoglobin 12.6g/dl 1317.5

Hematokrit 37.4% 4054%

Trombosit 41ribu/l 150400ribu/l

A:DHFgradeII
P:
RL2jalur:75cc/jamdan75cc/jam
Anbacim2x1g
SanmolInj300mg
Ceklab:DPL,UL,elektrolit,GDS,widal
FotoRontgenThoraxAP+RLD

12/8/2016 S:Pasienmerasalemas,nyeriuluhati,dantidaknafsumakan.
Demam,menggigil,danmualmembaik
O:KU:tampaksakitringan,Kes:Composmentis,HR:100x/menit,
Suhu:36,6oC,RR:20x/menit
Mata:SkleraIkterik/,ConjungtivaAnemis/
Thorax:BJ12reguler,murmur(),gallop(),SNVesikuler(lemah/
+),Wheezing(/),Rhonki(/)
Abdomen:Supel,Bisingusus(+),Hepatomegali(),Nyeritekan
epigastrium(+)
Ekstremitas:Akralhangat+/+,CRT<2detik,ptechie(+)

HEMATOLOGI Hasil NilaiRujukan


(6.34)

DarahRutinDHF

Leukosit 8.0ribu/l 510ribu/l

Hemoglobin 12.5g/dl 1317.5

Hematokrit 36.4% 4054%

Trombosit 60ribu/l 150400ribu/l

HEMATOLOGI Hasil NilaiRujukan


(16.25)

DarahRutinDHF

Leukosit 7.1ribu/l 510ribu/l

Hemoglobin 11.8g/dl 1317.5

Hematokrit 33.7% 4054%

Trombosit 82ribu/l 150400ribu/l

A:DHFgradeII
P:
RL2jalur:75cc/jamdan75cc/jam
Anbacim2x1g
SanmolInj300mg
Ceklab:seriDHF/8jam

13/8/2016 S:Pasienmerasalemas,nyeriuluhati,dantidaknafsumakan.
Demam(),menggigil(),danmual()
O:KU:tampaksakitringan,Kes:Composmentis,HR:98x/menit,
Suhu:36,9oC,RR:20x/menit
Mata:SkleraIkterik/,ConjungtivaAnemis/
Thorax:BJ12reguler,murmur(),gallop(),SNVesikuler(lemah/
+),Wheezing(/),Rhonki(/)
Abdomen:Supel,Bisingusus(+),Hepatomegali(),Nyeritekan
epigastrium(+)
Ekstremitas:Akralhangat+/+,CRT<2detik,ptechie(+)
A:DHFgradeII
P:
RL2jalur:25cc/jamdan25cc/jam
Anbacim2x1g
SanmolInj300mg
Ceklab:seriDHF/12jam

14/8/2016 S:Pasienmerasalemas,nyeriuluhati,dannafsumakanmembaik.
Demam(),menggigil(),danmual()
O:KU:tampaksakitringan,Kes:Composmentis,HR:98x/menit,
Suhu:36oC,RR:20x/menit
Mata:SkleraIkterik/,ConjungtivaAnemis/
Thorax:BJ12reguler,murmur(),gallop(),SNVesikuler(lemah/
+),Wheezing(/),Rhonki(/)
Abdomen:Supel,Bisingusus(+),Hepatomegali(),Nyeritekan
epigastrium(+)
Ekstremitas:Akralhangat+/+,CRT<2detik,ptechie()
A:DHFgradeIIperbaikan
P:
RL2jalur:25cc/jamdan25cc/jam
Anbacim2x1g
SanmolInj300mg
Ceklab:seriDHF/12jam

15/8/2016 S:Pasienmerasamembaik.Lemas(),nyeriuluhati(),nafsu
makanmembaik,demam(),menggigil(),danmual()
O:KU:tampaksakitringan,Kes:Composmentis,HR:98x/menit,
Suhu:36oC,RR:20x/menit
Mata:SkleraIkterik/,ConjungtivaAnemis/
Thorax:BJ12reguler,murmur(),gallop(),SNVesikuler(lemah/
+),Wheezing(/),Rhonki(/)
Abdomen:Supel,Bisingusus(+),Hepatomegali(),Nyeritekan
epigastrium()
Ekstremitas:Akralhangat+/+,CRT<2detik,ptechie()
A:DHFgradeIIperbaikan
P:
RL2jalur:25cc/jamdan25cc/jam
Anbacim2x1g
SanmolInj300mg
BolehPulang

BABIII

ANALISISKASUS

NO KASUS TEORI
.
1 Anamnesis Anamnesis

Demam atau riwayat demam akut,


Demam sejak 1 minggu SMRS.
antara27hari,biasanyabifasik
Demamnaikturunsepanjanghari,
Lesu/lemas
demamnaiksaatmalamdanturun

Tidaknafsumakan
apabila pasien minum obat panas,

Muntah
demam tidak pernah diukur di
Nyerikepala
rumah, hanya dirasakan dengan
perabaantangan. Nyeriotot

Nyeriperut
Lemas
Diarekadangkadang

Menggigil Perdarahankulit(ptechie)dan
mimisan
Nafsumakanmenurun

Perutkembung

Nyeripadauluhati

Mual

Muntah, muntah berisi air dan


makanan, lebih dari 5 kali dalam
sehari

Bintikbintik merah pada kulit


pasien yaitu pada wajah, tangan,
dankakinya

Di lingkungan rumah pasien ada


yang mengalami penyakit demam
berdarah,yaitutemansepermainan
pasien.
2 PemeriksaanFisik PemeriksaanFisik
Demam atau riwayat demam akut,
keadaan umum: tampak sakit
antara27hari,biasanyabifasik
sedang,kesadaran:composmentis,
Hepatomegalidankelainanfungsi
HR: 90 x/menit, RR: 20 x/menit,
hati
suhu:36,9oC
Peningkatanpermeabilitaskapiler
sehinggamenyebabkanperembesan
Kulit wajah, tangan, dan kaki:
plasma,hipovolemiadansyok:
ptechie(+)
o Anakgelisah,sampaiterjadi

Suara napas vesikuler dekstra penurunankesadaran,

melemah sianosis
o Nafascepat,naditeraba
Nyeritekanepigastrium(+). lembutkadangkadangtidak
teraba
o Tekanandarahturun,
tekanannadi<10mmHg
o Akraldingin,capillaryrefill
timemenurun
o Diuresismenurunsampai
anuria

Terdapat minimal satu dari


manifestasiperdarahanberikut:
o Ujibendungpositif
o Petekie, ekimosis, atau
purpura
o Perdarahan mukosa
(tersering epistaksis atau
perdarahangusi)
o Hematemesisataumelena

Derajat penyakit DBD


diklasifikasikandalam4derajat:

DerajatI Demam disertaigejalatidak


khas dan satusatunya
manifestasi perdarahan
adalahujitourniquet.
DerajatII Seperti derajat I, disertai
perdarahan spontan di kulit
danatauperdarahanlain.

DerajatIII Didapatkan kegagalan


sirkulasiyaitunadicepatdan
lambat, tekanan nadi
menurun (20 mmHg atau
kurang) atau hipotensi,
sianosis di sekitar mulut,
kulitdingindanlembab,dan
anaktampakgelisah.

DerajatIV Syokberat(profoundshock),
nadi tidak dapat diraba dan
tekanandarahtidakterukur.

