Anda di halaman 1dari 22

Laporan Kasus

STEMI KILLIP I

Diajukan Sebagai Salah Satu Tugas Dalam Menjalani Kepaniteraan Klinik Senior Pada
Bagian/SMF Kardiologi Fakultas Kedokteran Unsyiah
RSUDZA Banda Aceh

oleh
Kusnadi
1507101030174

Pembimbing
Dr. dr. T. Heriansyah, Sp.JP(K), FIHA

BAGIAN/SMF KARDIOLOGI
FAKULTAS KEDOKTERAN UNIVERSITAS SYIAH KUALA
RUMAH SAKIT UMUM dr. ZAINOEL ABIDIN
BANDA ACEH

1
BAB I
PENDAHULUAN

Infark miokard adalah perkembangan cepat dari nekrosis otot jantung yang

disebabkan oleh ketidakseimbangan antara suplai dan kebutuhan oksigen. Klinis sangat

mencemaskan karena sering berupa serangan mendadak umumya pada pria 3555 tahun,

tanpagejalapendahuluan.Lokasidanluasnyamiokardinfarktergantungpadaarteriyang

oklusidanalirandarahkolateral.1Infark miokard akut merupakan salah satu diagnosis rawat

inap tersering di negara maju. Laju mortalitas awal (30 hari) pada IMA adalah 30% dengan

lebih dari separuh kematian terjadi sebelum pasien mencapai Rumah Sakit. Walaupun laju

mortalitas menurun sebesar 30% dalam dua dekade terakhir, sekitar satu di antara 25 pasien

yang tetap hidup pada perawatan awal, meninggal dalam tahun pertama setelah IMA.2

Infark miokard akut merupakan bagian dari spektrum sindrom koroner akut (SKA)

yang terdiri atas angina pektoris tak stabil, IMA tanpa elevasi ST, dan IMA dengan elevasi

ST. Infark miokard akut dengan elevasi ST (STEMI) terjadi jika aliran darah koroner

menurun secara mendadak akibat oklusi trombus pada plak aterosklerotik yang sudah ada

sebelumnya. Trombus arteri koroner terjadi secara cepat pada lokasi injuri vaskuler, dimana

injuri ini dicetuskan oleh faktor-faktor seperti merokok, hipertensi, dan akumulasi lipid. 2

Tahun 2013, 478.000 pasien di Indonesia didiagnosa Penyakit Jantung Koroner. Saat ini,

prevalensi STEMI meningkat dari 25% ke 40% dari presentasi Infark Miokard.3

Infark miokard akut ST-elevasi (STEMI) merupakan oklusi total dari arteri koroner

yang menyebabkan area infark yang lebih luas meliputi seluruh ketebalan miokardium, yang

ditandai dengan adanya elevasi segmen ST pada EKG. Infark miokard akut non ST-elevasi

(NSTEMI): oklusi sebagian dari arteri koroner tanpa melibatkan seluruh ketebalan

miokardium, sehingga tidak ada elevasi segmen ST pada EKG.4

2
STEMI merupakan bagian dari Acute Coronary Syndrome (ACS), yang

menggambarkan cedera miokard transmural, akibat oklusi total arteri koronor oleh thrombus.

Bila tidak dilakukan revaskularisasi segera, maka akan terjadi nekrosis miokard yang

berhubungan linear dengan waktu. Maka dikenalah paradigma time is muscule yang berarti

bila tidak dilakukan reperfusi segera, maka otot jantung tidak akan diselamatkan. Paradigma

ini menekan perlunya reperfusi sedini mungkin.4

DiagnosisSTEMIditegakkandariditemukannyachestpain,STsegmenelevasiatau

diperkirakan adanya left bundle branch block (LBBB) yang baru pada gambaran EKG

(kompleksQRSpadasadapanyangmerekanventrikelkiri(I,AVL,V5,V6),gelombangR

akanmelebarpadapuncakatauberlekukdanpadasadapanyangmerekamventrikelkanan

akan menunjukkan gelombang S yang dalam, lebar dan terbalik) serta ditemukannya

peningkatanenzimyangmenunjukanterjadinyanekrosismiokard(troponinT,CKMB).5(6)

