Anda di halaman 1dari 10

DIETETIK LANJUT

Kasus, NCP dan Menu Pasien Luka Bakar


DisusunDalamRangkaMemenuhiTugas Mata KuliahDietetikLanjutPada Semester Ganjil
TahunAjaran 2016/2017

Oleh:
Dian AnggrainiMaengkom P07131214086

PROGRAM STUDI DIPLOMA IV


JURUSAN GIZI
POLITEKNIK KESEHATAN KEMENTRIAN KESEHATAN BANJARMASIN
DESEMBER 2016
GAMBARAN UMUM PASIEN
A. Identitaspasien
Nama : Ny Y
Umur : 75 Tahun
Sex : Perempuan
Pekerjaan : Petani
Pendidikan : Tidaktamat SD
Agama : Islam
Tanggalmasuk : 11 05 2012
Tanggalkasus : 18 05 2012
No. RM : 03-03-46
Alamat : Pasekanlor RT 04/04 Gamping, Sleman
Dokter : dr. Sagiran, Sp.B
Diagnosis medis : Post combustio grade II
Ruangrawatinap: R.Firdaus 206/2
B. Data subyektif
1. Berkaitandenganriwayatpenyakit
a. Keluhanutama
1) terkena air panas, lukabakardidaerahbokong
b. Riwayatpenyakitsekarang
1) Pasienterpelesetdanjatuh di bakberisi air panassaatakanmandipagi.
terjadilukaakibatnyaterdapatlukabakar/ melepuhdibagianbokongCombustio
grade II.
c. Riwayatpenyakitdahulu
1) Keluargapasienmengatakantidakadariwayatpenyakitdahulu
d. Riwayatpenyakitkeluarga
1) Tidakadariwayatpenyakitdahulu
2. Berkaitandenganriwayatgizi
a. Data sosialekonomi
1) Penghasilan : Menengahkebawah
2) Jumlahkeluarga : 6 (5 anakdan 1 suami)
3) Suku : jawa
b. Aktifitasfisik
1) Jenispekerjaan : Tani
2) Jumlah jam kerja : Tidaktentu
3) Jenisolahraga: -
4) Frekuensiolahraga : -
5) Jumlah jam tidur : 9 jam
c. Alergimakan
1) Makanan : Tidakadaalergimakanan
2) Penyebab :-
3) Jenis diet kusus :-
4) Alasan :-
5) Yang menganjurkan : -
d. Masalah gastrointestinal
1) Nyeriuluhati : tidak
2) Mual : tidak
3) Muntah :-
4) Diare :-
5) Konstipasi :-
6) Anoreksia : Tidak
7) Perubahanpengecapan : Tidakada
8) Perubahanpenciuman : Tidakada
e. Penyakitkronik
1) Jenispenyakit : tidakada
2) Modifikasi diet :-
3) Jenisdan lama pengobatan : -
f. Kesehatanmulut/menelan
1) Sulitmenelan :-
2) Stomatitis :-
3) Gigi lengkap : Iya
g. Pengobatan
1) Vitamin/mineral/suplemengizi :-
2) Frekuensidanjumlah :-
h. Perubahanberatbadan
1) Bertambah/berkurang : tidakadaperubahanberatbadan
2) Lamanya :-
3) Disengaja/tidak :-
4) Mempersiapkanmakan : anakdankeluarga
i. Riwayatpolamakan
Makananpokok : nasi @2x/hari 100 g
Lauknabati : ayam @1x/minggu 50 g, ikan @2x/minggu 40 g
Lauknabati : tempe@3x/minggu 40 g, tahu @2x/minggu 50 g
Sayur : sawi @2x/minggu, bayam @2x/minggu, kacangpanjang
@3x/minggu
Buah : pisang @4x/minggu, semangka @2x/mingguTeh
2x/hari
C. Data subyektif
1. Antropometri
a. Satuminggusebelummasukrumahsakitmengikutiposyandulansia (tanggal 3 mei
2012)
b. Beratbadan : 36 kg
c. Tinggibadan : 150 cm
2. Biokimia
a. Pemeriksaanlaboratorium
Tanggal : 17-05-2012
b. Pemeriksaanpenunjang : tanggal 17 mei 2012
c. Ro toraxhasil :cardiomegalidenganpulmo DBN.
3. Fisikdanklinis
Keadaanumum :Composmentis
Vital sign :

4. Dietary
a. Anamnesis Gizi : Recall 24 jam di RumahSakit
b. Terapimedis

D. NUTRITIN CARE PROCES (NCP)


1. Nutrition Assesment
a) Antopometri
IMT = = 16 (status gizi kurus)

b) Biokimia
Leukosittinggi (infeksi), Hbrendah (Anemia)
c) Fisik/klinis
Keadaanumum :Coposmentis (tamapaklemas). 130/60
mmHg.Tekanandarahtinggiawalmasukrumahsakit
d) Dietary (riwayatmakan)

1) StandarasupanmakanmenurutDepkes 1999.
a) Lebih : > 120 %
b)Baik : 80 -120 %
c) Sedang : 70 - 79,9 %
d)Kurang : 60 69,9 %
e) Buruk : < 60%