3 PemeriksaanPenunjang Laboratorium
Trombositopenia (jumlahtrombosit
Hbmenurun:12,5g/dl
Htmenurun:36,4% <100.000/ul)
Trombositmenurun:60.000/l Terdapat minimal satu tandatanda
PenurunanHtsetelahmendapat
plasmaleakage(kebocoranplasma)
cairan:
sebagaiberikut:
(HttertinggiHtterendah)x100% o Peningkatan hematokrit
Httertinggi >20% dibandingkan standar
(38,133,7)x100%=11,5%(<20%) sesuai dengan umur dan
38,1 jeniskelamin
o Penurunanhematokrit>20%

FotorontgenthoraxPA+RLD: setelah mendapat terapi

efusipleuradekstraminimal cairan,dibandingkandengan
nilaihematokritsebelumnya
PersentasePleuralEffsionIndex:
o Tanda kebocoran plasma
Lebarmaksimumefusipleurax100% seperti efusi pleura, asites
Lebarmaksimumhemitorax atauhipoproteinemi.
=25cmx100%=25%(>6%) SediaanApusDarahTepi(SADT):
10cm Dapatdinilailimfositplasmabiru,
peningkatan15%menunjang
diagnosisDBD
Radiologis:
o Dilatasipembuluhdarah
paruterutamadaerahhilus
kanan,hemitorakskanan
lebihradioopak
dibandingkankiri,kubah
diafragmakananlebihtinggi
daripadakiri,danefusi
pleura.
USG:
o Efusipleura,ascites,
kelainan(penebalan)dinding
vesicafeleadanvesica
urinaria.
4. Tatalaksana Tatalaksana

RehidrasiIVFD2Jalur: Suportif

RL75ml/jam o Rehidrasi DBD derajat II


tanpapeningkatanHt:
RL75ml/jam
Cairan Kristaloid, tetesan rumatan sesuai
Antibiotik:Anbacim2x1gr
BB:
Isi:Cefuroxim(sefalosporin)
=1500+(20xBB)=1500+(20x20)=
Antipiretik:Sanmol350mginjIV 1900ml/hari

Cek:Hb,Ht,Trombosit/12jam =80ml/jam

Medikamentosa

o Antipiretik : Parasetamol
5001000mg,jikademam

o Kortikosteroid : pada DBD


ensefalopati, apabila
terdapat perdarahan saluran
cerna kortikosteroid tidak
diberikan.

o Antibiotik:untukprofilaksis
danDBDensefalopati

Cek:Hb,Ht,Trombosit/612jam
BABIV

TINJAUANPUSTAKA

I. DEFINISI

Infeksivirusdenguemerupakansuatupenyakitdemamakutyangdisebabkanoleh
virusgenusFlavivirus,familyFlaviviridae,mempunyai4jenisserotipeyaituDEN1,DEN
2, DEN3, dan DEN4, melalui perantara nyamukAedes aegypti atauAedes albopictus.
KeempatserotipedengueterdapatdiIndonesia,DEN3merupakanserotipedominandan
banyakberhubungandengankasusberat,diikutiserotipeDEN2.3
Infeksivirusdenguepadamanusiamengakibatkanspektrummanifestasiklinisyang
bervariasi antara penyakit paling ringan (mild undifferentiated febrile illness), demam
dengue,demamberdarahdengue (DBD),sampai demamberdarah denguedisertaishock
(Dengue Shock Syndrome = DSS). Gambaran manifestasi klinis yang bervariasi ini
menggambarkanfenomenagununges.DengankasusDBDdanDSSyangdirawatdirumah
sakit sebagai puncak gunung es yang terlihat di atas permukaan laut. Sedangkan kasus
dengueringan(silentdengueinfectionataudemamdengue)sebagaidasarnya.1

II. EPIDEMIOLOGI

Padasaatinijumlahkasusmasihtetaptinggiratarata1025per100.000penduduk,
namunangkakematiantelahmenurunbermakna<2%.Umurterbanyakyangterkenainfeksi
dengueadalahkelompokumur410tahun,walaupunmakinbanyakkelompokumurlebih
tua.Spektrumklinisinfeksidenguedapatdibagimenjadi(1)gejalaklinispalingringantanpa
gejala (silent dengue infection), (2) demam dengue (DD), (3) demam berdarah dengue
(DBD)dan(4)demamberdarahdenguedisertaisyok(sindromsyokdengue/DSS).3
IstilahhemorrhagicfeverdiAsiaTenggarapertamakalidigunakandiFilipinapada
tahun1953.Padatahun1958meletusepidemipenyakitserupadiBangkok.Setelahtahun
1958penyakitinidilaporkanberjangkitdalambentukepidemidibeberapanegaralaindi
AsiaTenggarasepertiHanoi,Malaysia,Saigondanchikungu.DiIndonesiaDBDpertama
kali dicurigai di Surabaya pada tahun 1968. Berdasarkan jumlah kasus DBD, Indoneisa
menempatiurutankeduasetelahThailand.Sejaktahun1968,angkakesakitanratarataDBD
diIndonesiaerusmeningkatdari0,05hinggatertinggipadatahun1998yaitu35,19per
100.000penduduk.PadasaatiniDBtelahmenyebarluasdikawasanAsiaTenggara,Pasifik
BaratdandaerahKaribia.1

III. ETIOLOGI

VirusdenguetermasukgroupB arthropodvirus(arbovirus) dansekarangdikenal


sebagaigenusflavivirus,famili Flaviviridae yangmempunyai4jenisserotipeyaituden1,
den2, den3 dan den4. Infeksi dengan salah satu serotipe akan menimbulkan antibodi
seumurhidupterhadapserotipeyangbersangkutantetapitidakadaperlindunganterhadap
serotipelain.Seorangyangtinggaldidaerahendemisdenguedapatterinfeksidengan3atau
bahkan4serotipeselamahidupnya.Keempatjenisserotipevirusdenguedapatditemukan
dan bersirkulasi sepanjang tahun. Serotipe den3 merupakan serotipe yang dominan dan
banyakberhubungandengankasusyangberat.1

IV. PATOFISIOLOGI

Mekanisme sebenarnya tentang patofisiologi, hemodinamika, dan biokimia DBD


belum diketahui secara pasti karena kesukaran mendapatkan binatang percobaan untuk
menimbulkan gejala klinis DBD seperti manusia. Hingga sebagian besar sarjana masih
menganut the secondary hetelogous infection hypotesis atau the sequential infection
hypotesisyangmenyatakanbahwaDBDdapatterjadibilaseseorangterinfeksivirusdengue
pertamakalidanmendapatkaninfeksikeduadenganvirusdengueserotipelaindalamjarak
waktu6bulansampai5tahun.1

TheImmunologicalEnhancmentHypotesis

Antibodi yang terbentuk pada infeksi dengue terdiri dari IgG yang menghambat
replikasivirusdalammonosit,yaituenhancingantibodydanneutralizingantibody.Saatini
dikenal 2 jenis antibodi: (1) kelompok monoklonal reaktif yang tidam memiliki sifat
menetralisasitetapimemicureplikasivirus,(2)antibodiyangmemilikisifatmenetralisasi
dantidakmemilikidayamemicureplikasivirus.Antibodinonneutralisasiyangterbentuk
padainfeksiprimerakanmenyebabkantimbulnyakompleksimunpadainfeksisekunder
yangdapatmemicureplikasivirus.Sehinggatimbulteoribahwainfeksisekunderdengue
serotiplainmenimbulkanmanifestasiyanglebihberat.Dasarutamahipotesismeningkatnya
imunologis(theimmunologicalenhancmenthypothesis):1

1. Selfagositmononuklear(monosit,makrpfag,histiosit,selkupfer)merupakantempat
utamaterjadinyainfeksivirusengueprimer.
2. Nonneutralizingantibodybaikyangberedardisirkulasimaupunyangmelekatpada
sel,bertindaksebagaireseptorspesifikuntukmelekatnyavirusdenguedengansel
fagositmononuklear.Mekanismepertamainidisebutmekanismeaferen.
3. Virusdenguekemudianbereplikasidalamselfagositmononuklear.
4. Selanjutnyaselmonosityangmengandungkompleksimunmenyebarkeusus,hati,
limpa, dan sumsum tulang. Mekanisme ini disebut mekanisme eferen. Perbedaan
DBDdenganatautanparenjatanadalahjumlahselyangterinfeksi.
5. Sel monosit yang terinfeksi akan berinteraksi dengan sistem humoral dan sistem
komplemen, akibat dilepaskannya mediator yang mempengaruhi permeabilitas
kapiler dan mengaktifasi sistem koagulasi. Mekanisme ini disebut mekanisme
efektor.