DiagnosisinfarkmiokardjenisNSTEMIadalahnyeridadaberupaperasaanterbakar,

nyeri tumpul, rasa penuh, berat atau tertekan di substernal atau epigastrium. Pada EKG

didapatkan ST segmen depression dan T wave inverted. Selanjutnya juga didapatkan

peningkatanbiomarkerkerusakanmiokardyaitupeningkatantroponindalam34jamdan

CKMB.5

Diagnosis kerja infark miokard harus telah dibuat berdasarkan riwayat nyeri dada

yang berlangsung selama 20 menit atau lebih yang tidak membaik dengan pemberian

nitrogliserin. Adanya riwayat PJK dan penjalaran nyeri ke leher, rahang bawah atau lengan

kanan memperkuat dugaan ini. Pengawasan EKG perlu dilakukan pada setiap pasien dengan

dugaan STEMI. Diagnosis STEMI perlu dibuat sesegera mungkin melalui perekaman dan

interpretasi EKG 12 sadapan, selambat-lambatnya 10 menit dari saat pasien tiba untuk

mendukung penatalaksanaan yang berhasil. Gambaran EKG yang atipikal pada pasien

3
dengan tanda dan gejala iskemia miokard yang sedang berlangsung menunjukkan perlunya

tindakan segera.6

DalampenatalaksanaanSTEMIdapatdiakukanprarumahsakit,dirumahsakitdan

pascarumahsakit.TatalaksanaIMAdenganelevasiSTsaatinimengacupadadatadatadari

evidence based berdaarkan penelitian randomized cinical trial yang terus berkembang

ataupunconsensusdariparaahlisesuaipedoman(guideline).7(7)Klasifikasisindromkoroner

akut akan mempercepat dan mempermudah identifikasi pasien STEMI, oklusi total arteri

coroner,yangmemerlukanvaskularisasisegera.Penangananfaseawalsinromcoronerakut

adalahmenurunkankonsumsioksigen,pemberianantiplateletdanpemantauanyangintensif

secaraterusmenerus.8

4
BAB II
TINJAUAN PUSTAKA

2.1 Definisi

Infark miokard akut adalah suatu keadaan dimana otot jantung tiba-tiba tidak

mendapat suplai darah akibat penyumbatan mendadak arteri koroner oleh gumpalan darah

karena pecahnya plak.Terbendungnya aliran darah menghambat darah yang kaya oksigen

mencapai bagian otot jantung yang disuplai oleh arteri tersebut yang dapat mengakibatkan

kerusakan pada otot jantung. Aliran darah di pembuluh darah terhenti setelah terjadi

sumbatan koroner akut, kecuali sejumlah kecil aliran kolateral dari pembuluh darah di

sekitarnya. Daerah otot di sekitarnya yang sama sekali tidak mendapat aliran darah atau

alirannya sangat sedikit sehingga tidak dapat mempertahankan fungsi otot jantung, dikatakan

mengalami infark.9

Sindrom koroner akut merupakan terminology yang digunakan pada keadaan

gangguan aliran darah darah koroner parsial hingga total ke miokard secara akut. Berbeda

dengan angina pectoris stabil, gangguan aliran darah ke miokard pada SKA bukan disebabkan

oleh penyempitan yang statis namun terutama akibat pembentukan thrombus dalam arteri

coroner yang bersifat dinamis, sehingga gejala yang timbul berupa nyeri dada tiba-tiba

dengan intensitas nyeri yang dinamis sesuai dengan derajat penyempitan yang dipengaruhi

oleh komponen vasospasme arteri koroner dan terutama oleh ukuran trombusnya. Trombus,

terbentuk karena adanya ruptur/erosi plak aterosklerotik. Trombus tersebut bersifat dinamis,

dengan episode pembentukan, pembesaran, dan lisis terjadi secara bersamaan namun tidak

seimbang. Pada keadaan ini pembentukan trombus lebih dominan dari proses lisis, sehingga

terjadi episode peningkatan penyempitan atau bahkan oklusis arteri koroner dengan dampak

iskemia hingga infark jaringan miokard.8

5
2.2 Patofisiologi

Secara teoritis infark miokard disebabkan oleh:

Trombosis Koroner. Penelitian angiografi segera setelah timbulnya keluhan dan studi

postmortem pasien MI menunjukkan lebih dari 85% mendapatkan oklusi trombus

pada arteri penyebab (culprit artery). Trombus yang terbentuk merupakan campuran

trombus putih dan trombus merah.9


Retakan plak. Trombosis koroner umumnya dihubungkan dengan retakan plak.

