Anda di halaman 1dari 59

CNMP

CONSELHO NACIONAL DO MINISTRIO PBLICO

TCNICO
ESPECIALIDADE: ADMINISTRAO

Lngua Portuguesa
Raciocnio Lgico-Matemtico
Legislao de Interesse Institucional
Noes de Direito Constitucional
Noes de Direito Administrativo
Noes de Oramento Pblico
Lei n. 8.112/1990
Noes de Direito Processual Civil
Noes de Administrao
Gesto de Pessoas
Noes de Gesto de Processos
Noes de Arquivologia
12/2014 Editora Gran Cursos

EDITORA GRAN CURSOS LTDA


SIG QUADRA 01, LOTE 975 BRASLIA-DF
CEP: 70.610 410
TEL: 0800 601 7770
faleconosco@editoragrancursos.com.br

AUTORES:
Bruno Pilastre / Mrcio Wesley
Roberto Vasconcelos
Gilcimar Rodrigues
Ivan Lucas
J.W. Granjeiro / Rodrigo Cardoso
Thiago Vesely
Talita Ramine
Z Carlos / Flavio de Sousa

PRESIDNCIA: J. W. Granjeiro

DIRETORIA EXECUTIVA: Ivonete Granjeiro

CONSELHO EDITORIAL: J. W. Granjeiro, Ivonete Granjeiro, Bruno Pilastre e Joo Dino

DIRETORA COMERCIAL: Ana Camila Oliveira

SUPERVISO DE PRODUO: Marilene Otaviano

DIAGRAMAO: Oziel Candido e Washington Nunes Chaves

REVISO: Juliana Garcs, Luciana Silva e Sabrina Soares

CAPA: Pedro Wgilson Granjeiro

TODOS OS DIREITOS RESERVADOS De acordo com a Lei n. 9.610, de 19.02.1998, nenhuma parte
deste livro pode ser fotocopiada, gravada, reproduzida ou armazenada em um sistema de recuperao de
informaes ou transmitida sob qualquer forma ou por qualquer meio eletrnico ou mecnico sem o prvio
consentimento do detentor dos direitos autorais e do editor.
LNGUA PORTUGUESA

DOMNIO DA ORTOGRAFIA OFICIAL. ..........................................................................................................50


EMPREGO DA ACENTUAO GRFICA. .......................................................................................................72
EMPREGO DOS SINAIS DE PONTUAO. ...................................................................................................107
FLEXO NOMINAL E VERBAL. ........................................................................................................................84
PRONOMES: EMPREGO, FORMAS DE TRATAMENTO E COLOCAO. .....................................90/97/106/125
DOMNIO DOS MECANISMOS DE COESO TEXTUAL. ................................................................................34
EMPREGO DE TEMPOS E MODOS VERBAIS. ..................................................................................................84
VOZES DO VERBO. .........................................................................................................................................91
CONCORDNCIA NOMINAL E VERBAL. .......................................................................................................91
REGNCIA NOMINAL E VERBAL. ....................................................................................................................95
SINTAXE. REDAO (CONFRONTO E RECONHECIMENTO DE FRASES CORRETAS E INCORRETAS). .........91
INTELECO DE TEXTO. COMPREENSO E INTERPRETAO DE TEXTOS DE GNEROS VARIADOS. ......... 6
RECONHECIMENTO DE TIPOS E GNEROS TEXTUAIS. .................................................................................19
COMUNICAES OFICIAIS (CONFORME MANUAL DE REDAO DA PRESIDNCIA DA REPBLICA).
ADEQUAO DA LINGUAGEM AO TIPO DE DOCUMENTO. ADEQUAO DO FORMATO DO TEXTO
AO GNERO. ..................................................................................................................................................121
COMPREENSO (OU INTELECO) E INTERPRETAO DE 2V SURVVLRQDLV GR GLUHLWR QmR WrP FRQVHJXLGR UHVLV-
TEXTOS tir tentao de fabricar alentados escritos abusando dos
recursos da informtica. Clientes incautos ainda so impres-
Iniciamos nossos trabalhos com o artigo de Fbio Ulhoa VLRQiYHLVHFDPRUJXOKRVRVFRPDUREXVWH]GDVSHoDVGH
Coelho, publicado no jornal Folha de So Paulo no dia 1 de seu advogado.
janeiro de 2013: Objetividade, conciso e comedimento. No Claro, h questes de grande complexidade, que

LNGUA PORTUGUESA
artigo, o autor observa que h em nossa Justia excesso H[LJHPGRVSURVVLRQDLVGRGLUHLWRPDLRUHVGLJUHVV}HVHIXQ-
de argumentos desimportantes, de linguagem redundante e damentaes, gerando inevitavelmente textos mais exten-
com adjetivos demais e de mesuras desmedidas. A leitura sos. Tamanho exagerado nem sempre, assim, sinnimo
do texto se faz importante pelo fato de ressaltar a importn- GHUXODRUHLRRXUDSDSp0DVpXPERPLQGLFDWLYRGHVWHV
cia da linguagem em nossa sociedade. vcios, porque os casos realmente difceis correspondem
PLQRULDHVmRIDFLOPHQWHUHFRQKHFLGRVSHORVSURVVLRQDLVGD
iUHD1mRVHMXVWLFDJUDQGHJDVWRGHSDSHOHWLQWDQDVLJQL-
No poderia ter sido mais feliz a receita para o aper-
FDWLYDPDLRULDGRVSURFHVVRVHPFXUVR
feioamento da Justia brasileira formulada pelo ministro
Pois bem. Se a receita do ministro Barbosa melhora a
Joaquim Barbosa, em seu objetivo, conciso e comedido dis-
-XVWLoDHQWmRDTXHVWmRSDVVDDVHUDLGHQWLFDomRGHPHGL-
curso de posse na presidncia do Supremo Tribunal Fede-
das de incentivo ao discurso objetivo, conciso e comedido.
ral. Para o novo presidente da Corte Suprema, precisamos
A renovao da linguagem jurdica necessita de vigorosos
GHXPD-XVWLoDVHPUXODVVHPRUHLRVHVHPUDSDSpV
estmulos.
)LUXODV VmR DUJXPHQWRV DUWLFLDOPHQWH FRPSOH[RV
Alegar que estimular maior objetividade fere o direito
usados como expediente diversionista, para impedir ou GHDFHVVRDR-XGLFLiULRRXjDPSODGHIHVDpUXOD/DPHQWDU
retardar a apreciao da essncia das questes em julga- que a conciso importa perda de certo tempero literrio das
mento (o mrito da causa). Apegos a detalhes formais sem SHoDV SURFHVVXDLV p RUHLR 2EMXUJDU TXH R FRPHGLPHQWR
LPSRUWkQFLDpXPH[HPSORGHUXOD agride a tradio rapap.
Floreios so exageros no uso da linguagem, oral ou Se a exortao do ministro Barbosa desencadear,
escrita. Expediente empregado em geral no disfarce da como se espera, a renovao da linguagem jurdica, a sua
falta de contedo do discurso, preenche-o de redundncias, posse na presidncia do Supremo Tribunal Federal se tor-
hiprboles e adjetivaes. nar ainda mais histrica.
E rapaps so mesuras desmedidas que mal escon-
dem um servilismo anacrnico. Todos devemos nos tratar Aps a leitura do texto de Fbio Ulhoa Coelho, veja-
com respeito e cordialidade, dentro e fora dos ambientes mos o que Evanildo Bechara nos diz sobre como analisar
judicirios, mas sempre com o virtuoso comedimento. um texto:
)LUXODV RUHLRV H UDSDSpV VmR SHUQLFLRVRV SRUTXH
redundam em inevitvel desperdcio de tempo, energia e Os dez mandamentos para a anlise de textos
recursos. Combater esses vcios de linguagem, por isso,
tem todo o sentido no contexto do aprimoramento da Justia. I Ler duas vezes o texto. A primeira para tomar con-
2 RSRVWR GD UXOD p D REMHWLYLGDGH R FRQWUiULR GRV tato com o assunto; a segunda para observar como
RUHLRVpDFRQFLVmRDQHJDomRGRVUDSDSpVpRFRPHGL- o texto est articulado; desenvolvido.
mento. A salutar receita do ministro Barbosa recomenda dis- II Observar que um pargrafo em relao ao outro
cursos objetivos, concisos e comedidos. So discursos que, pode indicar uma continuao ou uma concluso
alis, costumam primar pela elegncia. ou, ainda, uma falsa oposio.
eXPDUHFRPHQGDomRGLULJLGDDWRGRVRVSURVVLRQDLV III Sublinhar, em cada pargrafo, a ideia mais impor-
tante (tpico frasal).
jurdicos: magistrados, promotores e advogados. Precisam
IV Ler com muito cuidado os enunciados das questes
todos escrever e falar menos, para dizerem mais.
para entender direito a inteno do que foi pedido.
Arrazoados jurdicos e decises longas so relativa-
V Sublinhar palavras como: erro, incorreto, correto
mente recentes.
etc., para no se confundir no momento de respon-
Nas primeiras dcadas do sculo passado, elas ainda
der questo.
eram escritas mo. Isso por si s j estabelecia um limite
VI Escrever, ao lado de cada pargrafo, ou de cada
(por assim dizer, fsico) aos arroubos. Os pareceres de
estrofe, a ideia mais importante contida neles.
Clvis Bevilqua, o autor do anteprojeto do Cdigo Civil de VII No levar em considerao o que o autor quis dizer,
1916, tinham cerca de cinco ou seis laudas. mas sim o que ele disse; escreveu.
Depois, veio a mquina de escrever. Embora tenha tor- VIII Se o enunciado mencionar tema ou ideia principal,
nado a confeco de textos menos cansativa, ela tambm deve-se examinar com ateno a introduo e/ou a
impunha limites fsicos extenso. No tempo do manuscrito concluso.
HGDGDWLORJUDDRWDPDQKRGRWH[WRHUDVHPSUHSURSRUFLR- IX Se o enunciado mencionar argumentao, deve
nal ao tempo gasto na produo do papel. preocupar-se com o desenvolvimento.
O computador rompeu decididamente este limite. Com X Tomar cuidado com os vocbulos relatores (os que
R UHFRUWD H FROD GRV SURJUDPDV LQIRUPDWL]DGRV GH UHGD- remetem a outros vocbulos do texto: pronomes
o, produzem-se textos de extraordinrias dimenses em relativos, pronomes pessoais, pronomes demons-
alguns poucos segundos. trativos etc.).

5
Proponho, como exerccio, aplicar os Dez mandamen- a) Por isso, em nome de todos os comediantes e hu-
WRVjOHLWXUDGRWH[WRGH8OKRD moristas, gostaria de lanar este pequeno protesto,
9HMDPRVDJRUDFRPR%HFKDUDGHQHcompreenso e pois, sendo o prefeito uma autoridade governamen-
interpretao de texto: WDOFDPXLWRGLItFLOSDUDQyVSREUHVPRUWDLVigua-
lar-se jYHUYHRFLDO -{6RDUHVVeja, 24.05.1995,
Compreenso ou inteleco de texto p. 95). (Uso de forma de 3 pessoa do singular em
lugar da de 1 pessoa do plural).
BRUNO PILASTRE

Consiste em analisar o que realmente est escrito, b) Qual a personagem que mais lhe DWUDLQROPH"
ou seja, coletar dados do texto. O enunciado normalmente (O Estado de S. Paulo, 29.05.1995, D10). (Uso do
assim se apresenta: pronome oblquo dativo que indica objeto indireto
As consideraes do autor se voltam para... em lugar do pronome oblquo acusativo que
Segundo o texto, est correta... manifesta objeto direto).
De acordo com o texto, est incorreta... c) Nem os seguranas de Mrio Covas acreditam na
Tendo em vista o texto, incorreto... falta de cerimnia do patro. Que foi surpreendido
O autor sugere ainda... em pleno fua a fua no gabinete do Bandeirantes
De acordo com o texto, certo... com dois vendedores de plano de sade que ele
2DXWRUDUPDTXH prprio tinha autorizado a entrada (Folha de S. Pau-
lo, 10.04.1995, 5-2). (Uso inadequado do pronome
Interpretao de Texto relativo: o correto seria cuja entrada ele prprio ti-
nha autorizado).
Consiste em saber o que se infere (conclui) do que est d) Sobre a minha renovao de contrato com o So
escrito. O enunciado normalmente encontrado da seguinte Paulo, posso adiantar que j tivemos uma conversa
maneira: no sbado, onde j evoluiu bastante (Goleiro Zetti,
O texto possibilita o entendimento de que...
Programa Bate-bola, TV Gazeta, 31.01.1993). (Uso
Com apoio no texto, infere-se que...
do onde no lugar de que).
O texto encaminha o leitor para...
e) H momentos na vida que voc no pode errar
Pretende o texto mostrar que o leitor...
(Propaganda da Agroceres. Falta da preposio em
O texto possibilita deduzir-se que...
diante do relativo com funo de adjunto adverbial
de tempo).
Trs erros capitais na anlise de textos
f) Espero que o pessoal UHHWH VREUH R VLJQLFDGR
desta Copa do Mundo (Rivelino, Programa Apito
Para o gramtico, h trs erros capitais na anlise de
Final, 08.07.1990, TV Bandeirantes). (Uso do indi-
textos: extrapolao, reduo e contradio.
cativo pelo subjuntivo).
g) D licena que eu tenho que me lav a loua da
Extrapolao
janta. Se o Z descobre que dormi na cama dele,
me mata eu e me mata voc (Falas da novela A
o fato de se fugir do texto. Ocorre quando se interpreta
o que no est escrito. Muitas vezes so fatos reais, mas prxima vtima. Veja. 12.04.1995, p. 8).
que no esto expressos no texto. Deve-se ater somente ao
que est relatado. 2VHUURVDVHJXLUSUHMXGLFDPDFRPXQLFDomRSRLVR
OHLWRUFDVHPVDEHURTXHTXLVGL]HUTXHPHVFUHYHXDIUDVH
Reduo Vejamos alguns exemplos:
a) J houve o tempo da moreninha, da loirinha e ago-
o fato de se valorizar uma parte do contexto, dei- ra chegou a vez da ruivinha. A cor do cabelo, no
xando de lado a sua totalidade. Deixa-se de considerar o entanto, faz pouca diferena, pois a frmula para
texto como um todo para se ater apenas parte dele. conquistar jovens platias com um interesse maior
em sexo do que em msica. O segredo do sucesso
Contradio na msica pop um rostinho e um corpinho fe-
minino bonito e bem sensual (Folha de S. Paulo,
o fato de se entender justamente o contrrio do que 17.09.1989, apud Unicamp 1989). (Observe que, no
est escrito. bom que se tome cuidado com algumas pala- segundo pargrafo, a orao iniciada por pois no
YUDVFRPRSRGHGHYHQmRYHUERVHUHWF tem predicado: no se sabe de que frmula falava
Bechara, Evanildo. Gramtica escolar da lngua portuguesa. Rio de o enunciador).
Janeiro, 2006. (Com adaptaes) b) Embora as enchentes, todos os anos, continuem
a destruir cidades inteiras em algumas regies do
A propsito da noo de erro, SAVIOLI & FIORIN Nordeste, provocando prejuzos que chegam a mi-
  QD REUD 0DQXDO GR FDQGLGDWR SRUWXJXrV SXEOL- lhes de dlares. (Nesse perodo no h orao
cada pela Fundao Alexandre de Gusmo, apresentam a principal: a primeira orao iniciada por embora
seguinte anlise: subordinada adverbial concessiva; a segunda
Nos textos em que de rigor a utilizao da norma uma subordinada adverbial temporal reduzida de
culta, o uso das construes abaixo seria inaceitvel: gerndio).