AktifasilimfositT

Monosityangterinfeksivirusdengue,akanmengakibatkanlimfositmengeluarkaninterferon
alfa dan gamma. Pada infeksi sekunder virus dengue, limfosit T CD4 berproliferasi
menghasilkan IFN alfa. IFN alfa merangsang sel yang terinfeksi virus dengue sehingga
monositmengeluarkanmediator.OlehlimfositTCD4danCD8,monositakanlisisdandan
mengeluarkanmediatoryangmengakibatkankebocoranplasmadanperdarahan.1

PatogenesisKlinis

Volumeplasma

PatofisiologiutamayangmenentukanderajatpenyakitdanmembedakanDDdengan
DBDadalahpeningkatanpermeabilitasdindingpembuluhdarah,penurunanvolumeplasma,
hipotensi, trombositopenia serta diatesis hemoragik. Pada kasus syok, nilai hematokrit
meningkat bersamaan dengan menghilangnya plasma melalui endotel pembuluh darah.
Meningginya nilai hematokrit terjadi sebagai akibat kebocoran plasma kedaerah
extravaskularmelaluikapileryangrusak.Buktiyangmendukungditemukannyapeningkatan
beratbadan,ditemukancairanyangtertimbundalamronggaserosayaituronggaperitoneum,
pleuradanperikardiumyangpadaotopsimelebihicairanyangdiberikanpadainfus,dan
terdapatnyaedema.1

Pada sebagian besar kasus, plasma yang menghilang dapat diganti dengan
memberikanplasmaatauekspanderplasma.Padamasadinidapatdiberikancairanyang
mengandungelektrolit.Syokterjadisecaraakutdanperbaikanklinisterjadisecaracepat.
Sedangkan pada otopsi tidak ditemukan kerusakan pada pembuluh darah. Gambaran
mikroskopbiopsikulitpasienDBDmenunjukkankerusakanendotelvaskularmiripdengan
anoksia,ataulukabakar.Gambaranitujugamiripdenganbinatangyangdiberihistaminatau
serotoninataudibuatkeadaantrombositopenia.1

Trombositopenia

Trombositopenia merupakan kelainan hematologis yang ditemukan pada sebagian


besarkasusDBD.Nilaitrombositmulaimenurunpadamasademamdanmencapainilai
terendahpadamasasyok.Trombositopeniadihubungkandenganmeningkatnyamegakariosit
muda dalam sumsum tulang dan pendeknya masa hidup trombosit akibat meningkatnya
destruksi trombosit. Penyebab peningkatan destruksi trombosit tidak diketahui namun
beberapafaktorpenyebabyaituvirusdengue,komponenaktifsistemkomplemen,kerusakan
endoteldanaktivasisistempembekuandarahsecarabersamaanatausecaraterpisah.Lebih
lanjutpenurunanjumlahtrombositdisebabkanolehprosesimunologisterbuktiditemukan
kompleks imun dalam peredaran darah. Trombositopenia dan gangguan fungsi trombosit
dianggapsebagaipenyebabutamaterjadinyaperdarahanpadaDBD.1

Sistemkoagulasidanfibrinolisis

Kelainan sistem koagulasi juga berperan terhadap perdarahan DBD. Masa perdarahan
memanjang, masa pembekuan normal, masa tromboplastin parsial yang teraktivasi
memanjang. Beberapa faktor pembekuan menurun termasuk faktor II,V,VII,VIII,X dan
fibrinogen. Pada kasus DBD berat terjadi peningkatan fibrinogen degradation product
(FDP). Penelitian lainnya menunjukkan adanya penurunan aktivitas antritrombin III.
Disampingitu,penurunanfaktorVII,IIdanantritrombinIIItidaksebanyakfibrinogendan
faktorVIIItidakhanyadiakibatkanolehkonsumsikoagulasitetapijugakonsumsisistem
fibrinolisis.KelainanfibrinolisispadaDBDdapatdibuktikandenganpenurunanaktivitas
2plasmininhibitordanpenurunanaktifitasplasminogen.1

Seluruhpenelitiandiatas membuktikanbahwa(1)padaDBDstadiumakuttelah
terjadiproseskoagulasidanfibrinolisis,(2)DessiminatedIntravascularCoagulation(DIC)
secarapotensialjugadapatterjadipadaDBDtanpashock.PadamasadiniDBD,peranDIC
tidakmenonjoldibandingkanperubahanplasmatetapiapabilapenyakitmemburukmenjadi
shockdanasidosismakaakanmemperberatDIC.ShockdanDICakansalingmempengaruhi
sehinggaterjadishockirreversibeldisertaiperdarahanhebat,terlibatnyaorganorganvital
yangmengakibatkankematian.(3)Perdarahankulitbiasanyadiakibatkanolehfaktorkapiler,
gangguan fungsi trombosit dan trombositopenia, sedangkan perdarahan masif berkaitan
dengankelainanyanglebihkomplekssepertitrombositopenia,gangguanfaktorpembekuan,
dan kemungkinan besar oleh DIC, terutama pada kasus shock lama yang tidak teratasi
disertaikomplikasiasidosismetabolik.(4)AntitrombinIIIyangmerupakanfaktorheparin.
PadakasuskekuranganantitrombinIII,responspemberianheparinakanberkurang.1

Sistemkomplemen

Penurunankadarserumkomplemendisebabkanolehaktivasisismtemkomplemen
danbukanolehproduksiyangmenurun.AktivasiiniakanmenghasilkananafilaktosinC3a
danC5a yangmempunyaikemampuanstimulasiselmastutnukmelepaskanhistamindan
merupakan mediator kuat untuk menimbulkan peningkatan permeabilitas kapiler,
pengurangan volume plasma dan syok hipovolemik. Komplemen juga bereaksi dengan
epitopeviruspadaselendotel,permukaantrombositdanlimfositTyangmengakibatkan
waktuparuhtrombositmemendek,kebocoranplasma,syokdanperdarahan.Disampingitu
komplemen juga merangsang monosit, untuk memproduksi sitokin seperti Tumor
NecrotizingFactor(TNF),interferongamma,interleukin1dan2(IL1danIL2).Buktiyang
mendukung peranan sistem komplemen pada penderita DBD ialah ditemukannya kadar
histaminyangmeningkatdalamurin24jam,adnayakompleksimunyangbersirkulasibaik
padaDBDderajatringanmaupunberat,adanyakorelasiantarakuantitatifkompleksimun
denganderajatberatpenyakit.1