Perubahan tiba-tiba dari angina stabil menjadi tidak stabil atau infark miokard

umumnya berhubungan dengan retakan plak pada titik tempat tekanan shear stressnya

tinggi dan sering dihubungkan dengan plak aterosklerosis ringan. Plak yang robek

kemudian merangsang agregasi trombosit yang selanjutnya akan membentuk

trombus.9
Spasme arteri koroner. Perubahan tonus pembuluh darah koroner melalui NitricOxide

(NO) endogen dapat mengubah ambang rangsang angina antara satu pasien dengan

yang lain, serta antara satu saat dengan saat lain. Beberapa faktor yang dapat

mempengaruhi tonus arteri yaitu hipoksia, katekolamin endogen, dan zat vasoaktif

(serotonin, adenosine diphosphat).9

STEMI umumnya terjadi jika aliran darah koroner menurun secara mendadak setelah

oklusi trombus pada plak arterosklerosik yang sudah ada sebelumnya. Stenosis arteri koroner

berat yang berkembang secara lambat biasanya tidak memicu STEMI karena berkembangnya

banyak kolateral sepanjang waktu. STEMI terjadi jika trombus arteri koroner terjadi secara

cepat pada lokasi injury vaskular, dimana injury ini dicetuskan oleh faktor-faktor seperti

merokok,hipertensi dan akumulasi lipid.10

Pada sebagian besar kasus, infark terjadi jika plak arterosklerosis mengalami fisur,

ruptur atau ulserasi dan jika kondisi lokal atau sistemik memicu trombogenesis, sehingga

6
terjadi trombus mural pada lokasi ruptur yang mengakibatkan oklusi arteri koroner. Penelitian

histologis menunjukkan plak koroner cenderung mengalami ruptur jika mempunyai fibrous

cap yang tipis dan inti kaya lipid (lipid rich core). Pada STEMI gambaran patologis klasik

terdiri dari fibrin rich red trombus, yang dipercaya menjadi dasar sehingga STEMI

memberikan respon terhadap terapi trombolitik.10

Selanjutnya pada lokasi ruptur plak, berbagai agonis (kolagen, ADP, efinefrin,

serotonin) memicu aktivasi trombosit, yang selanjutnya akan memproduksi dan melepaskan

tromboxan A2 (vasokontriktor lokal yang poten). Selain aktivasi trombosit memicu

perubahan konformasi reseptor glikoprotein IIb/IIIa.Setelah mengalami konversi fungsinya,

reseptor mempunyai afinitas tinggi terhadap sekuen asam amino pada protein adhesi yang

larut (integrin) seperti faktor von Willebrand (vWF) dan fibrinogen, dimana keduanya adalah

molekul multivalen yang dapat mengikat 2 platelet yang berbeda secara simultan,

menghasilkan ikatan silang platelets dan agregasi. 10

Kaskade koagulasi di aktivasi oleh pajanan tissue factor pada sel endotel yang rusak.

Faktor VII dan X di aktivasi, mengakibatkan konversi protrombin menjadi trombin, yang

kemudian mengkonversi fibrinogen menjadi fibrin. Arteri koroner yang terlibat kemudian

akan mengalami oklusi oleh trombus yang terdiri agregat trombosit dan fibrin. Pada kondisi

yang jarang, STEMI dapat juga disebabkan oleh emboli koroner, abnormalitas kongenital,

spasme koroner dan berbagai penyakit inflamasi sistemik.10

2.3 Gejala Klinis

7
Gejala-gejala umum infark miokard adalah nyeri dada retrosternal. Pasien sering

mengeluh rasa ditekan atau dihimpit, yang lebih dominan dibanding rasa nyeri. Keluhan -

keluhan yang mengarah pada infark miokard antara lain:

Rasa tekanan yang tidak nyaman, rasa penuh, diremas, atau nyeri dada retrosternal

dalam beberapa menit, sehingga penderita memegang dadanya atau yang lebih

dikenal sebagai Levine sign, yang merupakan tanda khas untukpenderita pria.11
Nyeri yang menjalar ke bahu, leher, satu atau kedua tangan atau rahang bawah, ke

punggung.11
Nyeri dada yang disertai rasa sempoyongan, mau jatuh, berkeringat, atau mual

muntah (khas untuk infark miokard inferior).11


Sesak napas yang tidak dapat dijelaskan, yang dapat terjadi dengan atau tanpa nyeri

dada; seperti pada penderita dengan riwayat diabetes atau hipertensi yang mengeluh

nyeri perut.11

2.4 Diagnosa

Penegakan diagnosa pasien dimulai dari anamnesis, pemeriksaan fisik, dan

pemeriksaan penunjang.