2. Nutrition diagnosis
a) Diagnosis medis
1) Post Combustio grade II
b) Diagnosis gizi
1. NI.1.2 Asupan energy inadekuatberkaitandenganadanyainfeksidan status
gizikurusditandaidenganhasil recall energy burukyaitu 48,44% danIMT 16
kg/m2
2. NI.2.1 Asupan oral inadekuatberkaitandenganasupanmakanan yang
kurangditandaidenganhasil recall Energi 48,44% buruk, Protein 57,25%
buruk, Lemak 41,91% buruk, Karbohidrat 49,60% buruk.
3. NI.5.7.1 Asupan protein
inadekuatberkaitandenganinfeksidankerusakanjaringanakibatlukabakarditan
daidengan recall protein burukyaitu 57,25%.
4. NC.2.2 Perubahannilai lab berkaitandenganinfeksilukabakar yang
dideritadanadanya anemiaditandaidenganleukosit 24.6 rb/ultinggi(normal 4
- 10 rb/ul) danHbrendah 11,7 g/dl (normal 12-16 g/dl)
3. Nutrition Intervention
a) Perencanaan (planning)
1) Terapi diet
Jenisdiet : TETP
Bentukmakanan :Lunak
Cara pemberian : oral
2) Tujuan diet
a. Mengusahakandanmempercepatpenyembuhanjaringan yang rusak
b. Mencegahterjadinyakeseimbangan nitrogen yang negative
c. Memperkecilterjadinyahiperglikemiadanhipergliseridemia
d. Mencegahterjadinyagejala-gejalakekuranganzatgizimikro
3) Prinsip diet
a) Kebutuhan energy
dihitungdenganpertimbangankedalamandanluaslukabakar, yaitu :
Curreri : 25 kkal/kg BB aktial +40 kkal x % lukabakar
b) Protein tinggiyaitu 20-25% darikebutuhan energy total
c) Lemaksedangataucukupyaitu 15-20%darikebutuhan energy total
d) Karbohidratsedangataucukupyaitu 50-60% darikebutuhan energy total.
e) Vitamin diberkandiatas AKG yang
dianjurkanuntukmembantumempercepatpenyembuhan.
Ditambahkandalambentuksuplemen.
Vitamin A minimal 2 x AKG
Vitamin B minimal 2 x AKG
Vitamin C minimal 2 x AKG
Vitamin E 200 SI
f) Mineral besi, seng, natrium, kalium, kalsium, fosfordan magnesium
tinggi. Sebagian mineral diberikandalambentuksuplemen.
g) Cairantinggi.Pada 48 jampertama,
pemberiancairanditujukanuntukmengganticairan yang hilang agar
tidakterjadi shock.

4) Syarat diet
Energi : 1260kkal
Protein :63 g
Lemak : 28 g
Karbohidrat :189 g
Vitamin tinggiyaitu 2x AKG dan mineral tinggi
Cairantinggi

5) Perhitungankebutuhanenergidanzatgizi
BBI = (TB-100)
= 150-100)
= 50
= 50 Kg
Energi = 25 kkal/kg BB actual + 40 kkal x % lukabakar
= 25 x 36 + 40 x 9
= 1260 kkal
10% = 1134kkal -1386kkal
Protein = 20% x kebutuhan energy total
= 20%x 1260 kkal
= 252/4 kkal
= 63 gr
5% = 59,85g -66,15 g
Lemak = (20% kebutuhanenergy total)/9kkal
= (20% x 1260kkal)/9kkal
=28gr
5% = 26,6g -29,4g
Karbohidrat= (60% x kebutuhan energy total)/4kkal
= (60%x 1260kkal)/4kkal
= 189 gr
10% = 170,1g -207,9g

6) Rencana monitoring
a) Antropometri : Beratbadan
b) Biokimia : Leokosit, Hb
c) Fisikklinis : Tekanandarah
d) Dietary : AsupanzatgiziEnergi, Protein, lemak,karbohidrat
7) Rencanakonsultasigizi
a) Masalahgizi : Status gizikurang, anemia, asupanrendah,
lukabakarsehinggaterjadihipermetabolisme
b) materi : Pengaturanmakanan/ diet TETP
c) Sasaran : Pasiendankeluarga
d) Waktupelaksanaan : 10 -15 menit
e) Tempat : PKU Muhammadiyah YogyakartaUnit II
f) Media : Leaflet
(1) Tujuan
(a) MemberipengetahuankepadapasiententangdiitTETP
(b) Memberikanpengetahuantentanggizimakanan
(c) Memberikanmotivasikepadapasienuntukmeningkatkanasupan
makanan yang diberikan.
(2) Edukasigizi
(a) Menjelaskantentangtentangdiit TETP
(b) Menjelaskantentangbahanmakananpenukar.
(c) Menjelaskandiit yang
diberikankepadapasiententangmakanatinggiprotrinUntukmem
bantumempercepatpenyembuhan.
4. Implementasi (implementation)
a) Kajian diet RS
1) Jenis Diet : TKTP
2) Bentukmakanan : BA
3) Cara pemberian : Oral
b) Rekomendasi Diet
1) Jenis diet : diit TETP
2) Bentukmakanan : Lunak
3) Cara pemberian : Oral