Responsleukosit
PadaperjalananpenyakitDBD,sejakdemamhariketigaterlihatpeningkatanlimfosit
atopik yang berlangsung hingga hari kedelapan. Dari penelitian yang lebih mendalam
menyebutnyasebagailimfositplasmabiru(LPB).LPBmeurpakancampuranlimfositBdan
limfositT,denganLPBpadaumunyamempunyaiukuranbesaratausamadenganlimfosit
besar, sitoplasma lebar dengan vakuolisasi halus sampai sangat nyata dengan daerah
perinuklearyangjernih.Intiterletakpadasalahsatutepiselberbentukbulatatauginjal.
Kromosomintikasardankadangkadangdidalamintiterdapatnukleoli.Padasitoplasma
tidakadagranulaazurofilik.PemeriksaanLPBsecaraseridaripreparathapusdarahtepi
menunjukkan bahwa LPB pada infeksi dengue mencapai puncak pada hari keenam.
Selanjutnya dibuktikan pula diantara hari keempat sampai kedelapan demam terdapat
perbedaanbermaknaproporsiLPBpadaDBDdengandemamdengue.1

V. MANIFESTASIKLINIS

DemamDengue

Masatunasberkisarantara35hari(umumnya58hari).Awalpenyakitmendadak,
disertaigejalaprodromalsepertinyerikepala,nyeribagiantubuh,anoreksia,menggigil,dan
malaise.Dijumpaitriassindrom,yaitudemamtinggi,nyeribagiantubuh,dantimbulruam
padakulit.Ruampadakulittimbul612jamsebelumdemampertamakali.Ruambersifat
makulopapularyanghilangdengantekanan.Ruampadadada,abdomenyangmenyebarke
anggotagerakdanmuka.1

Padabeberapapenderitadidapatkankurvasuhuberbentuktapalkudaataubifasik,
namuntidakpatognomonik. Anoreksia, obstipasi,rasatidaknyamanepigastrium disertai
nyerikolikdanperutjugadidapatkan.Padastadiumawaljugaditemukanperubahanpada
inderapengecapan.Gejalaklinisyangseringditemukanyaitufotofobia,berkeringat,suara
serak,batuk,epistaksis,dandisuria.1

Kelainandarahtepidemamdengueyaituleukopenia,terdapatneutrofiliarelatifdan
limfopeniayangdisusulneutropeniarelatifdanlimfositosispadamasapuncakpenyakitdan
masa konvalesens. Eosinofil menurun dan menghilang pada awal dan puncak penyakit,
hitung jenis neutrofil bergeser ke kiri pada periode demam, sel plasma meningkat pada
puncakpenyakitdisertaitrombositopenia.Hasildarahtepikembalinormalsetelah1minggu.
1

Komplikasidemamdneguewalaupunjarangditemukan,yaituorchitisatauovaritis,
keratitis,danretinitis.Berbagaikeluhanneurologisjugadapatdilaporkansepertipenurunan
kesadaran,paralisissensoriumsementara,meningismus,danensefalopati.1

DemamBerdarahDengue

Demamberdarahdengueditandaidengan4manifestasiklinis,yaitudemamtinggi,
perdarahan,hepatomegali,dankegagalanperedarandarahatausirkulasi.Patofisiologiutama
yang membedakan DD dan DBD yaitu peningkatan permeabilitas pembuluh darah,
menurunnyavolumeplasma,trombositopenia,dandiatesishemoragik.1

PadaDBDterdapatperdarahankulit,ujitorniquetpositif,memar,danperdarahan
padatempatpengambilandarahvena.Ptechieyangmenyebarpadaanggotagerak,muka,
aksillayangseringditemuipadamasadinidemam.Epistaksisdanperdarahangusijarang
ditemui,perdarahanhebatgastrointestinallebihjarangditemui,lebihseringditemuisetelah
terjadirenjatanyangtidakdiatasi.Perdarahankonjungtivakadangkadangdapatterjadi.Pada
masakonvalesensdapatditemukaneritemapadatelapaktangandankaki.1

DBDDenganShock

Pada DBD dengan shock, setelah demam beberapa hari dilanjutkan dengan
perburukankeadaanumum,biasanyapadaharike37.Pasienseringkalimengeluhnyeri
daerahperutsaatsebelumsyoktimbul.Haliniditandaidnganadanyakegagalansirkulasi,
kulitlembabdandingin,sianosissekitarmulut,nadicepatdanlambat,lesu,gelisah.Tekanan
nadimenurunsampai20mmHGataukurang,tekanansistolikmenurunsampai80mmHg
ataukurang.Syokharussecaratepatagartidakmasukdalamsyokberat(profoundshock).
Tatalaksana shock yang tidak adekuat dapat menyebabkan asidosis metabolik, hipoksia,
perdarahan gastrointestinal berat dengan prognosis buruk. Sebaliknya jika shock diatasi
dengan cepat dan segera, maka pasien akan sembuh dalam 23 hari dan nafsu makan
membaikyangmenunjukkanprognosisbaik.1

Pada pemeriksaan laboratorium ditemukan trombositopenia dan hemokonsentrasi.


Trombosit<100.000didapatkanpadaharike37.Peningkatanhematokritmerupakanbukti
kebocoran plasma. Pada beberapa kasus ditemukan asidosis metabolik. Jumlah leukosit
bervariasiantaraleukopenisampaileukositosis.1

GejalaKlinis

Demam

Demam berdarah dengue biasanya ditandai dengan demam yang mendadak tanpa
disertaisebabyangjelas,continue,bifasik.Biasanyaberlangsung27hari.Naikturundan
tidakberhasildenganpengobatanantipiretik.Demambiasanyamenurunharike3danke7
dengantandatandaanakmenjadilemah,ujungjari,telingaterabadingindanlembab.Masa
kritispadaharike35.Demamakut(3840 0)dengangejalatidakspesifiksepertianoreksia,
lemah,nyeripunggung,tulangsendidankepala.1

Manifestasiperdarahan

Uji tourniquet sebagai manifestasi perdarahan kulit paling ringan dapat dinilai
sebagaiujipresumtifolehkarenaujiinipositifpadahariharipertamademam.Pemeriksaan
terlebih dahulu dengan menetapkan tekanan darah anak. Selanjutnya diberikan tekanan
antarasistolikdandiastolikpadalenganatas.Setelahdilakukantekananselama5menit,
perhatikantimbulnyaptekiaepadavolarlenganbawah.Ujidinyatakanpositifbilaterdapat
20 ptekiae pada satu inchi persegi (2,8x2,8 cm). Pada DBD uji tourniquet umunya
memberikan hasil positif. Pemeriksaan ini memberikan hasil negatif atau positif lemah
selama syok. Apabila pemeriksaan diulangi setelah syok ditanggulangi pada umumnya
memberikanhasilpositif.1

Hepatomegali

Pembesaran hati pada umumnya dapat diraba pada permulaan penyakit dan
pembesaranhatitidaksejajardenganberatnyapenyakit;nyeritekanseringkaliditemukan
tanpa disertai ikterus. Hati pada anak umur 4 tahun atau gizi baik biasanya tidak dapat
diraba.Kewaspadaan perlu ditingkatkan apabila awalnya hati tidak teraba kemudian
membesar dan pada perabaan teraba lebih besar dan kenyal, hal ini merupakan tanda
terjadinyasyok.1

Syok
Manifestasisyokterdiriatas:1

o Kulitpucat,dingin,danlembabterutamadiujungjarikaki,tangan,hidung,
sedangkankukumenjadibiru.Halinidisebabkansirkulasiyanginsufisien
menyebabkanpeningkatanreflekssimpatik
o Anak yang awalnya cengeng, rewel, dan gelisah lambat laun mengalami
penurunankesadaranmenjadiapatis,sopor,dankoma.Halinidisebabkan
kegagalansirkulasiserebral.
o Perubahandenyutnadi,baikfrekuensimaupunamplitudonya.Nadimenjadi
cepatdanlemahsampaitidakterabalagi.Halinidisebabkankarenakolaps
sirkulasi.
o Tekanannadimenurunmenjadi20mmHGataukurang.
o Tekanansistolikpadaanakmenurunsampai80mmHgataukurang.
o Oligourisampaianurikarenapenurunansirkulasidarahyangmelewatiarteri
renalis.