1. Anamnesis
Pasien tampak cemas dan tidak bisa beristirahat (gelisah) dengan ekstremitas

pucat disertai keringat dingin. Kombinasi nyeri dada substernal >30 menit dan

banyak keringat merupakan kecurigaan kuat adanya STEMI.12

2. Pemeriksaan fisik
Kondisi umum pasien infark miokard dapat pucat, berkeringat banyak, atau

gelisah. Nadi dapat berupa aritmia, bradikardi, atau takikardi; yang perlu

diperhatikan jika pasien akan diberi -blocker. Penderita infark miokard dapat

mengalami hipertensi akibat respon nyeri hebat atau hipotensi akibat syok

kardiogenik. Peningkatan tekanan vena jugularis umumnya ditemukan pada

penderita infark miokard ventrikel kanan. Pada auskultasi, bunyi jantung dapat

8
bervariasi sesuai komplikasi yang timbul akibat infark miokard; misalnya mitral

regurgitasi dengan murmur pansistolik dan S1 yang lemah atau VSD dengan

murmur pansistolik yang kerasdan tinggi dan S1 yang normal.12


3.
Pemeriksaan Penunjang

Elektrokardiografi
Temuan EKG 12 leadpada infark miokard menurut evolusinya dapat berupa

gelombang T hiperakut, perubahan segmen ST, dan gelombang Q patologis.

Menurut lokasi anatomis infark miokard temuan abnormalitas EKG adalah

sebagai berikut:
- Dinding inferior: lead II, III, dan aVF
- Dinding anterior: lead V1-V4
- Dinding lateral: lead I, aVL, V5-V6
- Ventrikel kanan: lead V1R-V6R
- Dinding posterior: lead V7-V9

Pada NSTEMI temuan EKG dapat normal, ST depression, T flat, atau T

inversion, oleh karena itu diperlukan pemeriksaan serial untuk melihat

dinamika perubahannya. Perbedaan NSTEMI dan Unstable Angina Pectoris

adalah pada hasil pemeriksaan biomarker jantung.12

Biomarker Jantung:
- Kriteria biomarker jantung untuk mendiagnosis MI
- CK-MB meningkat secara serial dan kemudian turun dengan perbedaan

dua hasil pemeriksaan lebih dari 25%


- CK-MB 10 13 U/L atau lebih dari 5% dari total aktivitas CK
- Pada dua pemeriksaan berbeda waktu minimal 4 jam didapatkan

peningkatanaktivitas CK-MB lebih dari 50%


- Pada satu pemeriksaan CK-MB didapatkan peningkatan dua kali lipat

nilai normal
- Lebih dari 72 jam didapatkan peningkatan Troponin T atau I, atau LDH-1

> LDH-2.12

9
2.5 Tata Laksana
a. Oksigen12
Oksigen diberikan pada semua pasien infark miokard. Pemberian oksigen mampu

mengurangi ST elevasi pada infark anterior. Berdasarkan konsensus, dianjurkan

memberikan oksigen dalam 6 jam pertama terapi. Pemberian oksigen lebih dari 6

jam secara klinis tidak bermanfaat, kecuali pada keadaan berikut :


- Pasien dengan nyeri dada menetap atau berulang atau dengan hemodinamik

yang tidak stabil


- Pasien dengan tanda-tanda edema paru akut
- Pasien dengan saturasi oksigen < 90% 12
2 Acetylsalicylic acid
Acetylsalicylic acid 160-325 mg dikunyah, untuk pasien yang belum mendapat

acetylsalicylic acid dan tidak ada riwayat alergi dan tidak ada bukti perdarahan

lambung saat pemeriksaan. Acetylsalicylic acid supositoria dapat digunakan pada

pasien dengan mual, muntah atau ulkus peptik, atau gangguan saluran cerna atas.12
3 Nitroglycerin
Tablet nitroglycerin sublingual dapat diberikan sampai 3 kali dengan interval 3-5

menit jika tidak ada kontraindikasi. Obat ini tidak boleh diberikan pada pasien

dengan keadaan hemodinamik tidak stabil, misalnya pada pasien dengan tekanan

diastolik 90 mmHg atau 30 mmHg lebih rendah dari pemeriksaan awal.