6
Alm dos casos de agramaticalidade, constituem Escrevi crnica pedindo aos leitores que sugeris-
tambm erros as violaes de relaes discursivas, ou seja, sem formas do ex-deputado se matar e recebi cerca
de 1300 cartas com as propostas mais ilrias (O Es-
de relaes entre partes e segmentos do texto: por exemplo,
tado de S. Paulo, 22.05.1995, D2). (Aqui temos dois
o uso de conectores argumentativos inadequados, a criao problemas: hilria escreve-se com h; a forma corre-
de enunciados ambguos etc. Nesse caso, pode-se dizer WDGRDGMHWLYRTXHVLJQLFDTXHID]ULUphilariante).
que temos verdadeiras agramaticalidades discursivas. Veja-

LNGUA PORTUGUESA
mos alguns exemplos: b) Erro por imposio de uma tradio do ensino.
a) PC Farias responde a mais de 30 inquritos de Nesse caso, entram aqueles fatos lingusticos que
corrupo na Polcia Federal (Jornal Nacional, pertenciam norma culta da lngua, mas que se al-
30.11.1993). (Nesse caso, h uma ambiguidade: teraram e que a escola considera ainda como fatos
pode-se entender que PC Farias responde na Po- reais do portugus.
lcia Federal a 30 inquritos de corrupo ou res-
ponde a 30 inquritos por ter corrompido agentes O atraso no pagamento implicar em multa. (H
hoje uma oscilao na regncia do verbo implicar:
da Polcia Federal).
usado tanto como transitivo direto, quanto como
b) Os estudantes que pretendem ingressar na transitivo indireto com a preposio em; a nica re-
Unicamp, no prximo vestibular, concordam com gncia considerada correta pela tradio gramatical
o decreto do governo. Esto reclamando, apenas, sem a preposio).
que a Universidade de Campinas est exigindo a
leitura de um livro que entrar no exame inexistente Custei a perceber o problema. (O verbo custar, no
VHQWLGRGHVHUFXVWRVRpHQVLQDGRFRPRXQLSHV-
no Brasil: $ FRQVVmR GH /~FLR, de Mrio de S-
soal; s se considera correto custou-me perceber o
Carneiro. (Isto Senhor, 14.09.1989, apud Unicamp problema).
1989). (Pela posio em que foi colocado, o adjetivo
inexistente parece estar referindo-se a exame). No tenho nenhuma d de criminosos. (O substan-
c) O presidente americano [...] produziu um espetcu- tivo d ensinado como masculino).
ORFLQHPDWRJUiFRHPQRYHPEURSDVVDGRQD$UiELD
Saudita, onde comeu peru fantasiado de marine no Leia esta crnica de Raul Drewnick, publicada em O
mesmo bandejo em que era servido aos solda- Estado de S. Paulo, de 25.04.1995, em que um desses erros
dos americanos (Veja, 09.01.1991, apud Unicamp por imposio da tradio de ensino analisado com muita
graa.
1992). (Tem-se a impresso de que fantasiado se
refere a peru e de que o presidente era servido aos
A noite estava quase to gostosa quanto o chope e o
soldados).
salaminho. Na mesa do bar, os seis amigos, todos catedrti-
d) H meses no chove em Braslia. Portanto, o go-
cos em mulher e futebol, conversavam disso mesmo, porque
verno no pensa em racionamento de gua. (Nesse
no houve, no h e nunca haver assunto melhor para o
caso, completamente despropositado o uso do brasileiro do que mulher e futebol. Sharon Stone foi compa-
conector conclusivo portanto; o que se deveria era rada com Letcia Spiller. Romrio com Tlio. Anglica com
usar o adversativo mas). Xuxa, Viola com Edmundo e, depois de muito bate-boca, se
chegou quela concluso de sempre: nenhuma.
At o momento, vimos que trs fenmenos de natureza Duas horas mais tarde, j sob o efeito das rodadas de
diferente so considerados erros: chopinho que de dez em dez minutos o garom renovava,
a) desvio da norma adequada a uma dada situao de eles mudaram um pouco o debate. Comearam a compa-
comunicao; rar Sharon Stone com Romrio, Letcia Spiller com Tlio,
b) agramaticalidade da estrutura da frase ou do perodo; Anglica com Viola e Xuxa com Edmundo. Discutiram, exal-
c) violao de relaes discursivas. WDUDPVH TXDVH VH GHVHQWHQGHUDP H QR P FKHJDUDP DR
mesmo resultado do debate anterior: nenhum. No houve
vencedores. E vencidos, se houve, foram os chopinhos e os
H, no entanto, outros fenmenos distintos que tambm salaminhos, dizimados assim que se atreviam a aparecer.
so erros lingusticos. (VWDYDPIHOL]HV(IHOL]HVFDUDPDWpTXHXPGHOHVRPDLV
fofoqueiro dos seis, comeou a contar a histria de uma
a) (UURV GH RUWRJUDD$ RUWRJUDD p R FRQMXQWR GH garota, vizinha dele, famosa pelas curvas do corpo e pela
FRQYHQo}HV TXH UHJHP D JUDD GDV SDODYUDV (V- generosidade do corao.
sas convenes, no caso dos pases de lngua Vocs precisam conhecer a Adriana. um estouro,
um petardo, uma bomba atmica! Se ela sai de casa e vai
portuguesa, resultam de acordos entre os diferen-
at a esquina, a rua toda treme. Se ela vai um pouco mais
WHVSDtVHV$VQRUPDVGHRUWRJUDDVmRFRHUFLWLYDV
longe, explode todo o quarteiro.
para todos os falantes.
1RVVDHODpWXGRLVVRPHVPR"(QWmRDJHQWHSUH-
cisa conhecer.
Gosta de fama de bad boy (garoto mal) e faz tudo
Ela no tudo isso. tudo isso e mais um pouco.
o que pode para mant-la (Folha de S. Paulo,
11.06.1995, 4-5). (O adjetivo grafado com u (mau) Tudo isso e mais bastante. E ela topa qualquer parada. J
e o advrbio com I (mal)). namorou com o bairro inteiro.

7
Nesse ponto, o mais empertigado dos seis amigos arre- obras. No entanto, imagina-se que o sujeito seja
galou os olhos e perguntou, com expresso de espanto: UHFXUVRVVXFLHQWHVe que o verbo deva concordar
com ele).
2TXHIRLTXHYRFrGLVVH"
O galfo escapou-lhe das mos (como em certas ca-
Eu disse que a menina um avio e namora com
madas sociais troca-se o l por r, em palavras como
todo mundo. cala, maldade, calcanhar, pensa-se que a forma
2TXHpTXHYRFrHVWiHVWUDQKDQGR" correta de garfo seja galfo).
BRUNO PILASTRE

Eu estou estranhando que voc, um sujeito com ins-


truo, diga uma asneira como essa. d) Falsa anlise do enunciado. aquele erro cometi-
4XHDVQHLUD" do por uma anlise inadequada da frase, quando se
Que a menina namora com todo mundo. atribui a uma palavra ou expresso uma funo sin-
Mas verdade. A Adriana uma devoradora de ttica que ela no exerce, quando se estabelecem
homens. Dos 8 aos 80 no escapa um. relaes sintticas inexistentes, quando se realizam
No estou censurando o comportamento dela. Estou analogias improcedentes dentro do perodo. Veja-
indignado com o seu desconhecimento gramatical. mos alguns exemplos:
&RPRPHXGHVFRQKHFLPHQWRJUDPDWLFDO"9RFrSRGH
PHH[SOLFDULVVR" Vai chover multas na volta do feriado (Folha da
Voc disse que ela namora com. Tarde, 31.12.1992,1). (Nesse caso, atribui-se pa-
'LVVH(GDt" lavra, que o sujeito, a funo de objeto direto e,
por conseguinte, no se realiza a concordncia. A
Da que isso uma barbaridade. O verbo namorar
frase correta seria Vo chover multas na volta do
transitivo direto. feriado).
Quem namora, namora algum, no namora com
algum. Pode-se argumentar, certo, que eram previsveis
Enquanto o acusado de crime contra a gramtica os percalos que enfrentariam qualquer programa
assumiu um triste ar de ru para merecer a clemncia dos de estabilizao [...] necessrio no Brasil (Folha
amigos, um deles, quase to empertigado, quanto o gram- de S. Paulo, 07.10.1990, apud Unicamp 1991).
(Atribui-se ao pronome relativo que, que retoma o
tico de planto, protestou:
substantivo percalos, a funo de sujeito e no de
Espere a, Aristarco. Voc est massacrando o Cor- objeto direto e faz-se a concordncia do verbo com
deiro toa. O dicionrio do Aurlio diz que namorar com o antecedente percalos e no com o verdadeiro
perfeitamente vlido. sujeito qualquer programa de estabilizao).
Ah, Praxedes, eu no esperava que voc me viesse
com essa. Quando ele resolver apresentar-se, oferecer ex-
Voc sabe muito bem que o Aurlio no uma boa plicaes convincentes e obter o apoio da opinio
pblica, talvez seja inocentado (usa-se obter no
fonte. O Aurlio admite tudo: nis vai, nis fumo...
lugar de obtiver, porque os verbos que aparecem
Voc est querendo dizer, Aristarco, que voc tem
antes no futuro do subjuntivo, por serem regulares,
PDLVDXWRULGDGHGRTXHR$XUpOLR" DSUHVHQWDPXPDIRUPDLJXDOjGRLQQLWLYRRYHUER
No. O que eu estou querendo dizer que em irregular obter contagia-se da regularidade dos an-
nenhum outro dicionrio voc vai achar esse absurdo de teriores, sobretudo porque todos terminam em-er).
namorar com.
No incio do debate, o Cordeiro, que sem querer tinha 6RXFODUDHGHQLWLYDPHQWHSHODDGPLVVLELOLGDGHGR
provocado a confuso, ainda tentou acompanhar os argu- impeachment correndo o risco at do auto-suic-
dio poltico (Dep. Antnio Morimoto (PTB-RO) Folha
mentos dos dois gramticos, cada vez mais nervosos.
de S. Paulo, 24.09.1992, 1-4). (Analisa-se suicdio
Depois ele acabou dormindo, como os outros. Acordou FRPRXPWHUPRQmRUHH[LYRHSRULVVRDFUHVFHQ-
dali a dez minutos, com a voz trovejante de seu defensor, ta-se a ele auto, TXHVLJQLFDVLPHVPR 
o Praxedes. [...] Antes que o Aristarco, j rubro de clera,
apresentasse sua contraargumentao, o Cordeiro resolveu Muitas vezes, tambm a hipercorreo resulta de uma
mostrar-se grato ao seu advogado: falsa anlise do enunciado. A diferena, no entanto, que ela
isso a, Praxedes, voc est certo. Deixe de ser acaba resultando, para quem a pratica, numa regra de uso:
chato, Aristarco. por exemplo, certas pessoas nunca usam impessoalmente o
9RFr TXHU VDEHU GH XPD FRLVD" 1DPRUDU p WmR ERP verbo fazer indicando tempo passado (dizem sempre fazem
mas to bom, que at namorar contra gostoso. muitos dias e no faz muitos dias).

c) Hipercorreo. o uso de uma forma vista como e) Falsas analogias. So aquelas formas criadas por
correta no lugar de uma outra considerada indevi- analogia com as regularidades da lngua ou pelo
damente errada. Vejamos alguns exemplos: estabelecimento de correspondncias, que de fato
no existem, entre certas formas da lngua. Dife-
No havero UHFXUVRV VXFLHQWHV SDUD R WpUPLQR rentemente do caso anterior, no se trata aqui de
das obras. (O verbo haver, QR VHQWLGR GH H[LVWLU relaes indevidas estabelecidas entre termos no
impessoal. Portanto, a construo correta seria
interior de um perodo, mas da falsa pressuposio
1mRKDYHUiUHFXUVRVVXFLHQWHVSDUDRWpUPLQRGDV
de simetrias entre formas da lngua.

8
[Os astecas] no s conheciam o banho de vapor, O dom da oratria
to prezado na Europa, como mantiam o hbi-
to de banhar-se diariamente (Superinteressante, O pronunciamento do presidente Collor anteontem em
out. 1992, apud Unicamp 1993). (Usa-se mantiam cadeia nacional de rdio e TV despertou no ex-deputado
no lugar de mantinham, porque se faz a seguinte Jos Costa (PMDB) recordaes que coleciona para incluir
analogia: se comer faz a 3 pessoa do pretrito im- em um livro de memrias e casos polticos de Alagoas.
perfeito do indicativo comiam, vender faz vendiam, H alguns anos bem antes de algum pensar em

LNGUA PORTUGUESA
prender faz prendiam, ento manter faz mantiam). modernizar os portos o deputado federal Ozeas Cardoso,
amigo de Arnon de Mello, pai do presidente Collor, ajudou,
O governo interviu muito na economia nestes l- por uma circunstncia qualquer da vida, a categoria dos esti-
timos anos (usa-se interviu por interveio, porque vadores.
se faz a seguinte analogia: se partir tem, para a 3 Eram os tempos de guerra da velha UDN, partido do
pessoa do singular do pretrito perfeito do indica- deputado. Sensibilizados, os trabalhadores resolveram pro-
tivo, a forma partir tem; partiu, dormir tem dormiu, mover uma festa para agradecer a mozinha. O estivador
cair tem caiu, ento intervir tem interviu).
escolhido para falar na ocasio atendia pelo sugestivo ape-
OLGRGH4XHEUD3RVWH+RPHPVLPSOHVFRPHoRXVHGHV-
culpando por no saber falar direito a lngua ptria. Com
O novelo deslisou pelo cho (usa-se deslisar por
essa limitao, mas fazendo questo de expressar toda a
deslizar, porque se associa falsamente esse verbo
JUDWLGmRGDFDWHJRULD4XHEUD3RVWHUHVXPLXDPHQVDJHP
ao adjetivo liso; notese que existe, em portugus
em poucas palavras:
o verbo deslisar, PXLWRSRXFRXVDGRTXHVLJQLFD
6HXQRPHGHSXWDGRMiGL]WXGRWHPRRGHRQHVWR
DOLVDUHTXHQmRVHFRQIXQGHFRPRYHUERdesli-
HRFGHFLQFHUR Folha de S. Paulo, 23.06.1992)
zar, TXHTXHUGL]HUHVFRUUHJDUEUDQGDPHQWH 

f) Impropriedades lexicais. o uso de uma palavra


FRP XP VLJQLFDGR TXH HOD QmR WHP PDV TXH VH
atribui a ela indevidamente, em geral por uma se-
melhana fnica muito acentuada com o termo que
seria adequado.

Estaes de metr de mrmore, com lustres de


cristal, contrastam com a misria da populao. A
OX[~ULDde Moscou tem seu contraponto no silncio
GRPRVWHLUR'RQVNRLFULDGRQRQDOGRVpFXORe
um conjunto arquitetnico elegante e modesto
(O Estado de S. Paulo, 30/5/1995, G10). (Luxria, em portugus, no
VLJQLFDOX[RPDVVHQVXDOLGDGH 

Os erros ou inadequaes de linguagem no tm


todos o mesmo efeito: alguns prejudicam a compreenso
do texto; outros comprometem o enunciador.

As Foras Armadas brasileiras j esto treinando 3


mil soldados para atuar no Haiti depois da retirada
das tropas americanas. A Organizao das Naes
Unidas (ONU) solicitou o envio de tropas ao Brasil
e a mais quatro pases, disse ontem o presidente
da Guatemala, Ramiro de Len (O Estado de S.
Paulo, 24.09.1994, apud Unicamp 1995).

Nesse caso, a m colocao da expresso ao Brasil


e a mais quatro pases prejudica a compreenso do enun-
ciado, pois d a entender que a ONU solicitou o envio de
tropas ao Brasil e a mais quatro pases, quando na verdade
ela solicitou ao Brasil e a mais quatro pases que enviassem
tropas ao Haiti.
No caso abaixo, os erros lingusticos comprometem
o enunciador, pois criam dele a imagem de algum sem
qualquer intimidade com a lngua e, portanto, de algum
bastante rstico.

9
RACIOCNIO LGICO-MATEMTICO

SUM RIO

ESTRUTURA LGICA DE RELAES ARBITRRIAS ENTRE PESSOAS, LUGARES, OBJETOS OU EVEN-


TOS FICTCIOS; DEDUO DE NOVAS INFORMAES DAS RELAES FORNECIDAS E AVALIAO
DAS CONDIES USADAS PARA ESTABELECER A ESTRUTURA DAQUELAS RELAES. COMPREEN-
SO E ELABORAO DA LGICA DAS SITUAES POR MEIO DE: RACIOCNIO VERBAL, RACIO-
CNIO MATEMTICO, RACIOCNIO SEQUENCIAL, ORIENTAO ESPACIAL E TEMPORAL, FORMA-
O DE CONCEITOS, DISCRIMINAO DE ELEMENTOS. COMPREENSO DO PROCESSO LGICO
QUE, A PARTIR DE UM CONJUNTO DE HIPTESES, CONDUZ, DE FORMA VLIDA, A CONCLU-
SES DETERMINADAS. NMEROS INTEIROS E RACIONAIS: OPERAES (ADIO, SUBTRAO,
MULTIPLICAO, DIVISO, POTENCIAO); EXPRESSES NUMRICAS; MLTIPLOS E DIVISORES
DE NMEROS NATURAIS; PROBLEMAS. FRAES E OPERAES COM FRAES. NMEROS E
GRANDEZAS PROPORCIONAIS: RAZES E PROPORES; DIVISO EM PARTES PROPORCIONAIS;
REGRA DE TRS; PORCENTAGEM E PROBLEMAS..................................................................................... 142
PRINCPIOS DE CONTAGEM; PROBABILIDADE; ARRANJO; em seguida, apresentada uma segunda tela com
PERMUTAO E COMBINAO 6 novos conjuntos de 4 slabas distintas cada um,
dos quais apenas um contm a segunda slaba da
A partir de uma amostra de 1.200 candidatos a cargos senha do cliente, que deve, ento, selecionar esse
HPGHWHUPLQDGRFRQFXUVRYHULFRXVHTXHGHOHVVHLQV- conjunto;
creveram para o cargo A, 400 para B e 400 para cargos dis- QDOPHQWHpDSUHVHQWDGDXPDWHUFHLUDWHODFRP
tintos de A e de B. Alguns que se inscreveram para o cargo novos conjuntos de 4 slabas distintas cada um, dos
A tambm se inscreveram para o cargo B. quais apenas um contm a terceira slaba da senha
do cliente, que deve, ento, selecionar esse con-
A respeito dessa situao hipottica, julgue os itens junto.
subsecutivos.
A informao da senha silbica s ser considerada
1. (CESPE) Selecionando-se ao acaso dois candidatos
correta se cada uma das 3 slabas que compem essa
entre os 1.200, a probabilidade de que ambos tenham-
senha for informada na ordem solicitada: a primeira s-
-se inscrito no concurso para o cargo A ou para o cargo
laba dever estar no conjunto selecionado na primeira
B superior a 1/6.
tela; a segunda slaba, no conjunto selecionado na se-
gunda tela; e a terceira slaba, no conjunto selecionado
2. (CESPE) Menos de 180 candidatos se inscreveram no
na terceira tela.
concurso para os cargos A e B.