Pada kirakira sepertiga kasus DBD setelah demam berlangsung beberapa hari,
keadaanumumpasientibatibamemburuk.Haliniterjadipadasaatatausetelahdemam
menurunyaituantaraharisakitke37.Pasienseringkalimengeluhnyeridaerahperutsaat
sebelum syok timbul. Syok yang terjadi selama periode demam, biasanya mempunyai
prognosis buruk. Syok harus secara tepat agar tidak masuk dalam syok berat (profound
shock).Lamasyoksingkatsehinggapasiendapatmeninggaldalamwaktu1224jamatau
menyembuh.Tatalaksanashockyangtidakadekuatdapatmenyebabkanasidosismetabolik,
hipoksia,perdarahangastrointestinalberatdenganprognosisburuk.Sebaliknyajikashock
diatasidengancepatdansegera,makapasienakansembuhdalam23haridannafsumakan
membaikyangmenunjukkanprognosisbaik.Terjadinyakejangdenganhiperpireksiadisertai
penurunankesadaranpadabeberapakasusseringmengelabuisehinggaditegakkandiagnosis
kemungkinanensefalitis.1

VI. DIAGNOSIS

Anamnesis

Demammerupakantandautama,terjadimendadaktinggi,selama27hari
Disertailesu,tidakmaumakan,danmuntah
Padaanakbesardapatmengeluhnyerikepala,nyeriotot,dannyeriperut
Diarekadangkadangdapatditemukan
Perdarahanpalingseringdijumpaiadalahperdarahankulitdanmimisan.3

PemeriksaanFisik

GejalaklinisDBDdiawalidemammendadaktinggi,facialflush,muntah,nyeri
kepala,nyeriototdansendi,nyeritenggorokdenganfaringhiperemis,nyeridibawah
lengkungigakanan.GejalapenyertatersebutlebihmencolokpadaDDdaripadaDBD
SedangkanhepatomegalidankelainanfungsihatilebihseringditemukanpadaDBD.
PerbedaanantaraDDdanDBDadalahpadaDBDterjadipeningkatanpermeabilitas
kapilersehinggamenyebabkanperembesanplasma,hipovolemiadansyok
Perembesanplasmamengakibatkanekstravasasicairankedalamronggapleuradan
ronggaperitonealselama2448jam.
Fasekritissekitarharike3hinggake5perjalananpenyakit.Padasaatinisuhuturun,
yangdapatmerupakanawalpenyembuhanpadainfeksiringannamunpadaDBD
beratmerupakantandaawalsyok.
Perdarahandapatberupapetekie,epistaksis,melena,ataupunhematuria.3

Tandatandasyok

Anakgelisah,sampaiterjadipenurunankesadaran,sianosis
Nafascepat,naditerabalembutkadangkadangtidakteraba
Tekanandarahturun,tekanannadi<10mmHg
Akraldingin,capillaryrefillmenurun
Diuresismenurunsampaianuria
Apabilasyoktidakdapatsegeradiatasi,akanterjadikomplikasiberupaasidosis
metabolicdanperdarahanhebat.3
BerdasarkankriteriaWHO1997diagnosisDBDditegakkanbilasemuahaldibawah
inidipenuhi:1

Demamatauriwayatdemamakut,antara27hari,biasanyabifasik
Terdapatminimalsatudarimanifestasiperdarahanberikut:
o Ujibendungpositif
o Petekie,ekimosis,ataupurpura
o Perdarahanmukosa(terseringepistaksisatauperdarahangusi)
o Hematemesisataumelena
Trombositopenia(jumlahtrombosit<100.000/ul)
Terdapat minimal satu tandatanda plasma leakage (kebocoran plasma) sebagai
berikut:
o Peningkatanhematokrit>20%dibandingkanstandarsesuaidenganumurdan
jeniskelamin
o Penurunan hematokrit >20% setelah mendapat terapi cairan, dibandingkan
dengannilaihematokritsebelumnya
o Tandakebocoranplasmasepertiefusipleura,asitesatauhipoproteinemi.

DerajatpenyakitDBDdiklasifikasikandalam4derajat:2

DerajatI : Demam disertai gejala tidak khas dan satusatunya manifestasi


perdarahanadalahujitourniquet.
DerajatII : Seperti derajat I, disertai perdarahan spontan di kulit dan atau
perdarahanlain.
DerajatIII :Didapatkankegagalansirkulasiyaitunadicepatdanlambat,tekanan
nadimenurun(20mmHgataukurang)atauhipotensi,sianosisdisekitarmulut,kulit
dingindanlembab,dananaktampakgelisah.
DerajatIV :Syokberat(profoundshock),naditidakdapatdirabadantekanan
darahtidakterukur.

VII. PEMERIKSAANPENUNJANG

Laboratorium

Darahperifer,kadarhemoglobin,leukosit&hitungjenis,hematokrit,trombosit.Pada
apusandarahperiferjugadapatdinilailimfositplasmabiru,peningkatan15%
menunjangdiagnosisDBD
Ujiserologis,ujihemaglutinasiinhibisidilakukansaatfaseakutdanfasekonvalesens
o Infeksiprimer,serumakut<1:20,serumkonvalesensnaik4xataulebih
namuntidakmelebihi1:1280
o Infeksisekunder,serumakut<1:20,konvalesens1:2560;atauserumakut
1:20,konvalesensnaik4xataulebih
o Persangkaaninfeksisekunderyangbaruterjadi(presumptivesecondary
infection):serumakut1:1280,serumkonvalesensdapatlebihbesaratausama
Pemeriksaanradiologis(urutanpemeriksaansesuaiindikasiklinis)
o Pemeriksaanfotodada,dilakukanatasindikasi(1)dalamkeadaanklinisragu
ragu,namunperludiingatbahwaterdapatkelainanradiologispada
perembesanplasma2040%,(2)pemantauanklinis,sebagaipedoman
pemberiancairan.
o Kelainanradiologi,dilatasipembuluhdarahparuterutamadaerahhiluskanan,
hemitorakskananlebihradioopakdibandingkankiri,kubahdiafragmakanan
lebihtinggidaripadakanan,danefusipleura.
o USG:efusipleura,ascites,kelainan(penebalan)dindingvesicafeleadan
vesicaurinaria.3

VIII. PENATALAKSANAAN

PasienDDdapatberobatjalansedangkanpasienDBDdirawatdiruangperawatan
biasa. Tetapi pada kasus DBD dengan komplikasi diperlukan perawatan intensif. Untuk
dapat merawat pasien DBD dengan baik, diperlukan dokter dan perawat yang terampil,
sarana laboratorium yang memadai, cairan kristaloid dan koloid, serta bank darah yang
senantiasasiapbiladiperlukan.Diagnosisdinidanmemberikannasehatuntuksegeradirawat
bilaterdapattandasyok,merupakanhalyangpentinguntukmengurangiangkakematian.Di
pihak lain, perjalanan penyakit DBD sulit diramalkan. Pasien yang pada waktu masuk
keadaanumumnyatampakbaik,dalamwaktusingkatdapatmemburukdantidaktertolong.
KuncikeberhasilantatalaksanaDBD/SSDterletakpadaketrampilanparadokteruntukdapat
mengatasimasaperalihandarifasedemamkefasepenurunansuhu(fasekritis,fasesyok)
denganbaik.1