Nitroglycerin adalah venodilator dan penggunaannya harus secara hati-hati pada

keadaan infark inferior atau infark ventrikel kanan, hipotensi, bradikardi, takikardi,

dan penggunaan obat penghambat fosfodiesterase dalam waktu <24 jam.12


4 Morphine
Diberikan jika nitroglycerin sublingual tidak responsif. Morphine merupakan

pengobatan yang cukup penting pada infark miokard dengan alasan:


- Menimbulkan efek analgesik pada SSP yang dapat mengurangi

aktivitasneurohumoral dan menyebabkan pelepasan katekolamin


- Menghasilkan venodilatasi yang akan mengurangi beban ventrikel kiri

danmengurangi kebutuhan oksigen.


- Menurunkan tahanan vaskuler sistemik, sehingga mengurangi after load

ventrikel kiri.
- Membantu redistribusi volume darah pada edema paru akut.12

10
5 Terapi reperfusi awal
Sebelum melakukan terapi reperfusi awal harus dilakukan evaluasi sebagai berikut:
- Langkah I: Nilai waktu onset serangan, risiko STEMI, risiko fibrinolisis dan

waktu yang diperlukan untuk transportasi ke ahli kateterisasi PCI yang tersedia.
- Langkah II: strategi terapi reperfusi fibrinolisis atau invasif. Terapi fibrinolisis

dilakukan jika onset < 3 jam, tidak tersedia pilihan terapi invasif; waktu doctor-

baloon atau door-baloon > 90 menit; door-baloon minus door-needle > 1 jam,

dan tidak terdapat kontraindikasi fibrinolisis. Terapi invasif (PCI) dilakukan jika

onset > 3 jam, tersedia ahli PCI, kontak doctorbaloon atau door-baloon <90

menit; doorbaloon minus door-needle < 1 jam. Terdapat kontraindikasi

fibrinolisis, termasuk risiko perdarahan intraserebral, pada STEMI risiko tinggi

(CHF, Killip 3) atau diagnosis STEMI diragukan.12


6 Low Molecular Weight Heparin (misalnya enoxaparin)
Indikasi: STEMI, NSTEMI, angina tidak stabil ; pada STEMI digunakan sebagai

terapi tambahan fibrinolitik. Mekanisme kerja: menghambat thrombin secara tidak

langsung melalui kompleks antithrombin III Dibandingkan dengan unfractionated

heparin lebih selektif pada penghambatan faktor Xa.12


7 Clopidogrel dapat menggantikan acetylsalicylic acid bila pasien alergi

terhadapacetylsalicylic acid.12
8 Pemberian dosis awal clopidogrel 300 mg (loading dose) dilanjutkan dengan dosis

pemeliharaan 75 mg/hari merupakan terapi tambahan selain acetylsalicylic acid,

UFH atau LMWH dan GP IIb/IIIa. Mekanisme kerja clopidogrel adalah sebagai

antiplatelet, antagonis reseptor adenosine diphosphat.12


9 Statin (MHG Coenzyme A Reductase Inhibitor) mengurangi insiden reinfark, angina

berulang, rehospitalisasi, dan stroke bila diberikan dalam beberapa hari setelah infark

miokard. Pemberian dapat dilakukan lebih awal (dalam 24 jam) pada infark miokard

dan bila sudah mendapatkan statin sebelumnya maka terapi dilanjutkan.12


10 Terapi complete heart block
Keadaan bradikardi akibat complete heart block dengan hemodinamik tidak stabil

harus disiapkan untuk pemasangan pacu jantung transkutan atau transvena. Sambil

11
menunggu persiapan pacu jantung dapat dipertimbangkan pemberian atropine 0,5 mg

i.v dengan dosis maksimal 3 mg i.v. Selain itu dapat dipertimbangkan pemberian

epinefrin dengan dosis 2-10 g/menit atau dopamine 2-10 g/kgBB/menit.12

BAB III
LAPORAN KASUS

3.1 Identitas Pasien

Nama : T.n AS

Usia : 55 tahun

Jenis kelamin : Laki-laki

Alamat : Kec Bandar Dua, Kab Pidie Jaya

Pekerjaan : Swasta

Agama : Islam

Suku : Aceh

Status Perkawinan : Menikah

No. CM : 1-11-96-78

Tanggal masuk Rumah Sakit : 30 Januari 2017

Tanggal pemeriksaan : 31 Januari 2017

3.2 Anamnesis

Keluhan utama

Nyeri dada.

Keluhan tambahan

Pusing

Riwayat penyakit sekarang :

12
Pasien datang rujukan dari RSUD Sigi dengan keluhan utama nyeri dada
sebelah kiri sudah dirasakan 4 jam sebelum masuk RSUZA. Nyeri dada terasa
tertusuk dan tertimpa beban yang makin memberat namun tidak dapat ditunjuk
dengan satu jari, tidak hilang dengan istirahat tida dipengaruhi dengan menarik dan
menghembuskan napas. Pasien mengaku ini merupakan kejadian pertama kalinya.
Pasien juga mengeluh pusing sesaat nyeri dada muncul.