3. (IADES) Paulo e Maria utilizam o metr e embarcam Com base nessas informaes, julgue os dois prxi-
nas estaes de guas Claras e Guar, respectiva- mos itens.
mente. Hoje combinaram de embarcar no mesmo trem
para irem ao shopping. Assim que embarcou, Paulo 5. (CESPE) Se um indivduo conseguir visualizar e anotar
avisou a Maria, para que ela embarcasse no mesmo os 3 conjuntos de 4 slabas selecionados corretamente
RACIOCNIO LGICO-MATEMTICO

vago, mas esqueceu de avisar em qual estaria. Sa- por um cliente em um terminal de autoatendimento e,
bendo que a composio em que viajaram formada em seguida, listar todas as possibilidades para a se-
por 8 trens destinados aos passageiros, sendo um ex- nha silbica desse cliente, para, ento, escolher uma
clusivo para mulheres, a probabilidade de Maria em- dessas possveis senhas, a probabilidade de que essa
barcar no mesmo trem que Paulo : escolha coincida com a senha do correntista ser in-
a. menor que 9%. ferior a 0,01.
b. maior que 9% e menor que 11%.
c. maior que 11% e menor que 13%. 6. (CESPE) Se um cliente esquecer completamente a
d. maior que 13% e menor que 15%. sua senha silbica, a probabilidade de ele acert-la em
e. maior que 15%. uma nica tentativa, escolhendo aleatoriamente um
conjunto de slabas em cada uma das trs telas que
4. (IADES) A apresentadora do Oscar desse ano, Ellen forem apresentadas pelo terminal de autoatendimento,
DeGeneres, publicou em rede social um VHOH uma ser inferior a 0,005.
foto autotirada com celular por personagem nico ou,
no caso de grupo, por um dos integrantes em que ela 7. (ESAF) Para efetuar um determinado trabalho, 3 ser-
aparece com 10 estrelas de Hollywood, em uma com- vidores do DNIT sero selecionados ao acaso de um
posio no circular. Imagine que todas e apenas es- grupo com 4 homens e 2 mulheres. A probabilidade de
sas pessoas trocassem de posio entre si, de todos
serem selecionados 2 homens e 1 mulher igual a:
os modos possveis, e em cada novo posicionamento a. 55%
fosse feita uma foto de todos, e apenas uma. O nme- b. 40%
ro x de fotos diferentes obtido seria: c. 60%
a. x < 10.000. d. 45%
b. 10.000 < x < 50.000. e. 50%
c. 50.000 < x < 300.000.
d. 300.000 < x < 30.000.000. 8. (FUNRIO) Um professor entregou uma lista de exerc-
e. 30.000.000 > x. cios contendo dez questes para ser resolvida por cada
um dos vinte alunos de sua turma. Seis alunos con-
Para utilizar o autoatendimento de certo banco, o clien- seguiram resolver todas as questes da lista, dez alu-
te deve utilizar uma senha silbica composta por trs nos resolveram oito questes e os demais resolveram
slabas distintas. Para que possa acessar a sua conta apenas duas questes. Escolhendo-se aleatoriamente
em um caixa eletrnico, o cliente deve informar a sua um aluno e uma questo da lista, a probabilidade da
senha silbica da seguinte maneira: questo escolhida no ter sido resolvida igual a:
primeiramente, apresentada uma tela com 6 con- 17
a.
juntos de 4 slabas distintas cada um, dos quais 50
apenas um contm a primeira slaba da senha do
23
cliente, que deve, ento, selecionar esse conjunto; b.
50

12
27 12. (ESAF) Uma clnica especializada trata apenas de trs
c. tipos de doentes: dos que sofrem de problemas car-
50
dacos, dos que tem clculo renal e dos hipertensos.
37 Temos que 50% dos pacientes que procuram a clnica
d.
50 so cardacos, 40% so portadores de clculo renal e
apenas 10% so hipertensos. Os problemas cardacos
13
e. so curados em 80% das vezes, os problemas de cl-
50 culo renal em 90% das vezes e os hipertensos em 95%
das vezes. Um enfermo saiu curado da clnica. Qual
9. (CESPE) Em uma repartio com 40 funcionrios, tra- DSUREDELOLGDGHGHTXHHOHVRIUHVVHGHFiOFXORUHQDO"
balham analistas de recursos humanos, analistas de a. 43,1%
b. 42,1%
VLVWHPDVHRXWURVSURVVLRQDLVTXHH[HUFHPYiULRVWL-
c. 45,1%
pos de atividades. Sabe-se que desses funcionrios
d. 44,1%
20 so analistas de recursos humanos, 18 so analis-
e. 46,1%
tas de sistemas e 5 exercem as duas atividades: ana-
listas de recursos humanos e analistas de sistemas. 13. (ESAF) Uma companhia preocupada com sua produti-
vidade costuma oferecer cursos de treinamento a seus
Com base nas informaes acima, julgue os itens que RSHUiULRV$SDUWLUGDH[SHULrQFLDYHULFRXVHTXHXP
se seguem. operrio, recentemente admitido, que tenha frequen-
I Escolhendo-se ao acaso um dos funcionrios da tado o curso de treinamento tem 82% de probabilida-
repartio, a probabilidade de ele ser apenas ana- de de cumprir sua quota de produo. Por outro lado,
lista de recursos humanos superior a 40%. um operrio, tambm recentemente admitido, que
II A probabilidade de um funcionrio escolhido ao no tenha frequentado o mesmo curso de treinamen-
acaso exercer outra atividade que no seja a de to, tem apenas 35% de probabilidade de cumprir com

RACIOCNIO LGICO-MATEMTICO
analista de recursos humanos nem a de analistas sua quota de produo. Dos operrios recentemente
de sistemas superior a 20%. admitidos, 80% frequentaram o curso de treinamento.
Selecionando-se, aleatoriamente, um operrio recen-
10. (CESPE) Em um concurso pblico, registrou-se a ins- temente admitido na companhia, a probabilidade de
crio de 100 candidatos. Sabe-se que 30 desses can- que ele no cumpra sua quota de produo :
didatos inscreveram-se para o cargo de escriturrio, a. 11,70%
b. 27,40%
20, para o cargo de auxiliar administrativo, e apenas
c. 35%
10 candidatos se inscreveram para os dois cargos. Os
d. 83%
demais candidatos inscreveram-se em outros cargos.
e. 85%

Julgue os itens a seguir, considerando que um candi- 14. (IDR) Na avenida W3 sul, entre as quadras 702 e 704,
dato seja escolhido aleatoriamente nesse conjunto de H[LVWHP WUrV VHPiIRURV VXFLHQWHPHQWH HVSDoDGRV
100 pessoas. para poderem ser considerados independentes. No
SULPHLURDOX]YHUGHFDDFHVDGXUDQWHVHPFDGD
I A probabilidade de que o indivduo escolhido seja minuto, no segundo, durante 40s/m e no terceiro, 50
candidato ao cargo de auxiliar administrativo su- s/m. A probabilidade de um motorista que percorra
perior a 1/4. todo o trajeto citado encontrar um deles fechado :
II A probabilidade de que o indivduo escolhido seja 1
a.
candidato ao cargo de escriturrio ou ao cargo de 36
auxiliar administrativo igual a 1/2.
1
b.
18
11. (CESPE) Em uma cidade, 1.000 habitantes foram en-
trevistados a respeito de suas relaes com os bancos 13
c.
A e B. Dos entrevistados, 36
450 eram correntistas apenas do banco A, 480 eram
17
correntistas do banco B, 720 eram correntistas de ape- d.
36
nas um desses bancos e o restante no era correntista
de nenhum desses 2 bancos. 17
e.
18
$UHVSHLWRGHVVDSHVTXLVDpFRUUHWRDUPDUTXHDSUR-
babilidade de um dos entrevistados:
I ser correntista dos 2 bancos superior a 0,20. 15. (CESPE) Num grupo de 75 jovens, 16 gostam de m-
sica, esporte e leitura; 24 gostam de msica e esporte;
II no ser correntista de nenhum dos bancos igual
30 gostam de msica e leitura; 22 gostam de esporte e
a 0,08.
leitura; 6 gostam somente de msica; 9 gostam somen-
III ser correntista apenas do banco B inferior a 0,25.
te de esporte; e 5 jovens gostam somente de leitura.

13
a. Qual a probabilidade de, ao apontar, ao acaso, 21. (CETRO) Em uma corrida com 12 participantes, pode-
XPGHVVHVMRYHQVHOHJRVWDUGHP~VLFD" VH FRPSRU D FODVVLFDomR SDUD R SULPHLUR VHJXQGR
b. Qual a probabilidade de, ao apontar, ao acaso, HWHUFHLURFRORFDGRVGHTXDQWDVPDQHLUDVGLIHUHQWHV"
um desses jovens, ele no gostar de nenhuma des- a. 210
VDVDWLYLGDGHV" b. 720
c. 1.020
16. (ESAF) Carlos diariamente almoa um prato de sopa d. 1.320
no mesmo restaurante. A sopa feita de forma aleat- e. 2.120
ria por um dos trs cozinheiros que l trabalham: 40%
das vezes a sopa feita por Jos; 40% das vezes por 22. (CESPE) A quantidade de maneiras diferentes para se
Joo, e 20% das vezes por Maria. Jos salga demais construir um painel contendo 6 clulas a serem pre-
a sopa 10% das vezes; Joo o faz em 5% das vezes, e enchidas intercalando-se vogais e algarismos escolhi-
Maria 20% das vezes. Como de costume, um dia qual- dos de 0 a 9, sem repeties, comeando por vogal e
TXHU&DUORVSHGHDVRSDHDRH[SHULPHQWiODYHULFD terminando com nmero, conforme ilustrado abaixo,
que est salgada demais. A probabilidade de que essa superior a 40.000.
VRSDWHQKDVLGRIHLWDSRU-RVppLJXDOD"
a. 30% U 2 E 1 A 8
b. 32%
23. (CESPE) Caso o chefe de um rgo de inteligncia
c. 35%
tenha de escolher 3 agentes entre os 7 disponveis
d. 40%
para viagens um deles para coordenar a equipe, um
e. 42%
para redigir o relatrio de misso e um para fazer os
levantamentos de informaes , o nmero de manei-
17. (CETRO) Para etiquetar os frascos utilizados num la-
ras de que esse chefe dispe para fazer suas escolhas
boratrio, foi criado um cdigo formado por 3 letras e 3
inferior a 200.
RACIOCNIO LGICO-MATEMTICO

algarismos, sendo as letras apenas vogais e sendo os


algarismo distintos, portanto, a quantidade de cdigos 24. Uma reunio foi realizada com 5 pessoas que se sen-
igual a: taram ao redor de uma mesa redonda, na sala de reu-
a. 9. nies. De quantas formas distintas podemos organizar
b. 81. HVWDVSHVVRDVHPYROWDGHVWDPHVPDPHVD"
c. 810.
d. 9.000. 25. (ESAF) Considere todas as trinta e duas sequncias,
e. 90.000. com cinco elementos cada uma, que podem ser for-
madas com os algarismos 0 e 1. Quantas dessas se-
18. (ESAF) Um grupo de dana folclrica formado por 7 quncias possuem pelo menos trs zeros em posies
meninos e 4 meninas foi convidado a realizar apresen- FRQVHFXWLYDV"
taes de dana no exterior. Contudo o grupo dispe a. 5
de recursos para custear as passagens de apenas 6 b. 8
dessas crianas. Sabendo-se que nas apresentaes c. 9
do programa de danas devem participar pelo menos d. 12
duas meninas, o nmero de diferentes maneiras que e. 13
as 6 crianas podem ser escolhidas igual a:
a. 286 26. De quantos modos podemos dispor 5 livros de Mate-
b. 756 mtica, 3 de Fsica e 2 de Qumica numa prateleira, de
c. 468 PRGRTXHRVOLYURVGRPHVPRDVVXQWRTXHPVHPSUH
MXQWRV"
d. 371
a. 1.440
e. 752
b. 4.320
c. 8.640
19. (CESPE) inferior a 7.500 o nmero de maneiras d. 10.620
SHODVTXDLVFySLDVGHOPHVSRGHPVHUGLVWULEXtGDV e. 12.450
entre 4 salas de projeo, de modo que a menor sala
UHFHEDFySLDVGRVOPHVHFDGDXPDGDVRXWUDVVD- 27. Numa assembleia h cinquenta e sete deputados sen-
ODVUHFHEDFySLDVGRVOPHV do trinta e um governantes e os demais, oposicionis-
tas. Quantas comisses de sete deputados podem ser
20. &(63(  6XSRQKD TXH XPD GLVWULEXLGRUD GH OPHV formadas com quatro membros do governo e trs da
WHQKDOPHVGHDQLPDomRHFRPpGLDVSDUDGLVWUL- RSRVLomR"
buio. Nesse caso, superior a 140 e inferior a 160 a. menor que 80.000.000.
o nmero de formas distintas pelas quais 4 desses b. maior que 80.000.000 e menor que 85.000.000.
c. maior que 85.000.000 e menor que 90.000.000.
OPHV SRGHP VHU GLVWULEXtGRV GH PRGR TXH  VHMDP
d. maior que 90.000.000 e menor que 95.000.000.
comdias e 2 sejam de animao.
e. maior que 95.000.000.

14
28. Numa reunio esto doze pessoas. Quantas comis- 35. (CESPE) No Congresso Nacional, uma comisso de
ses de trs membros podem ser formadas, com a 5 membros ser formada a partir de 8 senadores e 6
condio de que uma determinada pessoa A esteja deputados, sendo que pelo menos um deputado deve-
sempre presente e uma determinada pessoa B nunca r pertencer comisso. O nmero de comisses que
SDUWLFLSHMXQWRFRPDSHVVRD$" podero ser assim formadas inferior a 1.920.
a. 24
b. 30 36. (CESPE) Os nmeros de telefone, usualmente, tm 8
c. 36 dgitos escolhidos entre os algarismos de 0 a 9. Consi-
d. 42 derando que 0 no possa ser o primeiro dgito, nesse
e. 45 caso, a quantidade de nmeros de telefones distintos
em que nenhum dgito aparece repetido inferior a
29. Quantos so os anagramas da palavra UNIVERSAL 1.600.000.
TXHFRPHoDPSRUFRQVRDQWHHWHUPLQDPSRUYRJDO"
a. menor que 101.000. 37. (FUNIVERSA) Uma loja vende tintas em dez cores di-
b. maior que 101.000e menor que 104.000. ferentes. Se cinco clientes compram uma lata de tinta
c. maior que 104.000e menor que 106.420. FDGDXPpFRUUHWRDUPDUTXH
d. maior que 106.420 e menor que 108.880. a. possvel se ordenar a entrada dos cinco clientes
e. maior que 108.880. na loja, um por vez, de 30 maneiras diferentes.
b. a probabilidade de as cores serem todas diferentes
30. De quantas maneiras distintas 7 pessoas podem sen- de 50%.
tar-se em torno de uma mesa circular, de tal modo que c. a probabilidade de pelo menos duas cores serem
GXDVGHWHUPLQDGDVSHVVRDVTXHPVHPSUHDFRPRGD- iguais de 50%.
GDVMXQWDV"
d. a probabilidade de pelo menos duas cores serem
a. 240
iguais superior a 65%.
b. 480
e. o nmero de maneiras diferentes de os cinco clien-

RACIOCNIO LGICO-MATEMTICO
c. 1.420
tes combinarem cores diferentes igual a 30.240.
d. 2.520
e. 5.040
38. (CESGRANRIO) Uma urna contm 5 bolas amarelas,
6 bolas azuis e 7 bolas verdes. Cinco bolas so ale-
31. Em uma assembleia realizada em Braslia com a par-
atoriamente escolhidas desta urna, sem reposio. A
ticipao de quarenta cientistas, oito destes presentes
probabilidade de selecionar, no mnimo, uma bola de
eram fsicos. Quantas comisses de cinco membros
cada cor :
podem ser formadas nesta assembleia incluindo no
PtQLPRXPItVLFRSUHVHQWH" 13 12 11 7 6 5
    
5 5 5 5 5 5
a. menor que 450.000. a. 1 
b. maior que 450.000 e menor que 455.000. 18

c. maior que 455.000 e menor que 460.000. 5
d. maior que 460.000 e menor que 462.000.
13 12 11 7 6 5
e. maior que 462.000.     
5 5 5 5 5 5
b.
32. (CESPE) O campeonato brasileiro de futebol da srie 18

A, neste ano de 2010, disputado em turno e returno, 5
com a participao de 20 clubes, todos jogando contra 13 12 11
todos, sendo considerado campeo o clube que, se-  
5 5 5 1
gundo as regras estabelecidas, somar o maior nmero c.
18
de pontos. Nesse caso, a quantidade de jogos previs-
tos para esse campeonato superior a 360. 5

13 12 11
33. (CESPE) Se, em um prdio de 12 apartamentos, com  
5 5 5
12 proprietrios diferentes, forem constitudas 3 comis- d.
18
ses para discutir assuntos distintos, cada uma forma-
5
da por 3 proprietrios, de forma que um mesmo pro-
prietrio possa participar de mais de uma comisso, 13 12 11
a quantidade de possibilidades de escolha dessas 3  
5 5 5
comisses ser superior a 369.000. e. 1
18

5
34. (CESPE) Considerando que Pedro e outras 9 pessoas
devam escolher, entre eles, o sndico, o subsndico, o
secretrio e o tesoureiro, formando a diretoria do con-
domnio em que residam, a quantidade de diretorias
que podero ser formadas sem que Pedro seja o sndi-
co ser superior a 4.500.