1. DemamDengue
Pasien DD dapat berobat jalan, tidak perlu dirawat. Pada fase demam pasien
dianjurkan:1

Tirahbaring,selamamasihdemam.
Obatantipiretikataukompreshangatdiberikanapabiladiperlukan.
Dianjurkanpemberiancairandanelektrolitperoral,jusbuah,sirop,susu,disampingair
putih,dianjurkanpalingsedikitdiberikanselama2hari.
Monitorsuhu,jumlahtrombositdanhematokritsampaifasekonvalesen.
PadapasienDD,saatsuhuturunpadaumumnyamerupakantandapenyembuhan.
Meskipundemikiansemuapasienharusdiobservasiterhadapkomplikasiyangdapatterjadi
selama2harisetelahsuhuturun. Halinidisebabkanolehkarenakemungkinankitasulit
membedakanantaraDDdanDBDpadafasedemam.Perbedaanakantampakjelassaatsuhu
turun,yaitupadaDDakanterjadipenyembuhansedangkanpadaDBDterdapattandaawal
kegagalan sirkulasi (syok). Komplikasi perdarahan dapat terjadi pada DD tanpa disertai
gejalasyok.Olehkarenaitu,orangtuaataupasiendinasehatibilaterasanyeriperuthebat,
buang air besar hitam, atau terdapat perdarahan kulit serta mukosa seperti mimisan,
perdarahan gusi, apalagi bila disertai berkeringat dingin, hal tersebut merupakan tanda
kegawatan,sehinggaharussegeradibawasegerakerumahsakit.Padapasienyangtidak
mengalamikomplikasisetelahsuhuturun23hari,tidakperlulagidiobservasi.1

2. DemamBerdarahDengue

KetentuanUmum

PerbedaanpatofisilogikutamaantaraDD/DBD/SSDdanpenyakitlainadalahadanya
peningkatan permeabilitas kapiler yang menyebabkan perembesan plasma dan gangguan
hemostasis.GambaranklinisDBD/SSDsangatkhasyaitudemamtinggimendadak,diastesis
hemoragik, hepatomegali, dan kegagalan sirkulasi. Maka keberhasilan tatalaksana DBD
terletakpadabagianmendeteksisecaradinifasekritisyaitusaatsuhuturun(thetimeof
defervescence)yangmerupakanfaseawalterjadinyakegagalansirkulasi,denganmelakukan
observasi klinis disertai pemantauan perembesan plasma dan gangguan hemostasis.
PrognosisDBDterletakpadapengenalanawalterjadinyaperembesanplasma,yangdapat
diketahuidaripeningkatankadarhematokrit.Fasekritispadaumumnyamulaiterjadipada
hari ketiga sakit. Penurunan jumlah trombosit sampai <100.000/l atau kurang dari 12
trombosit/lpb(rataratadihitungpada10lpb)terjadisebelumpeningkatanhematokritdan
sebelum terjadi penurunan suhu. Peningkatan hematokrit 20% atau lebih mencermikan
perembesanplasmadanmerupakanindikasiuntukpemberiancairan.Larutangaramisotonik
atau ringer laktat sebagai cairan awal pengganti volume plasma dapat diberikan sesuai
denganberatringanpenyakit.Perhatiankhususpada kasusdenganpeningkatanhematokrit
yangterusmenerusdanpenurunanjumlahtrombosit<50.000/l.SecaraumumpasienDBD
derajatIdanIIdapatdirawatdiPuskesmas,rumahsakitkelasD,Cdanpadaruangrawat
seharidirumahsakitkelasBdanA.1

FaseDemam

Tatalaksana DBD fase demam tidak berbeda dengan tatalaksana DD, bersifat
simtomatik dan suportif yaitu pemberian cairan oral untuk mencegah dehidrasi. Apabila
cairanoraltidakdapatdiberikanolehkarenatidakmauminum,muntahataunyeriperutyang
berlebihan, maka cairan intravena rumatan perlu diberikan. Antipiretik kadangkadang
diperlukan,tetapiperludiperhatikanbahwaantipiretiktidakdapatmengurangilamademam
padaDBD.1

DosisParasetamolMenurutKelompokUmur

Umur(tahun) Parasetamol(tiapkalipemberian)

dosis(mg) Tablet(1tab=500mg)
<1 60 1/8

13 60125 1/81/4
46 125250 1/41/2
712 250500 1/21
>12 5001000 12

Rasa haus dan keadaan dehidrasi dapat timbul sebagai akibat demam tinggi,
anoreksiadanmuntah.Jenisminumanyangdianjurkanadalahjusbuah,airtehmanis,sirup,
susu,sertalarutanoralit.Pasienperludiberikanminum50ml/kgBBdalam46jampertama.
Setelahkeadaandehidrasidapatdiatasianakdiberikancairanrumatan80100ml/kgBB
dalam 24 jam berikutnya. Bayi yang masih minum asi, tetap harus diberikan disamping
larutan oralit. Bila terjadi kejang demam, disamping antipiretik diberikan antikonvulsif
selamademam.1

Pasien harus diawasi ketat terhadap kejadian syokyang mungkin terjadi. Periode
kritisadalahwaktutransisi,yaitusaatsuhuturunpadaumumnyaharike35fasedemam.
Pemeriksaankadarhematokritberkalamerupakanpemeriksaanlaboratoriumyangterbaik
untukpengawasanhasilpemberiancairanyaitumenggambarkanderajatkebocoranplasma
danpedomankebutuhancairanintravena.Hemokonsentrasipadaumumnyaterjadisebelum
dijumpaiperubahantekanandarahdantekanannadi.Hematokritharusdiperiksaminimal
satu kali sejak hari sakit ketiga sampai suhu normal kembali. Bila sarana pemeriksaan
hematokrit tidak tersedia, pemeriksaan hemoglobin dapat dipergunakan sebagai alternatif
walaupuntidakterlalusensitif.1

UntukPuskesmasyangtidakadaalatpemeriksaanHt,dapatdipertimbangkandengan
menggunakanHb.SahlidenganestimasinilaiHt=3xkadarHb.1

PenggantianVolumePlasma

DasarpatogenesisDBDadalahperembesanplasma,yangterjadipadafasepenurunan
suhu(faseafebris,fasekrisis,fasesyok)makadasarpengobatannyaadalahpenggantian
volumeplasmayanghilang.Walaupundemikian,penggantiancairanharusdiberikandengan
bijaksana dan berhatihati. Kebutuhan cairan awal dihitung untuk 23 jam pertama,
sedangkanpadakasussyokmungkinlebihsering(setiap3060menit).Tetesandalam2428
jamberikutnyaharusselaludisesuaikandengantandavital,kadarhematokrit,dan jumlah
volume urin. Penggantian volume cairan harus adekuat, seminimal mungkin mencukupi
kebocoranplasma.Secaraumumvolumeyangdibutuhkanadalahjumlahcairanrumatan
ditambah58%.1