Riwayat penyakit dahulu

Pasien mengyangkal pernah mengalami riwayat hipertensi, DM, nyeri dada


sebelumnya (-).

Riwayat penyakit keluarga

Tidak ada dikeluarga pasien menderita penyakit yang sama.

Riwayat penggunaan obat


Pasien tida pernah mengkonsumsi obat-obatan.
Saat di RSU Sigli os mendapatan oabat yang diletakan di bawah lidah, namun

nyeri tidak banyak perubahan.

Riwayat kebiasaan sosial


Pasien merupakan pensiunan tentara yang saat mudah rutin berolahraga,

namun seja umur 40-an pasien sudah sangat jarang berolahraga.


Pasien merokok selama 25 tahun sebanyak 20 batang/hari.

Pemeriksaan umum
Kesadaran : Compos Mentis
Vital sign
TD : 106/60 mmHg
Nadi : 84 kali/menit

RR : 20 kali/menit

Suhu : 36,6 C

3.3 Pemeriksaan Fisik

13
Kepala : normocephali
Mata : konjungtiva palpebral inferior pucat (-/-), sklera ikterik (-/-)
Telinga : normotia, serumen (-/-)
Hidung : NCH (-), sekret (-)
Mulut : sianosis (-), mukosa bibir lembab (+)
Leher : pembesaran KGB (-), JVP R-2 cmH2O
Thorax :
Inspeksi : simetris
Palpasi : nyeri tekan (-), SF kanan = SF kiri
Perkusi : sonor (+/+) di seluruh lapangan paru
Auskultasi : ves (+/+), rh (-/-) basah halus, wh (-/-)

Cor :
Inspeksi : Ictus cordis tak tampak
Palpasi : Ictus teraba di ics 5 midclavicula
Perkusi : Batas jantung kanan di linea parasternalis dekstra batas jantung kiri di
ICS V linea midclacicula sinistra
Auskultasi : Bunyi jantung I>II, regular (+), bising(-)

Abdomen :
Inspeksi : simetris, distensi (-)
Palpasi : soepel, nyeri tekan (-), hepar/lien/renal tidak teraba
Perkusi : timpani
Auskultasi : peristaltik (+) , bising usus (-)

Ekstremitas:
Ekstremitas superior : sianosis(-/-), edema(-/-), pucat(-/-), akral dingin (-/-)
Ekstremitas inferior : sianosis(-/-), edema(-/-), pucat(-/-), akral dingin(-/-)

3.4 Pemeriksaan Penunjang

EKG (31 Januari 2017)

Interpretasi EKG :

Ritme : sinus

14
Rate : 83 x/menit

Axis : Normoaxis

P Wave : 0,08 detik

P-R Interval : 0,12 detik

Kompleks QRS : 0,08 detik

ST elevasi : V2, V3, V4

Q Patologis : V1, V2, V3, V4

ST depresi : negatif

T inverted : (-)

Kesimpulan : sinus ritme, infark anterior ekstensif

RONTGEN THORAKS AP

Laboratorium darah (10 November 2016)

JenisPemeriksaan Hasil NilaiRujukan

15
Hemoglobin 15,9gr/dL 14,017,0gr/dL
Hematokrit 48%
4555%
Eritrosit 5,6x103/mm3
Leukosit 11,1x103/mm3 4,76,1x103/mm3
Trombosit 237x103/mm3
4,510,5x103/mm3
Eos/Bas/N.Bat/N.Seg/Lim/Mon 10/0/0/61/22/7
Na/K/Cl 138/4,2/102mmol/L 150450x103/mm3
GlukosaDarahPuasa 201mg/dL
06/02/26/5070/2040/28%
GlukosaDarah2JamPP 352mg/dL
HbA1c 9,00% 135145/3,54,5/90110mmol/L
Ureum 27mg/dL
60110mg/dL
0,99mg/dL
Kreatinin
6,4mg/dL 100140mg/dL
AsamUrat
<6,5%
1343mg/dL
0,671,17mg/dL
3,57,2mg/dL