15
GABARITO
1. C
2. E
3. d
4. e
5. C
6. E
7. c
8. e
9. E, E
10. E, E
11. C, E, E
12. b
13. b
14. d
15. a) 58%
b) 14%
16. d
17. e
18. d
19. E
20. C
21. d
RACIOCNIO LGICO-MATEMTICO

22. C
23. E
24. 24 formas
25. b
26. c
27. b
28. e
29. a
30. a
31. c
32. C
33. C
34. C
35. E
36. E
37. d
38. a

16
LEGISLAO DE INTERESSE INSTITUCIONAL

SUM RIO

REGIMENTO INTERNO DO CONSELHO NACIONAL DO MINISTRIO PBLICO (RESOLUO N. 92, DE


13 DE MARO DE 2013 E ALTERAES POSTERIORES): LIVRO I - DA COMPOSIO, COMPETNCIA E
ORGANIZAO ............................................................................................................................................... 222
REGIME JURDICO DOS SERVIDORES PBLICOS CIVIS DA UNIO (LEI N. 8.112, DE 11 DE DEZEMBRO
DE 1990 E ALTERAES POSTERIORES): DOS DIREITOS E VANTAGENS. DO REGIME DISCIPLINAR..... (Vide
caderno Lei n. 8.112/1990)
CONSELHO NACIONAL DO MINISTRIO PBLICO para ser um instrumento de ampliao da participao cidad
nos rumos do Ministrio Pblico e de fortalecimento dos princ-
1 DEFINIO pios democrticos na gesto da Instituio. Com esse intuito, a
O Conselho Nacional do Ministrio Pblico um rgo Constituio Federal atribuiu ao CNMP o exerccio do controle
GHFRQWUROHH[WHUQRVREUHDDWXDomRDGPLQLVWUDWLYDHQDQFHLUD GDDWXDomRDGPLQLVWUDWLYDHQDQFHLUDGR0LQLVWpULR3~EOLFRHGR
do Ministrio Pblico Brasileiro e dos deveres funcionais dos FXPSULPHQWRGRVGHYHUHVIXQFLRQDLVGHVHXV0HPEURVHOKH
membros do parquet. Criado aps a to conhecida reforma do conferiu o dever de zelar pela autonomia funcional e administra-
sistema judicirio e do ministrio pblico, por meio da Emenda tiva do Ministrio Pblico, podendo expedir atos regulamentares,
Constitucional EC n. 45/2004. QRkPELWRGHVXDFRPSHWrQFLDRXUHFRPHQGDUSURYLGrQFLDV
A EC n. 45/2004 introduziu no ordenamento jurdico brasi- (Disponvel em: www.cnmp.mp.br)
leiro o Conselho Nacional do Ministrio Pblico, como rgo de
natureza meramente administrativa com a incumbncia de rea- O que o Presidente do CNMP, poca, entende?
lizar o controle externo sobre os diversos rgos do Ministrio
Pblico, seja de mbito da Unio ou dos Estados. A conotao democrtica do Conselho se acentua na
medida em que o colegiado, formado por diversos setores da
1.1 CONTROLE sociedade, constitudo para exercer o controle externo do
0LQLVWpULR3~EOLFRHDRPHVPRWHPSRUHDUPDUVXDDXWRQR-
Alguns livros, de forma equivocada, tendem a enderear mia. Roberto Monteiro Gurgel, Presidente do CNMP.
o Conselho Nacional do Ministrio Pblico CNMP como um (Disponvel em: www.cnmp.mp.br)
yUJmRGHFRQWUROHLQWHUQRGR0LQLVWpULR3~EOLFR(VVDDUPDomR
contm erros, tendo em vista que o CNMP no integra e no O que o STF entendeu de forma incidental?
faz parte da estrutura do Ministrio Pblico. Em outras pala-
vras, o CNMP no subordinado nem ao Ministrio Pblico Na espcie vertente, o Impetrante busca impedir a atua-
da Unio e nem aos Ministrios Pblicos dos Estados. Nota-se o disciplinar do rgo de controle externo do Ministrio Pblico
que o CNMP tem uma vinculao completamente diferente da nacional sob o argumento de que, ao determinar o arquivamento
do Conselho Nacional de Justia CNJ, que rgo do Poder do procedimento preparatrio criminal, a autoridade competente
Judicirio, vinculado e subordinado ao Judicirio. J o CNMP teria reconhecido a ausncia de elementos mnimos de materiali-
no integra estrutura do Ministrio Pblico, sendo assim, o dade e autoria [] Nele, o Impetrante ter garantido o seu direito
Conselho Nacional do Ministrio Pblico rgo de controle ao contraditrio e ampla defesa, sendo, por isso, prematuro
externo ao Ministrio Pblico. tolher a atuao do rgo administrativo ao qual a Constituio
da Repblica atribuiu a competncia para o controle do cumpri-
O que Doutrina entende sobre o assunto? mento dos deveres funcionais dos membros do Ministrio Pblico
DUW$LQF,,GD&RQVWLWXLomRGD5HS~EOLFD 06
Em um primeiro plano, observa-se que o CNMP, embora MC / MG MINAS GERAIS. Relator (a) Carmem Lucia.
seja um rgo tipicamente federal, mantido, portanto, pela
Unio, no est inserido na estrutura do Ministrio Pblico afeto Infere-se dos documentos juntados ao processo que a ins-
a esse ente federado. um rgo essencialmente externo, que taurao do procedimento de controle administrativo no rgo
controla tanto o Ministrio Pblico da Unio como os congne- de controle externo dos Ministrios Pblicos federal e estadu-
UHVHVWDGXDLV(PHUVRQ*DUFLD0HPEURGR0LQLVWpULR3~EOLFR ais decorreu de provocao de deputado estadual a partir de
do Estado do Rio de Janeiro. Ex-Consultor Jurdico da Procura- nota [...] A dvida suscitada sobre a validade jurdica do con-
doria Geral de Justia (2005-2009). Assessor Jurdico da Asso- trato celebrado pelo Impetrante com a empresa Oi S/A imps ao
ciao Nacional dos Membros do Ministrio Pblico (CONAMP). Conselho Nacional do Ministrio Pblico a instaurao do Pro-
Doutorando e Mestre em Cincias Jurdico-Polticas pela Uni- cedimento de Controle Administrativo n. 0.00.000.000509/2014-
versidade de Lisboa.  06  0&  ')  ',675,72 )('(5$/ 5HODWRU D 
(Disponvel em: aplicacao.mpmg.mp.br)
Carmem Lucia

O que o Conselho Federal da OAB entende? Enquadramento do CNMP e CNJ na Constituio:

Ophir Cavalcante, ao se referir aos cinco primeiros anos de A Constituio Federal destaca que o CNJ pertence
estrutura interna do Poder Judicirio. Diferentemente do que
GILCIMAR RODRIGUES

instalao do Conselho Nacional do Ministrio Pblico (CNMP),


comemorados hoje (21) em solenidade no Memorial JK, em ocorre com o CNMP. Vejamos:
Braslia. Ao enaltecer o trabalho desempenhado pelo Conse-
lho encarregado do controle externo do MP, Ophir ressaltou que Art. 92. So rgos do Poder Judicirio: I-A o Conse-
tambm a OAB ajudou a construir este momento. Sempre foi lho Nacional de Justia;
uma bandeira da advocacia brasileira e da sociedade o controle
externo. Este, apesar de todas as resistncias iniciais, mostrou- J o art. 128 ilumina a estrutura do Ministrio Pblico Bra-
VHPXLWRHFD]SDUDIRUWDOHFHUR0LQLVWpULR3~EOLFRHWDPEpPD sileiro. Percebam:
PDJLVWUDWXUDDUPRX2SKLU $UW20LQLVWpULR3~EOLFRDEUDQJH
(Disponvel em: www.oab.org.br) ,R0LQLVWpULR3~EOLFRGD8QLmRTXHFRPSUHHQGH
D R0LQLVWpULR3~EOLFR)HGHUDO
Como o CNMP se enquadra? E R0LQLVWpULR3~EOLFRGR7UDEDOKR
F R0LQLVWpULR3~EOLFR0LOLWDU
O Conselho Nacional do Ministrio Pblico o rgo de G R0LQLVWpULR3~EOLFRGR'LVWULWR)HGHUDOH7HUULWyULRV
controle externo criado pela Emenda Constitucional n. 45/2004 ,,RV0LQLVWpULRV3~EOLFRVGRV(VWDGRV

18
Podemos perceber que a estrutura orgnica do Minist- como rgo de controle interrgos, com mecanismos gover-
rio Pblico no mencionou o CNMP. namentais, nem sempre exercida dentro dos parmetros leg-
A Constituio destacou o CNMP somente no Art. timos, pelo qu abusos tm sido cometidos, especialmente
130-A, fora do mbito orgnico do Ministrio Pblico. na utilizao dos inquritos civis e aes civis pblicos como,
tambm, nos processos administrativos, de que se vem ser-
1.2 ATUAO vindo como meio de investigao criminal direta, sem amparo
constitucional. Faltava um rgo de controle intra-rgos para
Outro ponto importante que o Conselho Nacional o ajuste da prtica legitimidade constitucional. Pode ser que
do Ministrio Pblico no rgo jurisdicional, pois a sua HVVH&RQVHOKRIDoDHVVHUHDMXVWDPHQWR
natureza jurdica rgo de competncias administrativas,
exercendo o controle externo sobre a atuao administrativa 2 INSTALAO
HQDQFHLUDGR0LQLVWpULR3~EOLFRHGRVGHYHUHVIXQFLRQDLV
dos membros ministeriais. O Conselho Nacional do Ministrio Pblico tem como
Muito se discutiu sobre a competncia do CNMP con- origem a EC n. 45, de 30 de dezembro de 2004. Mas foi ins-
trolar o exerccio funcional do Ministrio Pblico. O Conse- talado efetivamente no dia 21 de junho de 2005, com atuao
lho Nacional no tem competncia para entrar no mrito das (no confudir com jurisdio) em todo o territrio nacional e
IXQo}HVQDOtVWLFDVGR0LQLVWpULR3~EOLFRSDUDQmRIHULUXP sede em Braslia, Distrito Federal. Sendo assim, s a partir
dos princpios mais marcantes do Ministrio Pblico: Auto- de 21 de junho de 2005, que o CNMP comeou a recepcio-
mia funcional da Instituio e a Independncia Funcional nar as demandas direcionadas ao Ministrio Pblico.
GRVPHPEURV3RUWDQWRDDWXDomRGR&103FDUiQRkPELWR
GDDWXDomRDGPLQLVWUDWLYDHQDQFHLUDGR0LQLVWpLUR3~EOLFR 3 COMPOSIO
e nos deveres ou obrigaes dos Membros.
A ideia de criao do Conselho Nacional do Ministrio A composio do Conselho Nacional do Ministrio
3~EOLFRWHYHFRPREDVHHYLWDUHYHQWXDLVGHVYLRVGHQDOLGD- Pblico heterognea ou mista, possuindo Conselheiros
des ou abusos cometidos por membros do Ministrio Pblico oriundos do Ministrio Pblico e de pessoas alheias ao MP,
H WDPEpP SHOD LQVWLWXLomR PLQLVWHULDO PDV D SULQFLSDO QDOL- na inteno de no desequilibrar a relao de proporo
GDGH GR &103 p ]HODU H JDUDQWLU XP 0LQLVWpULR 3~EOLFR H- entre os integrantes do Ministrio Pblico e daqueles que
ciente, pautado por princpios constitucionais e legais, preser- UHSUHVHQWDPRXWUDVSURVV}HV
vando os direitos difusos, coletivos e individuais indisponveis So integrantes do CNMP 14 Conselheiros na seguinte
da sociedade brasileira. Ao mesmo tempo em que busca pre- disposio: 8 (oitos) membros do Ministrio Pblico: O Procu-
servar a instituio do Ministrio Pblico, o CNMP atuar no rador-Geral da Repblica, 4 membros do MPU (1 membro de
FRQWUROHGRVDWRVDGPLQLVWUDWLYRVHQDQFHLURVGR0LQLVWpULR cada ramo) e 3 membros escolhidos dos Ministrios Pblicos
Pblico, podendo inclusive aplicar sanes aos membros dos Estados; 2 juzes indicados: 1 (um) pelo Supremo Tribunal
por no observarem os seus deveres e as suas obrigaes Federal e outro pelo Superior Tribunal de Jusita; 2 membros da
funcionais. Sobre o Conselho Nacional do Ministrio Pblico, advocacia, indicados pela OAB; 2 cidados, indicados 1 (um)
Jos Afonso da Silva, assevera: O Ministrio Pblico adqui- pela Cmara dos Deputados e outro pelo Senado Federal.
riu, pela Constituio, um poder extraordinrio, especialmente (PHVTXHPDDFRPSRVLomRFDUiDVVLP

LEGISLAO DE INTERESSE INSTITUCIONAL

19
3.1 PROCURADOR-GERAL DA REPBLICA MEMBRO NATO 3.5 APROVAO E NOMEAO DOS INTEGRANTES DO
CNMP
O Procurador-Geral da Repblica o nico integrante
do Conselho Nacional do Ministrio Pblico que no se sub- Compete ao Senado Federal aprovar por maioria abso-
mete votao no Senado Federal e nomeao pelo Pre- luta a escolha dos nomes. O Presidente da Repblica nome-
sidente da Repblica para compor o CNMP, tendo em vista ar os aprovados. O Procurador-Geral da Repblica empos-
que j se submeteu a este procedimento por ocasio de sar os nomeados.
Chefe do Ministrio Pblico da Unio. O Procurador-Geral
3.6 MANDATO
da Repblica membro nato e presidente do Conselho
Nacional do Ministrio Pblico.
Os Conselheiros possuiro mandato de 2 (dois) anos,
podendo ser reconduzido por uma nica vez, desde que
3.2 ESCOLHA DOS MEMBROS DO MINISTRIO PBLICO DA observe o mesmo trmite da nomeao.
UNIO
3.7 CRIME DE RESPONSABILIDADE
Os membros do Conselho Nacional do Ministrio
Pblico oriundos do Ministrio Pblico da Unio sero esco- Compete ao Senado Federal processar e julgar os Con-
lhidos pelo Procurador-Geral de cada um dos ramos, a partir selheiros do CNMP em crime de responsabilidade.
de lista trplice composta por membros com mais de 35 A Constituio Federal no previu a prerrogativa de foro
(trinta e cinco) anos de idade, que j tenham completado privilegiado em crime comum praticado por Conselheiros do
mais de 10 (dez) anos na respectiva Carreira. CNMP.
As listas trplices sero elaboradas pelos respectivos
Colgios de Procuradores do Ministrio Pblico Federal, do 4 COMPETNCIAS DO CNMP
Ministrio Pblico do Trabalho e do Ministrio Pblico Militar,
e pelo Colgio de Procuradores e Promotores de Justia do Compete ao Conselho Nacional do Ministrio Pblico o
Ministrio Pblico do Distrito Federal e Terrrios. FRQWUROHGDDWXDomRDGPLQLVWUDWLYDHQDQFHLUDGR0LQLVWpULR
O nome escolhido pelo Procurador-Geral de cada um Pblico e do cumprimento dos deveres funcionais de seus
membros, cabendo-lhe:
dos ramos ser encaminhado ao Procurador-Geral da Rep-
blica, que o submeter aprovao do Senado Federal.
4.1 ZELAR PELA AUTONOMIA FUNCIONAL E ADMINISTRA-
TIVA DO MINISTRIO PBLICO, PODENDO EXPEDIR ATOS
3.3 ESCOLHA DOS MEMBROS DOS MINISTRIOS PBLICOS
REGULAMENTARES, NO MBITO DE SUA COMPETNCIA,
DOS ESTADOS OU RECOMENDAR PROVIDNCIAS;
O Conselho Nacional do Ministrio Pblico, ao contrrio
Os membros do Conselho Nacional do Ministrio do que muitos pensam, tem como objetivo primrio e fuda-
Pblico oriundos dos Ministrios Pblicos dos Estados sero mental a preservao da autonomia do Ministrio Pblico,
indicados pelos respectivos Procuradores-Gerais de Justia, o CNMP no veio para diminuir ou restringir a autonomia
a partir de lista trplice elaborada pelos integrantes da Car- do Ministrio Pblico. Deve criar mecanismos para zelar e
reira de cada instituio, composta por membros com mais preservar a autonomia funcional e administrativa do Minist-
de 35 (trinta e cinco) anos de idade, que j tenham comple- rio Pblico, criando atos normativos ou regulamentares para
tado mais de 10 (dez) anos na respectiva Carreira. agilizar os procedimentos internos do Ministrio Pblico.
Os Procuradores-Gerais de Justia dos Estados, em Caso algum Poder ou autoridade pblica tentar impedir a
reunio conjunta especialmente convocada e realizada para autonomia do Ministrio Pblico, caber ao CNMP emitir
HVVHPIRUPDUmROLVWDFRPRV WUrV QRPHVLQGLFDGRVSDUD notas tcnicas repudiando tal comportamento.
as vagas destinadas a membros do Ministrio Pblico dos O regimento interno do CNMP proclama que a preser-
Estados, a ser submetida aprovao do Senado Federal. vao da autonomia funcional e administrativa do Ministrio
Repare que o procedimento de escolha dos membros Pblico ser promovida pelo Plenrio do Conselho, de ofcio
ou mediante provocao, sempre que houver ofensa ou
dos Ministrios Pblicos dos Estados mais complexo, pois
ameaa de ofensa independncia funcional dos membros
o membro precisar integrar a lista trplice elaborada pelo
do Ministrio Pblico ou interferncia indevida na autonomia
GILCIMAR RODRIGUES