Cairanintravenadiperlukan,apabila(1)terusmenerusmuntah,tidakmauminum,
demam tinggi sehingga tidak rnungkin diberikan minum per oral, ditakutkan terjadinya
dehidrasisehinggamempercepatterjadinyasyok.(2)Nilaihematokritcenderungmeningkat
padapemeriksaanberkala.Jumlahcairanyangdiberikantergantungdariderajatdehidrasi
dankehilanganelektrolit,dianjurkancairanglukosa5%didalamlarutanNaCl0,45%.Bila
terdapat asidosis, diberikan natrium bikarbonat 7,46% 12 ml/kgBB intravena bolus
perlahanlahan.1

Apabilaterdapathemokonsentrasi20%ataulebihmakakomposisijeniscairanyang
diberikanharussamadenganplasma.Volumedankomposisicairanyangdiperlukansesuai
cairanuntukdehidrasipadadiareringansampaisedang,yaitucairanrumatan+defisit6%(5
sampai8%).1

KebutuhanCairanpadaDehidrasiSedang(defisitcairan58%)

BeratBadanWaktuMasukRS Jumlahcairan

(kg) ml/kgberatbadanperhari
<7 220
711 165
1218 132
>18 88

Pemilihanjenisdanvolumecairanyangdiperlukantergantungdariumurdanberat
badanpasiensertaderajatkehilanganplasma,yangsesuaidenganderajathemokonsentrasi.
Padaanakgemuk,kebutuhancairandisesuaikandenganberatbadanidealuntukanakumur
yangsama.1

KebutuhanCairanRumatan

BeratBadan(kg) Jumlahcairan(ml)
10 100perkgBB
1020 1000+50xkg(diatas10kg)
>20 1500+20xkg(diatas20kg)

Misalnyauntukberatbadan40kg,makacairanrumatanadalah1500+(20x20)=1900
ml.Jumlahcairanrumatandiperhitungkan24jam.Olehkarenaperembesanplasmatidak
konstan(perembesanplasmaterjadilebihcepatpadasaatsuhuturun),makavolumecairan
penggantiharusdisesuaikandengankecepatandankehilanganplasma,yangdapatdiketahui
daripemantauankadarhematokrit.Penggantianvolumeyangberlebihandanterusmenerus
setelah plasma terhenti perlu mendapat perhatian. Perembesan plasma berhenti ketika
memasukifasepenyembuhan,saatterjadireabsorbsicairanekstravaskularkembalikedalam
intravaskuler.Apabilapadasaatitucairantidakdikurangi,akanmenyebabkanedemaparu
dandistrespernafasan.1

Pasienharusdirawatdansegeradiobatibiladijumpaitandatandasyokyaitugelisah,
letargi/lemah, ekstrimitas dingin, bibir sianosis, oliguri, dan nadi lemah, tekanan nadi
menyempit(20mmHgataukurang)atauhipotensi,danpeningkatanmendadakdarikadar
hematokrit atau kadar hematokrit meningkat terus menerus walaupun telah diberi cairan
intravena.1

JenisCairan(rekomendasiWHO)

Kristaloid

Larutanringerlaktat(RL)
Larutanringerasetat(RA)
Larutangaramfaali(GF)
Dekstrosa5%dalamlarutanringerlaktat(D5/RL)
Dekstrosa5%dalamlarutanringerasetat(D5/RA)
Dekstrosa5%dalam1/2larutangaramfaali(D5/1/2LGF)
(Catatan:UntukresusitasisyokdipergunakanlarutanRLatauRAtidakboleh

larutanyangmengandungdekstran)1

Koloid

Dekstran40,plasma,albumin.1

3. SindromSyokDengue

Syokmerupakankegawatan.Cairanpenggantiadalahpengobatanyangutamayang
bergunauntukmemperbaikikekuranganvolumeplasma.Pasienanakakancepatmengalami
syokdan sembuhkembalibiladiobatisegeradalam48jam.PadapenderitaSSDdengan
tensitakterukurdantekanannadi<20mmHgsegeraberikancairankristaloidsebanyak20
ml/kgBB/jamseiama30menit,bilasyokteratasiturunkanmenjadi10ml/kgBB.1

PenggantianVolumePlasmaSegera

Pengobatan awal cairan intravena larutan ringer laktat >20 ml/kg BB. Tetesan
diberikansecepatmungkinmaksimal30menit.Padaanakdenganberatbadanlebih,diberi
cairan sesuai berat BB ideal dan umur 10 mm/kg BB/jam, bila tidak ada perbaikan
pemberian cairan kristoloid ditambah cairan koloid. Apabila syok belum dapat teratasi
setelah 60 menit beri cairan kristaloid dengan tetesan 10 ml/kg BB/jam bila tidak ada
perbaikanstoppemberiankristaloiddan bericairankoloid(dekstran40atauplasma)10
ml/kgBB/jam.Padaumumnyapemberiankoloidtidakmelebihi30ml/kgBB.Maksimal
pemberian koloid 1500 ml/hari, sebaiknya tidak diberikan pada saat perdarahan. Setelah
pemberian cairan resusitasi kristaloid dan koloid syok masih menetap sedangkan kadar
hematokrit turun, diduga sudah terjadi perdarahan; maka dianjurkan pemberian transfusi
darahsegar.Apabilakadarhematokrittetap>tinggi,makaberikandarahdalamvolumekecil
(10 ml/kgBB/jam) dapat diulang sampai 30 ml/kgBB/24 jam. Setelah keadaan klinis
membaik,tetesaninfusdikurangibertahapsesuaikeadaanklinisdankadarhematokrit.1

KadarHematokrituntukMemantauPenggantianVolumePlasma

Pemberian cairan harus tetap diberikan walaupun tanda vital telah membaik dan
kadarhematokritturun.Tetesan cairan segeraditurunkan menjadi10ml/kgBB/jam dan
kemudiandisesuaikantergantungdarikehilanganplasmayangterjadiselama2448jam.
PemasanganCVPyangadakadangkalapadapasienSSDberat,saatinitidakdianjurkanlagi.
1

Cairanintravenadapatdihentikanapabilahematokrittelahturun,dibandingkannilai
Htsebelumnya.Jumlahurin/ml/kgBB/jamataulebihmerupakanindikasibahwakeadaaan
sirkulasimembaik.Padaumumnya,cairantidakperludiberikanlagisetelah48jamsyok
teratasi. Apabila cairan tetap diberikan dengan jumlah yang berlebih pada saat terjadi
reabsorpsiplasmadariekstravaskular(ditandaidenganpenurunankadarhematokritsetelah
pemberian cairan rumatan), maka akan menyebabkan hipervolemia dengan akibat edema
paru dan gagal jantung. Penurunan hematokrit pada saat reabsorbsi plasma ini jangan
dianggap sebagai tanda perdarahan, tetapi disebabkan oleh hemodilusi. Nadi yang kuat,
tekanan darah normal, diuresis cukup, tanda vital baik, merupakan tanda terjadinya fase
reabsorbsi.1

KoreksiGangguanMetabolikdanElektrolit

Hiponatremia dan asidosis metabolik sering menyertai pasien DBD/SSD, maka


analisis gas darah dan kadar elektrolit harus selalu diperiksa pada DBD berat. Apabila
asidosistidakdikoreksi,akanmemacuterjadinyaKID,sehinggatatalaksanapasienmenjadi
lebihkompleks.1

Pada umumnya, apabila penggantian cairan plasma diberikan secepatnya dan


dilakukankoreksiasidosisdengannatriumbikarbonat,makaperdarahansebagaiakibatKID,
tidakakantejadisehinggaheparintidakdiperlukan.1