3.4 Diagnosis Kerja

STEMI Anterior Ekstensif

3.5 Terapi

a. Bed rest

b. O2 nasal kanul

c. Inj arixtra Sc 2,5 cc/hr

d. Nororapid 6-6-6

e. Brilinta 2x90 mg

f. Tanapres 1x5 mg

g. Atorvastatin 1x40 mg

h. Aspilet 1x80 mg

i. Isosorbid nitrat 3x5 mg

3.6 Prognosis

Quo ad Vitam : Dubia ad bonam

16
Quo ad Functionam : Dubia ad bonam

Quo ad Sanactionam : Dubia ad bonam

3.7 Follow up harian

Tanggal S O A Th
09-11- Sesak napas (-), TD : 104/62 STEMI j. Bed rest
2016 nyeri dada (-), mmHg anterolate
batuk berdahak HR : 54x/I, ral onset k. O2 2-4l/i nasal
H+1 (-), nyeri irregular 4 jam kanul
pinggang (+) RR : 23 x/i l. Inj arixtra Sc
Temp : 36,8 C 2,5 cc/hr
m. Nororapid 6-6-6
n. Brilinta 2x90
mg
o. Bisoprolol 1x5
mg
p. Tanapres 1x5
mg
q. Atorvastatin
1x40 mg
r. Aspilet 1x80 mg
s. Isosorbid nitrat
3x5 mg

10-11- Sesak napas (-), TD : 98/60 STEMI a. Bed rest


2016 nyeri dada (-), mmHg anterior
batuk berdahak HR : 57x/i, luas + b. O2 2-4l/i nasal
H+2 (-), nyeri irregular DM tipe kanul
pinggang (+) RR : 19x/i 2 c. Inj arixtra Sc
Temp : 36,8 C 2,5 cc/hr
P/ PCI:
rabu d. Nororapid 6-6-6
Kgds/ e. Brilinta 2x90
hari mg
f. Bisoprolol 1x5
mg
g. Tanapres 1x5
mg
h. Atorvastatin
1x40 mg

17
i. Aspilet 1x80 mg
j. Isosorbid nitrat
3x5 mg

11-11- Sesak napas (+), TD : 120/70 STEMI a. Bed rest


2016 pusing (+) mmHg anterolate
HR : 66x/I, ral onset b. O2 2-4l/i nasal
H+3 RR : 24 x/i 4 jam + kanul
Temp : 36,5 C Dm tipe 2 c. Inj arixtra Sc
2,5 cc/hr

P/ PCI d. Nororapid 6-6-6


(rabu) e. Brilinta 2x90
KGS/hari mg
: 174
mg/dl f. Bisoprolol 1x5
mg
g. Tanapres 1x5
mg
h. Atorvastatin
1x40 mg
i. Aspilet 1x80 mg
j. Isosorbid nitrat
3x5 mg

18
BAB III
ANALISA KASUS

Pada kasus ini diagnosis ditegakkan berdasarkan hasil anamnesis dan pemeriksaan
penunjang. Dari anamnesis pasien didapatkan keluhan nyeri dada, nyeri dada tembus ke
belakan. Hasil pemeriksaan EKG ditemukan irama sinus, dengan LAD, sementara gelombang
QRS rate 78 kali per menit. Oleh karena itu disimpulkan STEMI anterior ekstensif dengan
heart rate 78 kali per menit. Hal utama dalam mendiagnosis infark miokard meliputi
anamnesis, pemeriksaan EKG 12 lead, dan pemeriksaan biomarker jantung.

Berdasarkan hasil anamnesis, pemeriksaan fisik, dan pemeriksaan penunjang


didapatkan bahwa pasien mengalami infark miokard akut. Diagnosis miokard akut
ditegakkan berdasarkan keluhan yang dialami pasien yaitu nyeri dada semakin memberat,
menjalar kebagaian belakang sampai keleher dan kedua tangan disertai keringat dingin. Hal
ini sesuai dengan salah satu kriteria miokard akut yang makin bertambah berat. Gambaran
klinis infark miokard umumnya berupa nyeri dada substernum yang terasa berat, menekan,

19
seperti diremas-remas dan terkadang dijalarkan ke leher, rahang, epigastrium, bahu, atau
lengan kiri, atau hanya rasa tidak enak di dada. Nyeri pada IMA biasanya berlangsung
beberapa jam sampai hari, jarang ada hubungannya dengan aktivitas fisik dan biasanya tidak
banyak berkurang dengan pemberian nitrogliserin, nadi biasanya cepat dan lemah.