colgio de seu Ministrio Pblico, despois disso o Procura-


dos rgos do Ministrio Pblico.
dor-Geral dever escolher 1 (um) nico nome, e aps isso
convocada uma reunio de todos os procuradores-gerais de 4.2 ZELAR PELA OBSERVNCIA DO ART. 37 DA CONSTITUI-
justia do brasil para a escolha dos 3 (trs) representantes O E APRECIAR, DE OFCIO OU MEDIANTE PROVOCAO,
dos estados. A LEGALIDADE DOS ATOS ADMINISTRATIVOS PRATICADOS
POR MEMBROS OU RGOS DO MINISTRIO PBLICO DA
3.4 ESCOLHA DOS INTEGRANTES DE OUTRAS CLASSES UNIO E DOS ESTADOS, PODENDO DESCONSTITU-LOS,
PROFISSIONAIS REV-LOS OU FIXAR PRAZO PARA QUE SE ADOTEM AS
PROVIDNCIAS NECESSRIAS AO EXATO CUMPRIMENTO
A Constituio Federal facultou a cada rgo legitimado DA LEI, SEM PREJUZO DA COMPETNCIA DOS TRIBUNAIS
a escolha dos integrantes do CNMP. Sendo assim, compete DE CONTAS;
ao Regimento interno do STF, STJ, Cmara, Senado e OAB O art. 37 da Constituio Federal trata-se dos princpios
disciplinar a conduo e a forma de escolha de seus repre- da administrao pblica e de temas relacionados gesto
sentantes perante o CNMP. administrativa.

20
Cumpre ao Conselho Nacional do Ministrio Pblico apre- Julgado procedente o pedido de reviso, o Plenrio
ciar os atos de gesto emanados do Ministrio Pblico. Caso poder instaurar ou determinar a instaurao de processo
o ato no preservar a legalidade, compete ao CNMP descons- DGPLQLVWUDWLYRGLVFLSOLQDUDOWHUDUDFODVVLFDomRGDLQIUDomR
WLWXtORUHYrORRX[DUSUD]RSDUDTXHVHDGRWHPDVSURYLGrQ- absolver ou condenar o membro do Ministrio Pblico, modi-
cias. importante salientar que a Constituio no deu compe- FDUDSHQDRXDQXODURSURFHVVR
tncia ao CNMP para exercer a administrao dos Ministrios
Pblicos, mas sim aperfeio-los com estrita legalidade, e 4.5 ELABORAR RELATRIO ANUAL, PROPONDO AS PROVI-
quando no houver legalidade adotar as devidas providncias. DNCIAS QUE JULGAR NECESSRIAS SOBRE A SITUAO
Outro ponto importante que a incumbncia do CNMP DO MINISTRIO PBLICO NO PAS E AS ATIVIDADES DO
refere-se questes administrativas, refutando-se a possibi- CONSELHO, O QUAL DEVE INTEGRAR A MENSAGEM PRE-
lidade de apreciar atos funcionais ou aspecto processual, na VISTA NO ART. 84, XI.
inteno de no ferir a autonomia funcional da instituio e o &RP D LQWHQomR SULPHLUD GH DXPHQWDU D HFLrQFLD D
princpio da independncia funcional dos membros. racionalizao e a produtividade da instituio Ministrio
A Competncia do CNMP para apreciar a legalidade dos Pblico, a Constituio Federal inseriu a possibilidade de
atos administrativos do Ministrio Pblico no exime os rgos o CNMP propor providncia que julgar necessria a situa-
ministeriais de prestarem contas aos Tribunais de Contas, isto o da instituio no pas, via elaborao de um relatrio
, a atuao do CNMP no prejudicar a competncia dos Tri- anual. Consagrando a sua importncia, a Constituio prev
bunais de Contas. que o citado relatrio dever integrar a mensagem remetida
pelo Presidente da Repblica, junto ao plano de governo,
4.3 RECEBER E CONHECER DAS RECLAMAES CONTRA MEM- ao Congresso Nacional, por ocasio da abertura da sesso
BROS OU RGOS DO MINISTRIO PBLICO DA UNIO OU legislativa, que expor a situao do pas, solicitando as pro-
DOS ESTADOS, INCLUSIVE CONTRA SEUS SERVIOS AUXILIA- vidncias pertinentes. 1
RES, SEM PREJUZO DA COMPETNCIA DISCIPLINAR E COR-
REICIONAL DA INSTITUIO, PODENDO AVOCAR PROCES- 5 CORREGEDOR NACIONAL DO MINISTRIO PBLICO
SOS DISCIPLINARES EM CURSO, DETERMINAR A REMOO,
A DISPONIBILIDADE OU A APOSENTADORIA COM SUBSDIOS O Corregedor Nacional ser eleito entre os membros
OU PROVENTOS PROPORCIONAIS AO TEMPO DE SERVIO E do Ministrio Pblico que integram o Conselho para um
APLICAR OUTRAS SANES ADMINISTRATIVAS, ASSEGU- mandato de dois anos, vedada a reconduo.
RADA AMPLA DEFESA; Proceder-se- a eleio pelo voto secreto, na sesso
O Conselho Nacional poder receber reclamaes contra imediatamente posterior vacncia do cargo, sendo eleito o
quaisquer membros do Ministrio Pblico e ainda contra os ser- candidato escolhido pela maioria absoluta.
vios auxiliares. No sendo alcanada a maioria absoluta, os dois candi-
Conforme o regimento interno, a avocao de procedi- datos mais votados concorrero em segundo escrutnio, pro-
mento ou processo administrativo disciplinar em curso contra clamando-se vencedor, em caso de empate, o mais antigo
membro ou servidor do Ministrio Pblico dar-se- mediante no Conselho.
proposio de qualquer Conselheiro ou representao funda- O Corregedor Nacional tomar posse imediatamente
mentada de qualquer cidado, dirigida ao Presidente do Con- aps a proclamao do resultado da eleio.
selho, a quem caber determinar sua autuao e distribuio O mandato do Corregedor Nacional expirar junta-
a um Relator. Salienta-se que para ocorrer a avocao, o pro- mente com seu mandato de Conselheiro.
cesso administrativo precisa estar em curso ou em andamento, O Corregedor Nacional exercer suas funes em
VHPGHFLVmRGHQLWLYD UHJLPH GH GHGLFDomR H[FOXVLYD FDQGR DIDVWDGR GR yUJmR
O Conselho Nacional poder determinar remoo de do Ministrio Pblico a que pertence.
membros do ministrio pblico em caso de interesse pblico. Alm de outras competncias que lhe sejam conferidas
A determinao de disponibilidade acarreta a inatividade por lei ou pelo Regimento do CNMP, ao Corregedor Nacional
do membro (podendo ser aproveitado no futuro), com subs- compete:
dios proporcionais ao tempo de servio. I receber reclamaes e denncias, de qualquer inte- LEGISLAO DE INTERESSE INSTITUCIONAL
A penalidade mxima que o CNMP poder aplicar aos ressado, relativas aos membros do Ministrio Pblico e dos
membros do MP a aposentadoria compulsria com proven- seus servios auxiliares;
tos proporcionais ao tempo de servio, tendo em vista que o II exercer funes executivas do Conselho, de inspe-
Conselho um rgo de natureza administrativa. o e correio geral;
Para cada sano aplicada aos membros, o Conselho III requisitar e designar membros do Ministrio Pblico
precisa de um processo administrativo que seja assegurada a e requisitar servidores de rgos do Ministrio Pblico;
ampla defesa e o contraditrio ao acusado. IV determinar o processamento das reclamaes que
atendam aos requisitos de admissibilidade e arquivar, suma-
4.4 REVER, DE OFCIO OU MEDIANTE PROVOCAO, OS riamente, as annimas ou aquelas manifestamente impro-
PROCESSOS DISCIPLINARES DE MEMBROS DO MINISTRIO cedentes ou desprovidas de elementos mnimos para sua
PBLICO DA UNIO OU DOS ESTADOS JULGADOS H MENOS compreenso, dando cincia ao interessado;
DE UM ANO; V propor ao Plenrio a avocao ou a reviso de pro-
Compete ao Conselho rever processos disciplinares de cedimentos acompanhados por reclamaes disciplinares
membros do parquet julgados h menos de um ano. instauradas na Corregedoria Nacional, quando discordar,
O regimento interno informa que os procedimentos e os respectivamente, do trmite ou das concluses;
processos administrativos disciplinares contra membros do
0LQLVWpULR 3~EOLFR GHQLWLYDPHQWH MXOJDGRV Ki PHQRV GH XP
ano, podero ser revistos de ofcio ou mediante provocao de 1
Clever Rodolfo Carvalho Vasconcelos, Ministrio Pblico na Constituio Federal.
qualquer cidado.

21
VI instaurar sindicncia de ofcio ou, quando houver II a Presidncia;
LQGtFLRV VXFLHQWHV GH PDWHULDOLGDGH H DXWRULD GD LQIUDomR III a Corregedoria Nacional do Ministrio Pblico;
processo administrativo disciplinar. IV os Conselheiros;
VII realizar, de ofcio ou mediante provocao, inspe- V as Comisses;
es e correies para apurao de fatos relacionados aos VI a Ouvidoria Nacional.
servios do Ministrio Pblico, em todas as reas de sua
atuao, havendo ou no evidncias de irregularidades.
VIII elaborar e apresentar ao Plenrio relatrio trimes-
tral sobre as atividades desenvolvidas na Corregedoria Nacio-
QDOGLYXOJDQGRUHODWyULRFRQVROLGDGRQRQDOGRH[HUFtFLR
IX executar e fazer executar as ordens e as delibera-
es do Conselho sujeitas sua competncia;
X expedir recomendaes orientadoras, no vinculativas,
destinadas ao aperfeioamento das atividades dos membros,
rgos e servios auxiliares do Ministrio Pblico, em proces-
sos e procedimentos que tramitem na Corregedoria Nacional;
;,UHTXLVLWDUGDVDXWRULGDGHVVFDLVPRQHWiULDVMXGL-
cirias e outras, informaes, exames, percias ou documen-
tos, sigilosos ou no, imprescindveis ao esclarecimento de
processos ou procedimentos submetidos sua apreciao;
XII manter contato, no que diz respeito s matrias
de sua competncia, com as corregedorias e demais rgos
das unidades do Ministrio Pblico, bem como com autori-
dades judicirias ou administrativas;
XIII delegar aos demais Conselheiros, membros auxi-
liares ou servidores expressamente indicados, atribuies
SDUDDSUiWLFDGHSURFHGLPHQWRVHVSHFtFRV

6 PRESIDENTE DA OAB

O Presidente do Conselho Federal da Ordem dos


$GYRJDGRVGR%UDVLORFLDUiMXQWRDR&103SRGHQGRXVDU
da palavra, tomar assento direita do Presidente do Con-
selho, podendo ser representado pelo Vice-Presidente do
Conselho Federal da OAB. A atuao do Presidente da OAB
meramente participativa. O regimento interno prev a pos-
sibilidade do presidente da OAB enviar representao para
avocao de processo disciplinar, reviso disciplinar e ins-
taurao de processo disciplinar.

7 OUVIDORIAS

A Constituio Federal proclama que leis da Unio e


dos estados criaro ouvidorias do Ministrio Pblico, com-
petentes para receber reclamaes e dennicas de qualquer
interessado contra membros ou rgos do MP, inclusive
contra seus servios auxiliares, representando diretamente
ao Conselho Nacional do Ministrio Pblico.
GILCIMAR RODRIGUES

8 AES CONTRA O CONSELHO NACIONAL DO MINIST-


RIO PBLICO

Nos termos do art. 102, I, r, da Constituio Federal,


compete ao Supremo Tribunal Federal processar e julgar,
originariamente, as aes contra o Conselho Nacional do
Ministrio Pblico. Sendo assim, apenas o STF poder
rever atos praticados pelo Conselho Nacional do Ministrio
Pblico.

9 DA ORGANIZAO DO CONSELHO NACIONAL DO


MINISTRIO PBLICO

So rgos do Conselho:
I o Plenrio;

22
NOES DE DIREITO CONSTITUCIONAL

SUM RIO

PRINCPIOS FUNDAMENTAIS .....................................................................................................................244


DIREITOS E GARANTIAS FUNDAMENTAIS .................................................................................................252
DA ORGANIZAO DO ESTADO: DA ADMINISTRAO PBLICA: DOS SERVIDORES ....................291/300
ORGANIZAO DOS PODERES: DO PODER LEGISLATIVO: DO CONGRESSO NACIONAL. DAS
ATRIBUIES E COMPETNCIA DO CONGRESSO NACIONAL. DA CMARA DOS DEPUTADOS. DO
SENADO FEDERAL. PODER EXECUTIVO: DO PRESIDENTE E DO VICE-PRESIDENTE DA REPBLICA.
DAS ATRIBUIES DO PRESIDENTE DA REPBLICA. DAS RESPONSABILIDADES DO PRESIDENTE DA
REPBLICA ...........................................................................................................................................321/359
DO PODER JUDICIRIO: DAS DISPOSIES GERAIS. DO SUPREMO TRIBUNAL FEDERAL .....................331
DAS FUNES ESSENCIAIS JUSTIA: DO MINISTRIO PBLICO ..........................................................353
c. igualdade material.
EXERCCIOS d. inviolabilidade domiciliar.
e. segurana jurdica.
1. (FCC/ TRT - 6 Regio (PE)/ Tcnico Judicirio/ rea
Administrativa/ 2012) A Constituio Federal reconhe- 5. (FCC/ TRF - 2 REGIO/ Tcnico Judicirio/ Segu-
ce que so Poderes da Unio, independentes e har- rana e Transporte/ 2012) Quanto s relaes inter-
mnicos entre si, APENAS o nacionais, o Brasil rege-se, segundo expressamente
a. Legislativo e o Executivo. disposto no artigo 4 da Constituio Federal brasileira
IVAN LUCAS