PemberianOksigen

Terapi oksigen 2 liter per menit harus selalu diberikan pada semua pasien syok.
Dianjurkanpemberianoksigendenganmempergunakanmasker,tetapiharusdiingatpula
padaanakseringkalimenjadimakingelisahapabiladipasangmaskeroksigen.1

TransfusiDarah

Pemeriksaan golongan darah crossmatching harus dilakukan pada setiap pasien


syok, terutama pada syok yang berkepanjangan (prolonged shock). Pemberian transfusi
darahdiberikanpadakeadaanmanifestasiperdarahanyangnyata.Kadangkalasulituntuk
mengetahui perdarahan interna (internal haemorrhage) apabila disertai hemokonsentrasi.
Penurunanhematokrit(misalnyadari50%menjadi40%)tanpaperbaikankliniswalaupun
telah diberikan cairan yang mencukupi, merupakan tanda adanya perdarahan. Pemberian
darahsegardimaksudkanuntukmengatasipendarahankarenacukupmengandungplasma,
seldarahmerahdanfaktorpembesartrombosit.Plasmasegardanataususpensitrombosit
bergunauntukpasiendenganKIDdanperdarahanmasif.KIDbiasanyaterjadipadasyok
berat dan menyebabkan perdarahan masif sehingga dapat menimbulkan kematian.
Pemeriksaan hematologi seperti waktu tromboplastin parsial, waktu protombin, dan
fibrinogen degradation products harus diperiksa pada pasien syok untuk mendeteksi
terjadinya dan berat ringannya KID. Pemeriksaan hematologis tersebut juga menentukan
prognosis.1

Monitoring

Tandavitaldankadarhematokritharusdimonitordandievaluasisecarateraturuntuk
menilaihasilpengobatan.Halhalyangharusdiperhatikanpadamonitoringadalah:1

Nadi,tekanandarah,respirasi,dantemperaturharusdicatatsetiap1530menitataulebih
sering,sampaisyokdapatteratasi.
Kadarhematokritharusdiperiksatiap46jamsekalisampaikeadaanklinispasienstabil.
Setiappasienharusmempunyaiformulirpemantauan,mengenaijeniscairan,jumlah,dan
tetesan,untukmenentukanapakahcairanyangdiberikansudahmencukupi.
Jumlahdanfrekuensidiuresis.
Kriteriamemulangkanpasienapabilatidakdemamselama24jamtanpaantipiretik,
nafsumakanmembaik,tampakperbaikansecaraklinis,hematokritstabil,trombosit>50.000
dancenderungmeningkatsertatidakditemukannyadistresspernafasan(efusipleuraatau
asidosis).1

DBDtanpasyok(derajatIdanII)
Medikamentosa

Antipiretikdapatdiberikan,dianjurkanpemberianparasetamolbukanaspirin.
Diusahakantidakmemberikanobatobatyangtidakdiperlukan(misalnyaantasid,
antiemetik)untukmengurangibebandetoksikasiobatdalamhati.
KortikosteroiddiberikanpadaDBDensefalopati,apabilaterdapatperdarahansaluran
cernakortikosteroidtidakdiberikan.
AntibiotikdiberikanuntukDBDensefalopati.3
Suportif

Mengatasikehilangancairanplasmasebagaiakibatpeningkatanpermeabilitaskapiler
danperdarahan.
Kuncikeberhasilanterletakpadakemampuanuntukmengatasimasaperalihandari
fasedemamkefasesyokdisebuttimeoffeverdiffervesencedenganbaik.
Cairanintravenadiperlukan,apabila(1)anakterusmenerusmuntah,tidakmau
minum,demamtinggi,dehidrasiyangdapatmempercepatterjadinyasyok,(2)nilai
hematokritcenderungmeningkatpadapemeriksaanberkala.3

DBDdisertaisyok(SindromSyokDengue,derajatIIIdanIV)

Penggantianvolumeplasmasegera,cairanintravenalarutanringerlaktat1020
ml/kgbbsecarabolusdiberikandalamwaktu30menit.Apabilasyokbelumteratasi
tetapberikanringerlaktat20ml/kgbbditambahkoloid2030ml/kgbb/jam,maksimal
1500ml/hari.
Pemberiancairan10ml/kgbb/jamtetapdiberikan14jampascasyok.Volumecairan
diturunkanmenjadi7ml/kgbb/jam,selanjutnya5ml,dan3mlapabilatandavitaldan
diuresisbaik.
Jumlahurin1ml/kgbb/jammerupakanindikasibahwasirkulasimembaik.
Padaumumnyacairantidakperludiberikanlagi48jamsetelahsyokteratasi.
Oksigen24l/menitpadaDBDsyok.
KoreksiasidosismetabolikdanelektrolitpadaDBDsyok.
Indikasipemberiandarah:
Terdapatperdarahansecaraklinis
o Setelahpemberiancairankristaloiddankoloid,syokmenetap,hematokritturun,
didugatelahterjadiperdarahan,berikandarahsegar10ml/kgbb
o Apabilakadarhematokrittetap>40vol%,makaberikandarahdalamvolume
kecil
o Plasmasegarbekudansuspensitrombositbergunauntukkoreksigangguan
koagulopatiataukoagulasiintravaskulardesiminata(KID)padasyokberatyang
menimbulkanperdarahanmasif.
o PemberiantransfusisuspensitrombositpadaKIDharusselaludisertaiplasma
segar(berisifaktorkoagulasiyangdiperlukan),untukmencegahperdarahanlebih
hebat.3

Mengingat pada saat awal pasien datang, kita belum selalu dapat menentukan
diagnosis DD/DBD dengan tepat, maka sebagai pedoman tatalaksana awal dapat dibagi
dalam3bagian,yaitu:3

1. TatalaksanakasustersangkaDBD,termasukkasusDD,DBDderajatIdanDBDderajat
IItanpapeningkatankadarhematokrit.
2. Tatalaksana kasus DBD, termasuk kasus DBD derajat II dengan peningkatan kadar
hematokrit.
3. Tatalaksanakasussindromsyokdengue,termasukDBDderajatIIIdanIV.
Faktorrisikoterjadinyakomplikasi:3
Ensefalopatidengue,dapatterjadipadaDBDdengansyokatupuntanpasyok.
Kelainanginjal,akibatsyokberkepanjangandapatterjadigagalginjalakut.
Edemparu,seringkaliterjadiakibatoverloadingcairan

Kriteriamemulangkanpasien:3
Tidakdemamselama24jamtanpaantipiretik
Nafsumakanmembaik
Secaraklinistampakperbaikan
Hematokritstabil
Tigaharisetelahsyokteratasi
Jumlahtrombosit>50.000/ml
Tidakdijumpaidistrespernapasan
BABV

DAFTARPUSTAKA

1. SoedarmoSSP,GarnaH,HadinegoroSRS,atariHI.InfeksiVirusDengue.In:Buku
AjarInfeksi&PediatriTropis.2nded.2008.p.15580.Jakarta:BadanPenerbitIDAI.

2. Nelson WE, Behrman RE, Kliegman R, Arvin AM. Infeksi Virus:


Arbovirus. In: Nelson Ilmu Kesehatan Anak. Ed 15 th. Vol 1. 2000. p.
1132-5. WB Saunders Company: Philadelphia, Pennsylvania.
3. PudjiadiAH,HegarB,HandryastutiS,IdrisNS,GandaputraEP,HarmoniatiED.
InfeksiVirusDengue.In:PedomanPelayananMedisIkatanDokterAnakIndonesia.
p.1419.Jakarta:BadanPenerbitIDAI.