Dari anamnesis didapatkan juga bahwa pasien sering merokok Pasien merokok selama
25 tahun sebanyak 20 batang/hari.. Hal ini merupakan faktor resiko yang dapat menyebabkan
terbentuknya plak di arteri koroner. Terjadinya trombus disebabkan oleh rupture plak yang
kemudian diikuti oleh pembentukan thrombus oleh trombosit. Lokasi dan luasnya infark
miokard tergantung pada arteri yang oklusi dan aliran darah kolateral.

Pada injury miokard, area yang terlibat tidak berdepolarisasi secara sempurna. Area
tersebut lebih positif dibandingkan daerah yang normal pada akhir proses depolarisasi. Jika
elektroda diletakkan di daerah ini, maka potensial yang positif akan terekam dalam bentuk
elevasi segmen ST. Jika elektroda diletakkan di daerah sehat yang berseberangan dengan area
injury, maka terekam potensial yang negatif dan ditunjukkan dalam bentuk ST depresi. ST
depresi juga terjadi pada injury subendokard, dimana elektroda dipisahkan dari daerah injury
oleh daerah normal. Vektor ST bergerak menjauhi elektroda, yang menyebabkan gambaran
ST depresi. nekrosis miokard dilihat dari 12 lead EKG. Selama fase awal miokard infark
akut, EKG pasien yang mengalami oklusi total arteri koroner menunjukkan elevasi segmen
ST. Kemudian gambaran EKG berupa elevasi segmen ST akan berkembang menjadi
gelombang Q. Pada Kasus ini didapatkan ST-Elevasi pada I, aVL, V2-V3 maka dari itu kasus
ini dapat digolongkan STEMI.

Pada nekrosis miokard, protein intraseluler akan masuk dalam ruang interstitial dan
masuk ke sirkulasi sistemik melalui mikrovaskuler lokal dan aliran limfatik . Oleh sebab itu,
nekrosis miokard dapat dideteksi dari pemeriksaan protein dalam darah yang disebabkan
kerusakan sel. Protein-protein tersebut antara lain aspartate aminotransferase (AST), lactate
dehydrogenase, creatine kinase isoenzyme MB (CK-MB), mioglobin, carbonic anhydrase III
(CA III), myosin light chain (MLC) dan cardiac troponin I dan T (cTnI dan cTnT).
Peningkatan kadar serum protein-protein ini mengkonfirmasi adanya infark miokard.

20
DAFTAR PUSTAKA

1. Brown.T.Carol.2003.Penyakit Aterosklerotik Koroner dalam Patofisiologi Konsep


Kinis Proses-proses Penyakit.Jakarta: EGC

2. Sudoyo AW,Setyohadi B, Alwi I, Simodibrata M, Setati S. Buku Ajar Ilmu Penyakit


Dalam Edisi ke-5. Jakarta : Interna Publishing: Pusat Penelitian Ilmu Penyakit Dalam.
2009
3. Depkes Litbang. Riset Kesehatan Dasar. 2013
4. Morris F, Brady WJ. Acute Myocardial Infarction-Part I. In: Morris F, Edhouse J,
Brady WJ, Camm J eds. ABC of Clinical Electrocardiography 1st ed. London: BMJ
Books; 2003:29-32.
5. Reznik, AG. Morphology of acute myocardial infarction at prenecrotic stage.
Kardiologi. 2010; 50(1):48.

6. Perhimpunan Dokter Spesialis Kardiovaskular Indonesia, Pedoman Tatalaksana


Sindroma Koroner Akut, edisi ketiga. 2015

21
7. Libby P, Bonow RO, Mann DL, Zipes DP. Braunwalds Heart Disease : A textbook of
Cardiovascular Medicine. Philadephia: Elsevier; 2008.

8. Lily I. Rilantono. Penyakit Kardiovaskular (PKV). Badan Penerbit Fakultas


Kedokteran Universitas Indonesia. 2012.
9. Ryan TJ, Antman EM, Brooks NH, et al. ACC/AHA Pocket Guidelines for The
Management of Patients with Acute Myocadial Infarction. ACC & AHA ,Inc.; 2000:6-
11.
10. Irmalia.1996.Infark Miokard dalam Buku Ajar Kardiologi.Jakarta: fakultas
Kedokteran Universitas Indonesia.

11. Robbins SL, Cotran RS, Kumar V. Buku Ajar Patologi Robbins. Jakarta: EGC; 2007.

12. Alwi, Idrus. 2006. Tatalaksana Infark Miokard Akut Dengan Elevasi ST. dalam Buku
Ajar Ilmu Penyakit Dalam. Jakarta: FKUI

22