b. Judicirio e o Legislativo. de 1988, pelo princpio


c. Executivo, o Legislativo e o Judicirio. a. do juiz natural.
d. Legislativo, o Executivo, o Judicirio e o Ministrio b. do efeito mediato.
c. da sucumbncia.
Pblico.
d. da igualdade entre os Estados.
e. Executivo, o Legislativo, o Judicirio, o Ministrio
e. da concentrao.
Pblico e a Defensoria Pblica.
6. (FCC/ TRE-SP/ Tcnico Judicirio/ rea Administrati-
2. (FCC/ TRT - 6 Regio-(PE)/ Tcnico Judicirio/ Se-
va/ 2012) O mecanismo pelo qual os Ministros do Su-
gurana/ 2012) No que concerne organizao dos
premo Tribunal Federal so nomeados pelo Presidente
3RGHUHV GD 8QLmR p FRUUHWR DUPDU FRP EDVH QD
da Repblica, aps aprovao da escolha pelo Sena-
Constituio Federal, que
do Federal, decorre do princpio constitucional da
a. o Judicirio hierarquicamente superior ao Exe-
a. separao de poderes.
cutivo e ao Legislativo, na medida em que quele
b. soberania.
LQFXPEHGHFLVmRQDOVREUHDFRQVWLWXFLRQDOLGDGH
c. cidadania.
das normas vigentes.
d. inafastabilidade do Poder Judicirio.
b. so independentes e harmnicos entre si, impon-
e. VROXomRSDFtFDGRVFRQLWRV
GR VH LQXrQFLDV H OLPLWDo}HV UHFtSURFDV TXH VH
prestam limitao do poder estatal.
7. (FCC/ TRE-PR/ Tcnico Judicirio/ rea Administrati-
c. o Executivo hierarquicamente superior ao Legis-
va/ 2012) A Carta Africana dos Direitos do Homem e
lativo, na medida em lhe autorizado legislar por
dos Povos, assinada por Estados do continente africa-
meio de medidas provisrias.
no em 1981, enuncia, em seu artigo 20, que todo povo
d. o Legislativo hierarquicamente superior ao Exe-
tem um direito imprescritvel e inalienvel, pelo qual
cutivo, na medida em que pode derrubar o veto do
determina livremente seu estatuto poltico e garante
Chefe do Executivo a determinada lei, tornando-a seu desenvolvimento econmico e social pelo caminho
vigente. que livremente escolheu.
e. so independentes e harmnicos, no se relacio- Na Constituio da Repblica Federativa do Brasil, o
QDQGRHQWUHVLGHYHQGRHYHQWXDOFRQLWRVHUGLUL- teor de referido enunciado encontra equivalncia no
mido por organismo supranacional. princpio de regncia das relaes internacionais de
a. repdio ao terrorismo e ao racismo.
3. (FCC/ TRT - 6 Regio/ 2012) Analista Judicirio/ Exe- b. construo de uma sociedade livre, justa e solidria.
cuo de Mandados) O voto uma das principais ar- c. erradicao da pobreza e da marginalizao.
mas da Democracia, pois permite ao povo escolher os d. autodeterminao dos povos.
responsveis pela conduo das decises polticas de e. concesso de asilo poltico.
um Estado. Quem faz mau uso do voto deixa de ze-
lar pela boa conduo da poltica e pe em risco seus 8. (FCC/ TRT - 14 Regio/ Tcnico Judicirio/ rea Ad-
prprios direitos e deveres, o que afeta a essncia do ministrativa/ 2011) NO constitui objetivo fundamental
Estado Democrtico de Direito. Dentre os fundamen- da Repblica Federativa do Brasil, previsto expressa-
tos da Repblica Federativa do Brasil, expressamente mente na Constituio Federal,
previstos na Constituio, aquele que mais adequada- a. construir uma sociedade livre, justa e solidria.
mente se relaciona ideia acima exposta a b. garantir o desenvolvimento nacional.
a. soberania. c. erradicar a pobreza e a marginalizao e reduzir as
b. prevalncia dos direitos humanos. desigualdades sociais e regionais.
c. cidadania. d. FDSWDU WULEXWRV PHGLDQWH VFDOL]DomR GD 5HFHLWD
d. independncia nacional. Federal.
e. dignidade da pessoa humana. e. promover o bem de todos, sem preconceitos de
origem, raa, sexo, cor, idade e quaisquer outras
4. (FCC/ TRT - 6 Regio/ Analista Judicirio/ rea Ju- formas de discriminao.
diciria/ 2012) O princpio constitucional, relacionado
aos direitos fundamentais, que embasa a Lei Maria 9. (FCC/ TRF - 1 REGIO/ Tcnico Judicirio/ rea Ad-
GD3HQKDSHUPLWLQGRTXHDPXOKHUUHFHEDXPWUDWD- ministrativa/ 2007) Dentre as proposies abaixo,
mento jurdico preferencial em relao ao homem nas ,1&255(72 DUPDU TXH D 5HS~EOLFD )HGHUDWLYD GR
situaes de violncia domstica e familiar, o da Brasil tem como fundamentos, dentre outros,
a. funo social da propriedade. a. a cidadania e o pluralismo poltico.
b. liberdade individual. b. a soberania e a dignidade da pessoa humana.

24
c. o pluralismo poltico e a valorizao social do tra- 15. (FCC/ TRF - 5 REGIO/ Tcnico Judicirio/ Seguran-
balho. a e Transporte/ 2008) NO constitui princpio funda-
d. a dignidade da pessoa humana e o valor da livre mental da Repblica Federativa do Brasil
iniciativa. a. o valor social do trabalho e da livre iniciativa.

NOES DE DIREITO CONSTITUCIONAL


e. a autonomia e a dependncia nacional. b. a soberania.
c. a dignidade da pessoa humana.
10. (FCC/ TRF - 4 REGIO/ Analista Judicirio/ Taquigra- d. a determinao dos povos.
D 12FRQVWLWXLSULQFtSLRTXHUHJHD5HS~EOLFD e. o pluralismo poltico.
Federativa do Brasil nas suas relaes internacionais,
previsto na Constituio Federal: 16. (FCC/ TRF - 1 REGIO/ Tcnico Judicirio/ rea Ad-
a. concesso de asilo poltico. ministrativa/ 2006) Dentre as proposies abaixo,
b. independncia nacional. ,1&255(72 DUPDU TXH D 5HS~EOLFD )HGHUDWLYD GR
c. repdio ao terrorismo e ao racismo. Brasil, nas suas relaes internacionais, rege-se pelo
d. autodeterminao dos povos. princpio da
e. busca de integrao econmica. a. independncia nacional.
b. vedao ao asilo poltico.
11. (FCC/ AL-SP/ Agente Tcnico Legislativo Especializa- c. no interveno.
do/ Direito/ 2010) No Brasil, as funes atpicas, rela- d. prevalncia dos direitos humanos.
cionadas teoria da separao de poderes, e. autodeterminao dos povos.
a. so consideradas inconstitucionais, pois ferem a
harmonia e a independncia dos Poderes. 17. (FCC/ TCE-GO/ Tcnico de Controle Externo/ rea
b. s podero ser realizadas mediante expressa pre- $GPLQLVWUDWLYD   &RQVLGHUH DV VHJXLQWHV DUPD-
viso legal. es sobre os princpios fundamentais da Constituio
c. possibilitam ao Senado Federal julgar o Presidente da Repblica:
da Repblica por crime de responsabilidade. I A Repblica Federativa do Brasil formada pela
d. permitem aos Tribunais Superiores aprovar smula unio indissolvel dos Estados, Municpios e Dis-
com efeito vinculante em relao aos demais r- trito Federal.
gos do Poder Judicirio. II Todo o poder emana do povo, que o exerce por
e. garantem ao Poder Executivo prerrogativa para meio de representantes ou diretamente, nos termos
apurar fato determinado e por prazo certo com da Constituio.
poderes de investigao prprios das autoridades III Constituem objetivos fundamentais da Repblica
judiciais. Federativa do Brasil, dentre outros, a construo de
uma sociedade livre, justa e solidria e a garantia
12. (FCC/ AL-SP/ Agente Legislativo de Servios Tcnicos do desenvolvimento nacional.
e Administrativos/ 2010) Constitui um dos fundamen- (VWiFRUUHWRRTXHVHDUPDHP
tos da Repblica Federativa do Brasil, de acordo com a. I, II e III.
a Constituio Federal de 1988, b. I, apenas.
a. a garantia do desenvolvimento nacional. c. II, apenas.
b. a no interveno. d. III, apenas.
c. a defesa da paz. e. I e II, apenas.
d. a igualdade entre os Estados.
e. o pluralismo poltico. 18. (FCC/ DPE-SP/ Defensor Pblico/ 2006) Quanto ao
IHGHUDOLVPRpFRUUHWRDUPDU
13. (FCC/ MPU/ Analista/ Oramento/ 2007) A Repblica a. Consiste na diviso de poder entre governo central
Federativa do Brasil rege-se, nas suas relaes inter-
e governos regionais na qual cada ente federativo,
nacionais, pelo princpio, dentre outros,
GHQLGRJHRJUDFDPHQWHPDQWpPVXDVREHUDQLD
a. do pluralismo poltico.
b. uma forma de Estado freqente: h mais de duas
b. da garantia do desenvolvimento nacional.
vezes estados federais que unitrios.
c. da erradicao da marginalidade e reduo das de-
c. No permite diferentes formas de governo entre as
sigualdades sociais.
unidades regionais ou locais componentes da fede-
d. da dignidade da pessoa humana.
rao e as unidades centrais.
e. da no-interveno.
d. costumeiro em pases relativamente extensos ou
aqueles de menor diversidade social e cultural.
14. (FCC/ TRF - 5 REGIO/ Analista Judicirio/ Tecno-
e. A autonomia federativa assenta-se na existncia
logia da Informao/ 2008) Nas suas relaes inter-
de rgos governamentais prprios e com compe-
nacionais, a Repblica Federativa do Brasil rege-se,
tncias exclusivas.
dentre outros, pelo princpio da
a. dependncia nacional e do pluralismo poltico.
19. (FCC/ DPE-SP/ Defensor Pblico/ 2006) Em relao
b. interveno e da cidadania.
dignidade da pessoa humana, prevista pela Constitui-
c. autodeterminao dos povos.
o Federal de 1988 como fundamento da Repblica
d. VROXomREpOLFDGRVFRQLWRVHGDVREHUDQLD
)HGHUDWLYDGR%UDVLOpSRVVtYHODUPDU
e. vedao de asilo poltico.

25
a. um direito pblico subjetivo expresso numa nor- 23. (FCC/ TRF - 2 REGIO/ Tcnico Judicirio/ Contabili-
ma regra. dade/ 2012) Caio, Pompeu, Cesar, Flvio e Otaviano,
b. Por ser fundamento e princpio constitucional es- so, respectivamente, policial civil, delegado de pol-
WUXWXUDQWH p GHQVLFDGD DR ORQJR GR WH[WR FRQVWL- cia, promotor de justia, juiz de direito e jornalista. J-
tucional. lio, sem estar em estado de fragrante delito, foi preso
c. Por ser uma norma programtica a sua efetivao no interior de casa durante o dia por policiais militares
depender de polticas pblicas que venham a ser que, sem autorizao do morador, arrebentaram a por-
adotadas pelos governantes. ta de entrada e efetuaram sua priso. No caso, para
IVAN LUCAS

d. eVXFLHQWHSDUDVXDUHDOL]DomRRUHVSHLWRDRVGL- que a priso de Jlio seja vlida, necessria a prvia


reitos individuais clssicos: direito vida, liberda- determinao de
de, igualdade, segurana e propriedade. a. Cesar
e. Exprime um conceito extremamente vago que b. Pompeu.
comporta ampla discricionariedade judicial, deven-
c. Caio.
do, portanto, ser evitado em demandas judiciais.
d. Otaviano.
e. Flvio
20. (FCC/ MPE-AP/ Tcnico Administrativo/ 2009) A Cons-
tituio Federal, no captulo reservado aos princpios
24. (FCC/ TRF - 2 REGIO/ Tcnico Judicirio/ Conta-
fundamentais, estabelece que a Repblica Federativa
bilidade/ 2012) O sindicato dos aerovirios realizou
do Brasil rege-se nas suas relaes internacionais,
dentre outras hipteses, pelo princpio da SDVVHDWDSDFtFDHVHPDUPDVQD/DJRD5RGULJRGH
a. no interveno. Freitas, na Cidade Rio de Janeiro. Essa reunio ser
b. dependncia nacional condicionada. considerada lcita desde que
c. determinao dos povos quanto dignidade da a. tenha sido previamente autorizada pela autoridade
pessoa humana. competente e no seja vinculada a greve ilegal.
d. VROXomREpOLFDHQmRDUELWUDOGRVFRQLWRV b. tenha sido previamente autorizada pela autoridade
e. vedao de asilo e de exlio poltico-partidrio. competente, apenas.
c. no tenha frustrado outra reunio anteriormente
21. (FCC/ TRT - 4 REGIO/ Juiz do Trabalho/ 2012) Ten- convocada para o mesmo local, sendo apenas exi-
do sido noticiado pela imprensa que haviam sido for- gido prvio aviso autoridade competente.
muladas denncias contra si perante a Corregedoria- d. no critique os atos administrativos dos Estados e
*HUDOGD8QLmRDVTXDLVDUPDVHUHPLQYHUtGLFDVXP dos Municpios, apenas.
indivduo formula pedido junto ao rgo para obter, por e. no critique os atos administrativos da Unio, apenas.
PHLRGHFHUWLGmRDLGHQWLFDomRGRVDXWRUHVGDVUHIH-
ULGDVGHQ~QFLDVDPGHTXHDFHUWLGmRHPTXHVWmR 25. (FCC/ DPE-SP/ Defensor Pblico/ 2012) A respeito dos
possa ser utilizada, na defesa de direitos, como meio direitos e das garantias fundamentais pr-vistos na or-
de prova em processo judicial. O pedido para obteno GHPFRQVWLWXFLRQDOEUDVLOHLUDYLJHQWHpFRUUHWRDUPDU
GDFHUWLGmRpLQGHIHULGR(PWDOVLWXDomRDPGHYHU a. As pessoas presas, ainda que provisoriamente, em
sua pretenso acolhida perante o rgo correicional, razo de processo penal, tm seus direitos polti-
poder o indivduo valer-se judicialmente da impetra- cos suspensos, no podendo, inclusive, exercer
o de direito de voto.
a. mandado de injuno. b. Para efeitos do disposto no artigo 5, XI, da Cons-
b. ao popular.
tituio Federal de 1988, o conceito normativo de
c. habeas corpus.
FDVDGHYHVHUHQWHQGLGRGHIRUPDDEUDQJHQWHGH
d. habeas data.
forma a alcanar qualquer compartimento privado
e. mandado de segurana.
QmRDEHUWRDRS~EOLFRRQGHDOJXpPH[HUFHSURV-
so ou atividade, mas no deve ser estendido a
22. (FCC/ TJ-GO Juiz/ 2012) Relativamente desapro-
SULDomRSRULQWHUHVVHVRFLDOSDUDQVGHUHIRUPDDJUiULD EDUUDFRV FRQVWUXtGRV LUUHJXODUPHQWH SRU H[HP-
a. as benfeitorias necessrias sero indenizadas em plo, em reas pblicas.
dinheiro, mas no as teis. c. Segundo entendimento consolidado do Supremo
b. o decreto que declarar o imvel como de interesse Tribunal Federal, ao contrrio da busca domiciliar e
VRFLDOSDUDQVGHUHIRUPDDJUiULDDXWRUL]DR0X- da decretao da priso, ressalvada a situao de
nicpio a propor a ao de desapropriao. DJUkQFLD SHQDO QmR VH FRQVLGHUD FOiXVXOD FRQV-
c. cabe lei ordinria estabelecer procedimento con- titucional de reserva de jurisdio a interceptao
traditrio especial, de rito sumrio, para o processo telefnica, podendo esta ser determinada, inclu-
judicial de desapropriao. sive, por Comisso Parlamentar de Inqurito, nos
d. RRUoDPHQWR[DUiDFDGDGRLVDQRVRYROXPHWRWDO termos do artigo 58, 3 , da Constituio Federal
de ttulos da dvida agrria, assim como o montante de 1988.
de recursos para atender ao programa de reforma d. A prtica de racismo, a ao de grupos armados,
agrria no binio. civis ou militares, contra a ordem constitucional e o
e. so isentas de impostos federais, estaduais e mu- (VWDGR'HPRFUiWLFRHDSUiWLFDGRWUiFRLOtFLWRGH
nicipais as operaes de transferncia de imveis HQWRUSHFHQWHVHGHGURJDVDQVVmRFRQVLGHUDGRV
GHVDSURSULDGRVSDUDQVGHUHIRUPDDJUiULD crimes imprescritveis.

26
e. O disposto no artigo 5, XXXVI, da Constituio 28. (CESGRANRIO/ BACEN/ Tcnico do Banco Central/
Federal de 1988, segundo o qual a lei no pre- Area 1/ 2010) Juan, cidado argentino residente no
judicar o direito adquirido, o ato jurdico perfeito %UDVLO GLULJLXVH DR %DQFR &HQWUDO D P GH HQFDPL-
nhar uma petio dirigida a determinada autoridade,

NOES DE DIREITO CONSTITUCIONAL


HDFRLVDMXOJDGDQmRSURLELXDUHWURDWLYLGDGHGD
lei, mas, apenas, protegeu o direito adquirido, o ato reclamando sobre a conduta abusiva de um funcion-
jurdico perfeito e a coisa julgada de eventual ao rio. Nesse caso, a Constituio
retroativa de lei. a. condiciona o exerccio deste direito ao pagamento
de taxa correspondente ao servio.
26. (CESGRANRIO/ TJ-RO/ Tcnico Judicirio/ 2008) O b. permite a Juan exercer tal direito.
chamado princpio do Juiz Natural assegura que c. assegura esse direito apenas aos brasileiros (natos
a. a lei no excluir da apreciao do Poder Judicirio ou naturalizados).
d. assegura esse direito apenas aos brasileiros no
leso ou ameaa a direito.
gozo dos direitos polticos.
b. ningum ser processado nem sentenciado, seno
e. no assegura tal direito.
pela autoridade competente.
c. QLQJXpPVHUiSUHVRVHQmRHPDJUDQWHGHOLWRRX
29. (CESGRANRIO/ BACEN/ Analista do Banco Central/
por ordem escrita e fundamentada de autoridade
Todas as reas/ 2010) Na hiptese de o Banco Central
judiciria competente.
vir a praticar ato manifestamente ilegal e lesivo ao pa-
d. nenhum brasileiro ser extraditado, salvo o natura-
trimnio pblico, um cidado brasileiro, indignado com
lizado, em caso de crime comum, praticado antes
o ocorrido e com o propsito de anular o referido ato,
da naturalizao, ou de comprovado envolvimento
pode ajuizar
HPWUiFRLOtFLWRGHHQWRUSHFHQWHVHGURJDVDQV
a. ao popular.
e. aos litigantes, em processo judicial ou administrativo,
b. ao civil pblica.
so assegurados o contraditrio e a ampla defesa.
c. mandado de segurana coletivo.
27. (CESGRANRIO/ BACEN/ Tcnico do Banco Central/ d. mandado de injuno coletivo.
rea 2/ 2010) A Constituio Federal de 1988, em seu e. habeas data.
Art. 5, estabelece os direitos e deveres individuais do
cidado: Todos so iguais perante a lei, sem distino 30. &(6*5$15,2 7-52 2FLDO GH -XVWLoD   $
de qualquer natureza, garantindo-se aos brasileiros e &RQVWLWXLomR DUPD TXH D FDVD p DVLOR LQYLROiYHO GR
aos estrangeiros residentes no pas, a inviolabilidade indivduo, ningum nela podendo penetrar sem o con-
do direito vida, liberdade, igualdade, seguran- VHQWLPHQWR GR PRUDGRU $UW  ;, $ HVVH UHVSHLWR
oDHjSURSULHGDGH7HQGRFRPREDVHHVWHDUWLJRGD FRQVLGHUHDVDUPDWLYDVDVHJXLU
&RQVWLWXLomRSRGHVHDUPDUTXH I permitido penetrar na casa, a qualquer hora do
I qualquer pessoa, detida pela segurana, dever ser dia, mesmo sem o consentimento do morador, des-
imediatamente entregue aos rgos policiais, no de que haja autorizao judicial para tanto.
podendo ser submetida a nenhum tipo de maltrato II permitido penetrar na casa, a qualquer hora do
ou humilhao; dia, em caso de desastre ou para prestar socorro.
II D SUiWLFD GH UDFLVPR FRQVWLWXL FULPH LQDDQoiYHO III e SHUPLWLGR SHQHWUDU QD FDVD TXDQGR KRXYHU D-
e somente ser tolerada em comunidades de imi- grante delito, mas somente durante o dia.
grantes, em cuja cultura essa prtica seja permitida; IV O conceito de casa deve ser interpretado de forma
III um suspeito, ao ser detido, poder solicitar a iden- restritiva, no incluindo, por exemplo, quarto de hotel.
WLFDomRGHVHXVGHWHQWRUHVFRQWXGRRVYLJLODQWHV
no so obrigados a faz-la; Tendo em vista o direito fundamental citado, de acordo
IV um meliante, ao ser detido pela segurana de uma com a prpria Constituio, e com a jurisprudncia do
instituio, dever ser informado de seus direitos, 67)p VmR FRUUHWD V $3(1$6D V DUPDWLYD V
inclusive o de permanecer calado, se assim o de- a. II
sejar; b. III
V DSUiWLFDGHWRUWXUDFRQWUDSUHVRVFRPRPGHRE- c. I e IV
WHQomRGHLQIRUPDo}HVRXFRQVVmRVHUiFRQVLGH- d. I, II e IV
UDGD FULPH LQDDQoiYHO SRU HOD UHVSRQGHQGR QmR e. I, III e IV
s os executantes, mas tambm os mandantes e
os que, tendo conhecimento e podendo evit-la, se
31. &(6*5$15,27-522FLDOGH-XVWLoD &DVR
omitiram.
uma determinada autoridade administrativa se recu-
sasse (ilegalmente) a fornecer certido de tempo de
(VWmRFRUUHWDV$3(1$6DVDUPDo}HV
servio, requerida por funcionrio pblico que dela ne-
a. I e III.
FHVVLWDVVHDPGHVROLFLWDUVXDDSRVHQWDGRULDVHULD
b. I, IV e V.
c. II, III e IV. cabvel ajuizar
d. II, III e V. a. +DEHDV'DWD.
e. II, IV e V. b. Ao Civil Pblica.

27
c. Ao Popular. 35. (CONSULPLAN/ TRE-RS/ Tcnico Administrativo/
d. Mandado de Injuno. 2008) Sobre os direitos e deveres individuais e coleti-
e. Mandado de Segurana. vos previstos na Constituio da Repblica Federativa
do Brasil, marque a alternativa INCORRETA:
32. (CONSULPLAN/ TSE/ Tcnico Judicirio/ rea Admi- a. A lei estabelecer o procedimento para desapro-
QLVWUDWLYD   3HULJRVD TXDGULOKD GH QDUFRWUDFDQ- priao por necessidade ou utilidade pblica, ou
por interesse social, mediante justa e prvia indeni-
tes em determinada cidade brasileira planeja execu-
zao em dinheiro, ressalvados os casos previstos
IVAN LUCAS

tar uma srie de atentados, com real possibilidade de


na Constituio da Repblica.
produzir mortes entre civis, com o intuito de espalhar
b. No caso de iminente perigo pblico, a autoridade
pnico nesta cidade. Gasparzinho, integrante da fac- competente poder usar de propriedade particular,
o criminosa preso e, em interrogatrio, por meio assegurada ao proprietrio indenizao anterior, se
da tcnica do waterboarding DIRJDPHQWRVLPXODGR  houver dano.
aplicada pela autoridade policial, confessa e fornece c. Aos autores pertence o direito exclusivo de utili-
detalhes sobre o plano terrorista. Tal fato possibilita a zao, publicao ou reproduo de suas obras,
ao preventiva das foras de segurana daquela uni- transmissvel aos herdeiros pelo tempo que a lei
dade da federao que, assim, conseguem impedir a [DU
execuo dos eventos. A respeito da situao descrita, d. assegurado a todos o acesso informao e res-
pFRUUHWRDUPDUTXH guardado o sigilo da fonte, quando necessrio ao
a. amparada pela supremacia do interesse pblico. H[HUFtFLRSURVVLRQDO
b. viola o princpio da individualizao da pena. e. A propriedade atender a sua funo social.
c. ponderando os bens jurdicos em oposio, am- GABARITO
parada pelo princpio da proporcionalidade.
d. viola o devido processo legal. 1. c
2. b
33. (CONSULPLAN/ Prefeitura de Campo Verde MT/ 3. c
Contador/ 2010) A Constituio da Repblica Federa- 4. c
WLYDGR%UDVLOGHHVWDEHOHFHFRPRFULPHLQDDQ- 5. d
vel, EXCETO: 6. a
a. Prtica do racismo. 7. d
b. Prtica de tortura.
8. d
c. Crime poltico.
9. e
d. 7UiFRLOtFLWRGHHQWRUSHFHQWHV
10. e
e. Terrorismo.
11. c
34. (CONSULPLAN/ Prefeitura de Campo Verde MT/ 12. e
13. e
Contador/ 2010) Nos termos da Carta Constitucional
14. c
GHpOLYUHDDVVRFLDomRSURVVLRQDORXVLQGLFDO
15. d
observado que, EXCETO:
16. b
a. A lei no poder exigir autorizao do Estado para
17. a
a fundao de sindicato, ressalvado o registro no
18. e
rgo competente, vedadas ao Poder Pblico a in-
19. b
terferncia e a interveno na organizao sindical. 20. a
b. Ao sindicato cabe a defesa dos direitos e interes- 21. e
ses coletivos ou individuais da categoria, inclusive 22. e
em questes judiciais ou administrativas. 23. e
c. 1LQJXpP VHUi REULJDGR D OLDUVH RX D PDQWHUVH 24. c
OLDGRDVLQGLFDWR 25. e
d. vedada a criao de mais de uma organizao 26. b
sindical, em qualquer grau, representativa de ca- 27. b
WHJRULDSURVVLRQDORXHFRQ{PLFDQDPHVPDEDVH 28. b
WHUULWRULDOTXHVHUiGHQLGDSHORVWUDEDOKDGRUHVRX 29. a
empregadores interessados, no podendo ser infe- 30. a
rior rea de um municpio. 31. e
32. d
e. A participao dos sindicatos nas negociaes co-
33. c
letivas de trabalho facultativa.
34. e
35. b

28
NOES DE DIREITO ADMINISTRATIVO

SUM RIO

ADMINISTRAO PBLICA. CARACTERSTICAS. MODOS DE ATUAO. PERSONALIDADE JURDICA


DO ESTADO. RGOS E AGENTES PBLICOS. PRINCPIOS BSICOS DA ADMINISTRAO PBLICA ..... 382
PODERES ADMINISTRATIVOS .....................................................................................................................387
ATOS ADMINISTRATIVOS. ATOS INTERNA CORPORIS. ATOS LEGISLATIVOS. ATOS POLTICOS.
ATOS ADMINISTRATIVOS VINCULADOS E DISCRICIONRIOS. INVALIDAO DOS ATOS
ADMINISTRATIVOS: REVOGAO. ANULAO. EFEITOS DECORRENTES...............................................395
CONTROLE DA ADMINISTRAO: ADMINISTRATIVO, JUDICIAL E LEGISLATIVO. MEIOS DE
CONTROLE ADMINISTRATIVOS. CONTROLE COMUM. CONTROLE ESPECIAL ........................................412
PROCESSO ADMINISTRATIVO FEDERAL (LEI N. 9.784, DE 29 DE JANEIRO DE 1999) ...............................427
LICITAES E CONTRATOS: LICITAES E CONTRATOS (LEI N. 8.666, DE 21 DE JUNHO 1993).
PREGO (LEI N. 10.520, DE 17 DE JULHO DE 2002 E ALTERAES POSTERIORES E DECRETO N.
5.450, DE 31 DE MAIO DE 2005) .........................................................................................................439/454
SISTEMA DE REGISTRO DE PREOS (DECRETO N. 7.892, DE 23 DE JANEIRO DE 2013) ...........................461
PRINCPIOS DA ADMINISTRAO PBLICA praticar um ato que no atenda a lei, este dever ser anu-
lado pela prpria Administrao ou pelo Poder Judicirio, se
Esse tema de extrema importncia para o Direito provocado.
Administrativo e, por consequncia, para provas de importante compreender que o princpio da lega-
concurso. lidade uma exigncia que decorre do Estado de Direito,
Princpios so os alicerces da cincia. No imenso que impe a necessidade de submisso ao imprio da lei.
SUpGLRMXUtGLFRRXVHMDQRRUGHQDPHQWRMXUtGLFRRVSULQ- Desse modo, a Administrao Pblica somente poder atuar
cpios formam a base. Imagine que o nosso ordenamento quando autorizada por lei.
jurdico seja um prdio, sendo as janelas as leis e a base QUESTO DE CONCURSO
desse prdio, os princpios. Se a lei ferir um princpio, o
prdio estar em runas. Desse modo, os princpios chegam (CESPE / ANEEL / TCNICO ADMINISTRA-
a ser mais importantes do que a prpria lei. Se a lei ferir um TIVO / 2010) De acordo com o princpio da
princpio, ser ilegal. legalidade, a administrao pblica somente
Os princpios administrativos devem ser observados pode fazer o que a lei lhe permite.
por toda a Administrao Pblica em seus diversos nveis
ou pessoas: seja pelos rgos, entidades ou pelos agentes -XVWLFDWLYD como vimos, a administrao s pode
pblicos que desempenhem qualquer funo pblica. Assim agir quando a lei autorizar. Questo certa.
que voc iniciar suas atividades na Administrao Pblica,
com certeza ter que atender todos os princpios que orien-
tam as atividades pblicas. (CESPE / CFO-PMDF / 2010) Pelo princpio
Para Bandeira de Mello, violar um princpio muito da legalidade, aplicvel no mbito da adminis-
mais grave que transgredir uma norma qualquer. A desaten- trao pblica, o administrador pblico pode
omRDRSULQFtSLRLPSOLFDRIHQVDQmRDSHQDVDXPHVSHFtFR praticar todas as condutas que no estejam
J. W. GRANJEIRO / RODRIGO CARDOSO

mandamento obrigatrio, mas a todo o sistema de coman- expressamente proibidas em lei.


dos. a mais grave forma de ilegalidade ou inconstituciona-
OLGDGH>@ -XVWLFDWLYD vimos que o administrador s pode
Os princpios orientam todo o nosso ordenamento. SUDWLFDUDOJXPDFRQGXWDVHDOHLDXWRUL]DU$TXHVWmRDUPD
Desse modo, se a lei contrariar um princpio esta no poder que o agente pode praticar todas as condutas que no estejam
produzir efeitos jurdicos. expressamente proibidas em lei. Questo errada.
Tradicionalmente, os princpios so divididos em: prin-
PRINCPIO DA IMPESSOALIDADE
cpios expressos na Constituio e princpios no expressos
(ou implcitos). Ento, vamos detalhar o tema!
Tradicionalmente, esse princpio estudado sob dois
aspectos.
PRINCPIOS EXPRESSOS
a) O primeiro o de que o agente deve sempre atuar
visando o interesse pblico. Desse modo, a Admi-
Presentes no texto Constitucional. O art. 37, caput, da
nistrao deve atuar de forma impessoal, sendo
Constituio assim dispe: vedado qualquer ato discriminatrio que vise a pre-
judicar ou favorecer algum.
Art. 37. A administrao pblica direta e indireta de
qualquer dos Poderes da Unio, dos Estados, do
Distrito Federal e dos Municpios obedecer aos
Ao interpretar esse princpio, chega-se a concluso
princpios de legalidade, impessoalidade, mora- de que proibido ao agente praticar ato para atender inte-
lidade, publicidade e HFLrQFLD [...]. resses pessoais. A ao do agente deve atender Lei, que
representa comando geral e abstrato. Presume-se que o
PRINCPIO DA LEGALIDADE comando legal seja impessoal. O princpio da impessoali-
dade corresponde ao princpio da igualdade ou isonomia.
Toda ao do administrador pblico deve ser pautada A aplicao desse princpio vista, por exemplo, na
na lei. Ningum ser obrigado a fazer ou deixar de fazer realizao de licitao, de concurso pblico etc.
alguma coisa seno em virtude de lei (CF, art. 5, II). S a lei Se o agente praticar ato com objetivo de interesses pes-
tem a prerrogativa de inovar no mundo jurdico, s a lei pode soais em detrimento do interesse pblico, estar incorrendo
trazer novos direitos ou restries. em abuso de poder na modalidade GHVYLRGHQDOLGDGH.
Ateno: a principal diferena entre a legalidade admi-
nistrativa e a aplicada ao particular que o administrador ([HPSOLFDQGRRWHPDa remoo de ofcio descrita
no art. 36 da Lei n. 8.112/1990 instituto utilizado pela Admi-
pblico s pode fazer o que a lei autoriza, enquanto o
nistrao Pblica para atender s necessidades funcionais
particular pode fazer tudo o que a lei no probe.
do rgo ou entidade. Logo, se o servidor for removido por
O administrador s pode agir quando a lei autoriza
perseguio ou mesmo para punio, o ato dever ser anu-
(produo de atos discricionrios) ou quando ela exige sua
lado, pois houve GHVYLRGHQDOLGDGH. A remoo prerro-
atuao (produo de atos vinculados). Se a Administrao

30
gativa que a Administrao tem para melhor desempenhar II O servidor pblico no poder jamais desprezar
a prestao do servio sociedade e no forma de punio o elemento tico de sua conduta. Assim, no ter
que decidir somente entre o legal e o ilegal, o justo
de servidor.
e o injusto, o conveniente e o inconveniente, o opor-
tuno e o inoportuno, mas principalmente entre o ho-
b) o segundo aspecto veda que o agente pblico nesto e o desonesto, consoante s regras contidas
valha-se da atividade desenvolvida pela adminis- no art. 37, caput, e 4, da Constituio Federal.
trao para obter promoo pessoal. Por exem- III A moralidade da Administrao Pblica no se
plo: em uma obra pblica, nunca se pode anunciar limita distino entre o bem e o mal, devendo ser
acrescida GDLGHLDGHTXHRPpVHPSUHREHPFR-
como realizao GR*RYHUQDGRU;QDGLYXOJDomR
PXP2HTXLOtEULRHQWUHDOHJDOLGDGHHDQDOLGDGH
$QDODREUDQmRIRLUHDOL]DGDFRPGLQKHLURGR*R- na conduta do servidor pblico, que poder con-
YHUQDGRU;HVLPFRPGLQKHLURS~EOLFR solidar a moralidade do ato administrativo.

Nesse contexto, os atos so do rgo e no dos agentes ,QVWUXPHQWRV TXH YLVDP FRPEDWHU D LPRUDOLGDGH
pblicos teoria do rgo. O 1 do art. 37 da Constituio DGPLQLVWUDWLYD
disciplina o tema com a seguinte redao:
Diversos institutos combatem a imoralidade administra-
1 A publicidade dos atos, programas, obras, ser- tiva. A seguir, comentamos alguns deles.
vios e campanhas dos rgos pblicos dever a) A Lei n. 8.429/1992 que trata dos atos de impro-
ter carter educativo, informativo ou de orientao bidade administrativa. A probidade administrativa
social, dela no podendo constar nomes, smbolos uma espcie do gnero moralidade adminis-
ou imagens que caracterizem promoo pessoal de trativa, que recebeu tratamento prprio no 4 do
autoridades ou servidores pblicos. art. 37 da Constituio. O agente mprobo, conse-

NOES DE DIREITO ADMINISTRATIVO


quentemente, imoral. Note ento que a probida-
QUESTO DE CONCURSO de um aspecto da moralidade, portanto no so
expresses idnticas.
(CESPE / ABIN / AGENTE TCNICO DE
INTELIGNCIA / 2010) O princpio da im- A Lei n. 8.429/1992 prev trs espcies de atos
pessoalidade decorre, em ltima anlise, do considerados mprobos: os que importam enriquecimento
ilcito, os que causam prejuzos ao errio e os que
princpio da isonomia e da supremacia do in- atentam contra os princpios da Administrao Pblica.
teresse pblico, no podendo, por exemplo, Comentaremos mais sobre o tema no captulo prprio.
a administrao pblica conceder privilgios
LQMXVWLFDGRV HP FRQFXUVRV S~EOLFRV H OLFLWD- b) A ao popular tambm instituto de proteo
o}HVQHPXWLOL]DUSXEOLFLGDGHRFLDOSDUDYHL- imoralidade administrativa. Dispe a Constituio
cular promoo pessoal. em seu art. 5, inciso LXXIII:

LXXIII qualquer cidado parte legtima para


-XVWLFDWLYD o princpio da impessoalidade probe a
propor ao popular que vise a anular ato lesivo ao
FRQFHVVmR GH SULYLOpJLRV LQMXVWLFDGRV HP FRQFXUVR H OLFL-
patrimnio pblico ou de entidade de que o Estado
WDo}HVHSURtEHDSURPRomRSHVVRDOHPSXEOLFLGDGHRFLDO participe, PRUDOLGDGH DGPLQLVWUDWLYD, ao meio
Questo certa. DPELHQWHHDRSDWULP{QLRKLVWyULFRHFXOWXUDOFDQ-
do o autor, salvo comprovada m-f, isento de cus-
PRINCPIO DA MORALIDADE tas judiciais e do nus da sucumbncia.

Smula Vinculante
A moralidade administrativa determina que a conduta
do administrador pblico deve ser tica, pautada na hones-
Smulas so orientaes que os Tribunais proferem a
tidade. O agente administrativo, como ser humano dotado
respeito do que entendem acerca de determinadas mat-
da capacidade de atuar, deve, necessariamente, distinguir
rias, advinda principalmente da consolidao de jurisprudn-
o bem do mal, o honesto do desonesto. E, ao atuar, no
cia por meio de decises reiteradas no mesmo sentido. As
poder desprezar o elemento tico de sua conduta. Assim,
Smulas, tradicionalmente, no possuem fora vinculante,
no ter de decidir somente entre o legal e o ilegal, o justo
ou seja, no obrigam que os outros Tribunais e a Administra-
e o injusto, o conveniente e o inconveniente, o oportuno e o sigam o mesmo posicionamento.
o inoportuno, mas tambm entre o honesto e o desonesto. )DODPRVWUDGLFLRQDOPHQWHSRUTXHD(PHQGD&RQVWLWX-
A Lei n. 9.784/1999 trata a moralidade em seu art. 2, cional 45/2004, acrescentou o art. 103-A Constituio. a
IV, descrevendo que o administrador tem de ter uma atua- seguinte a redao do referido artigo:
omRVHJXQGRSDGU}HVpWLFRVGHSURELGDGHGHFRURHERDIp
O Decreto n. 1.171/1994, que representa o Cdigo de Art. 103-A. O Supremo Tribunal Federal poder, de
eWLFD3URVVLRQDOGR6HUYLGRU3~EOLFR&LYLOGR3RGHU([HFX- ofcio ou por provocao, mediante deciso de dois
tivo Federal, estabelece que: teros dos seus membros, aps reiteradas decises

31
sobre matria constitucional, aprovar smula que, Conforme anteriormente mencionado, o STF entende
DSDUWLUGHVXDSXEOLFDomRQDLPSUHQVDRFLDOter no ser inconstitucional a nomeao entre parentes para
HIHLWRYLQFXODQWHem relao aos demais rgos do o exerccio de cargo poltico. Ex.: considere que Scrates,
Poder Judicirio e administrao pblica direta
JRYHUQDGRUGR(VWDGR;WHQKDQRPHDGRVHXOKR*DOLOHX
e indireta, nas esferas federal, estadual e munici-
para Secretrio de Transporte do Estado. Essa nomeao,
pal, bem como proceder sua reviso ou cancela-
para o STF, no atenta contra a Constituio, pois repre-
mento, na forma estabelecida em lei
senta a nomeao para ocupar cargo poltico. No entanto,
VH6yFUDWHVQRPHDUVHXOKRSDUDVHUVHXDVVHVVRU DJHQWH
Com efeito, foi editada a Smula Vinculante n. 13,
DGPLQLVWUDWLYR  HVWD VHUi LQFRQVWLWXFLRQDO SRUTXH FRQJXUD
conhecida como Smula antinepotismo, que assim preceitua:
prtica do nepotismo.
13 A nomeao de cnjuge, companheiro ou parente
QUESTO DE CONCURSO
HPOLQKDUHWDFRODWHUDORXSRUDQLGDGHDWpRWHUFHLURJUDX
inclusive, da autoridade nomeante ou de servidor da mesma
(CESPE / SEPLAG-DF / NVEL SUPERIOR /
SHVVRD MXUtGLFD LQYHVWLGR HP FDUJR GH GLUHomR FKHD RX
2009) O nepotismo corresponde a prtica que
assessoramento, para o exerccio de cargo em comisso ou pode violar o princpio da moralidade admi-
GHFRQDQoDRXDLQGDGHIXQomRJUDWLFDGDQDDGPLQLVWUD- nistrativa. A esse respeito, de acordo com a
o pblica direta e indireta em qualquer dos Poderes da jurisprudncia do STF, seria inconstitucional
Unio, dos Estados, do Distrito Federal e dos Municpios, ato discricionrio do Governador do Distrito
compreendido o ajuste mediante designaes recprocas, Federal que nomeasse parente de segundo
viola a Constituio Federal. grau para o exerccio do cargo de secretrio
O objetivo do texto acima combater a prtica do de Estado da SEAPA/DF.
nepotismo dento da Administrao Pblica, que representa
DQRPHDomRGHSDUHQWHVFRQVDQJXtQHRVRXSRUDQLGDGHH -XVWLFDWLYD A nomeao de agentes polticos no
J. W. GRANJEIRO / RODRIGO CARDOSO

do cnjuge, para o exerccio de cargo em comisso ou FRQJXUDSUiWLFDGHQHSRWLVPR4XHVWmRHUUDGD


IXQomRGHFRQDQoD.
Essa prtica viola o princpio da moralidade, entre (TRE-ES / TCNICO JUDICIRIO / REA:
outros. Realmente imoral nomear parentes para ocupar ADMINISTRATIVA / 2010) Contraria o princ-
cargo em comisso aquele provido sem concurso pblico. pio da moralidade o servidor pblico que no-
meie o seu sobrinho para um cargo em comis-
A nomeao de ocupante desse cargo deve ter como base
so subordinado.
a competncia do servidor nomeado, e no recair sobre vn-
culo familiar.
-XVWLFDWLYD A nomeao de sobrinho (parente em
Apesar da clareza da redao da Smula em estudo
3 grau) para o exerccio de cargo em comisso (agente
que probe a prtica do nepotismo em todos os nveis, o STF, administrativo) configura prtica de nepotismo e, por
DRMXOJDUR5(DUPRXTXHDQRPHDomRGHSDUHQ- consequncia contraria o princpio da moralidade, entre
tes para cargo poltico no inconstitucional. Pode-se, outros. Questo certa.
HQWmRDUPDUTXHDUHGDomRGD6~PXODDOFDQoDVRPHQWHD
nomeao de agentes administrativos (ocupantes de cargo PRINCPIO DA PUBLICIDADE
HPFRPLVVmRRXIXQomRGHFRQDQoD VHQGRDIDVWDGDVXD
aplicao aos agentes polticos! Esse princpio informa que a atividade da administrao
3RVWHULRUPHQWH D 6XSUHPD &RUWH UHDUPRX VHX SRVL- deve ser transparente. Os atos administrativos gerais e as
cionamento inicial ao julgar medida cautelar na Rcl 6.650/ leis devem ser publicados para terem validade perante ter-
PR, nos seguintes termos: ceiros. Assim, esse princpio impe Administrao Pblica
o dever de conceder ampla divulgao de seus atos, pois
AGRAVO REGIMENTAL EM MEDIDA CAUTELAR VyDVVLPRVDGPLQLVWUDGRVSRGHUmRVFDOL]DUDFRQGXWDGRV
EM RECLAMAO. NOMEAO DE IRMO agentes pblicos. Pense: como voc ir controlar a conduta
DE GOVERNADOR DE ESTADO. CARGO DE GRVDJHQWHVS~EOLFRVVHHVWHVQmRDGLYXOJDP"
SECRETRIO DE ESTADO. NEPOTISMO. S- O inciso XXXII do art. 5 da Constituio informa que:
MULA VINCULANTE N. 13. INAPLICABILIDADE
AO CASO. CARGO DE NATUREZA POLTICA. XXXIII Todos tm direito a receber dos rgos p-
AGENTE POLTICO. ENTENDIMENTO FIRMADO blicos informaes de seu interesse particular, ou
NO JULGAMENTO DO RECURSO EXTRAORDI- de interesse coletivo ou geral, que sero prestadas
NRIO 579.951/RN. OCORRNCIA DA FUMAA no prazo da lei, sob pena de responsabilidade, res-
DO BOM DIREITO. 1. Impossibilidade de submis- VDOYDGDVDTXHODVFXMRVLJLORVHMDLPSUHVFLQGtYHO
so do reclamante, Secretrio Estadual de Trans- segurana da sociedade e do Estado.
porte, agente poltico, s hipteses expressamente
elencadas na Smula Vinculante n. 13, por se tra- Conforme visto, esse princpio no absoluto, pois
tar de cargo de natureza poltica. (STF, AG. REG. a prpria Constituio autoriza que as informaes que
1$0('&$871$5FO1355(/$725$ coloquem em risco a segurana da sociedade e do Estado
0,1(//(1*5$&,(,1)250$7,92  podem ser restritas.

32
No mesmo sentido, o inciso LX do art. 5 da Constitui- Esse princpio informa que o administrador
o, prev que: pblico s pode fazer o que a lei autoriza,
Legalidade
enquanto o particular pode fazer tudo o que a
LX a lei s poder restringir a publicidade dos atos lei no probe.
processuais quando a defesa da intimidade ou o
Esse princpio estudado em dois aspectos:
interesse social o exigirem;
a) o agente deve sempre atuar visando o inte-
resse pblico. Desse modo, a Administrao
Vimos que a Administrao deve dar publicidade a seus
deve atuar de forma impessoal, sendo vedado
DWRVTXHVHGDUiTXDQGRGDSXEOLFDomRQR'LiULR2FLDOGR
Impessoalidade qualquer ato discriminatrio que visa a prejudi-
ente poltico. A Unio, os Estados e o Distrito Federal pos-
car ou favorecer algum.
suem DLiULR 2FLDO 3RGH RFRUUHU GH DOJXP PXQLFtSLR QmR
b) veda que o agente pblico valha-se da ati-
SRVVXLU'LiULR2FLDOQHVVHFDVRRVDWRVWHUmRSXEOLFLGDGH
vidade desenvolvida pela administrao para
FRPVXDD[DomRQDVHGHGRyUJmRFRPRSRUH[emplo, a
obter promoo pessoal.
D[DomRGHFySLDGRDWRHPXPTXDGURGHDYLVRV
O agente deve agir com tica, com honestidade
3RU P FXPSUH FRQVLJQDU TXH RV DWRV LQWHUQRV GRV Moralidade
rgos podem ter publicidade quando publicados em bole- e com boa-f.
Possibilita transparncia na atuao da admi-
tins internos como, por exemplo, a concesso de frias a um Publicidade
servidor. Mas os atos que causarem efeitos externos devem nistrao.
$HFLrQFLDpGHYHUGD$GPLQLVWUDomR3~EOLFD
VHU SXEOLFDGRV HP 'LiULR 2FLDO FRPR SRU H[HPSOR XP
Decreto, a nomeao de um servidor etc. traduzindo-se no dever de todo agente pblico
(FLrQFLD
de realizar suas atribuies com presteza, per-
feio e rendimento funcional.
IMPORTANTE
Lembre que a publicidade dos atos no absoluta, pois cabe PRINCPIOS NO EXPRESSOS NA CONSTITUIO

NOES DE DIREITO ADMINISTRATIVO


exceo. Exemplo: licito ABIN guardar sigilo sobre as
atividades que versam sobre a segurana do Estado. Inicialmente trabalhamos os princpios expressos na
Constituio (art. 37, caput). Agora, iremos trabalhar os prin-
cpios no expressos na CF. No h hierarquia entre os prin-
PRINCPIO DA EFICINCIA
cpios explcitos e implcitos. Os princpios explcitos esto
WLSLFDGRVQRWH[WRFRQVWLWXFLRQDOHHPDOJXPDVOHLVHVSDU-
Na promulgao da Constituio de 1988 constavam
sas, enquanto os implcitos esto subentendidos no ordena-
no caput do art. 37 apenas os princpios de legalidade,
mento jurdico.
impessoalidade, moralidade e publicidade. Com o advento
Ento, deve-se atentar que os princpios so divididos
da Emenda Constitucional n. 19/1998 positivou-se o princ-
em princpios expressos e implcitos (no expressos).
SLRGDHFLrQFLDQRWH[WRFRQVWLWXFLRQDO1RHQWDQWRGHVGHD
promulgao da Constituio de 1988, esse princpio estava Podemos citar como exemplo de princpios expressos,
implcito, ou seja, estava presente no texto constitucional de os dispostos no art. 2 da Lei n. 9.784/1999 (Lei do processo
maneira a nortear a atuao dos agentes e das pessoas no administrativo na esfera federal), a saber:
mbito da organizao administrativa.
Art. 2 A Administrao Pblica obedecer, dentre
7HPRV GXDV DFHSo}HV UHODFLRQDGDV j HFLrQFLD
RXWURVDRVSULQFtSLRVGDOHJDOLGDGHQDOLGDGHPR-
segundo a Prof. Maria Sylvia Zanella Di Pietro:
tivao, razoabilidade, proporcionalidade, moralida-
a) modo de atuao do agente pblico: os agentes
de, ampla defesa, contraditrio, segurana jurdica,
pblicos devem desempenhar suas atribuies de LQWHUHVVHS~EOLFRHHFLrQFLD
forma a buscar os melhores resultados possveis;
b) quanto ao modo de organizar, estruturar, dis-
Em sntese, os princpios expressos so aqueles
ciplinar a Administrao Pblica: a organizao
HVFULWRVRXVHMDWLSLFDGRVHPOHLHQmRVRPHQWHDTXH-
administrativa deve ser racional.
les dispostos no art. 37, caput, da CF. J os princpios
implcitos so aqueles que no esto expressamente infor-
$ HFLrQFLD p GHYHU GD$GPLQLVWUDomR 3~EOLFD WUDGX-
mados em lei, decorrem da construo doutrinria ou juris-
zindo-se no dever de todo agente pblico de realizar suas
prudencial.
atribuies com presteza, perfeio e rendimento funcional.
2SULQFtSLRGDHFLrQFLDWHPUHODomRFRPcusto/benefcio, Ex.: YLPRVTXHRSULQFtSLRGDHFLrQFLDQmRFRQVWDYD
ou seja, a Administrao Pblica deve buscar a satisfao de maneira expressa na Constituio no ato de sua promul-
GRLQWHUHVVHS~EOLFRGHIRUPDFpOHUHUDFLRQDOHHFD]FRP gao. Esse princpio, quela poca, era considerado prin-
os escassos meios que tem a sua disposio. FtSLRLPSOtFLWR7DPEpPIRLYLVWRTXHHVVHSULQFtSLRSDVVRX
Exemplo: considere que determinado rgo municipal a constar na Constituio apenas em 1998, com a edio da
realize uma licitao para a compra de merenda escolar em Emenda Constitucional 19/1998. Desse modo, o princpio da
quantidade superior ao nmero de alunos matriculados nas HFLrQFLDHUDXPSULQFtSLRLPSOtFLWR QRDWRGDSURPXOJDomR
escolas municipais. Desse modo, o responsvel pela contra- GD&) TXHSDVVRXDVHUSULQFtSLRH[SUHVVR FRPDHGLomR
WDomRQmRIRLHFLHQWHQDFRQWUDWDomR da EC 19/1998).

33
PRINCPIOS DA SUPREMACIA DO INTERESSE PBLICO PRINCPIO DA MOTIVAO

O coletivo tem prerrogativa sobre o particular. Quando A motivao do ato administrativo de tal importncia
XPGLUHLWRFROHWLYRHRGHXPSDUWLFXODUHQWUDPHPFRQLWR que a doutrina e a jurisprudncia a consagraram como prin-
em regra deve prevalecer o coletivo. cpio. O princpio da motivao exige que a Administrao
Pblica indique os fundamentos de fato e direito de suas
Temos como exemplo da incidncia desse princpio a
GHFLV}HV3DUD'L3LHWURDVXDREULJDWRULHGDGHVHMXVWLFD
desapropriao (com justa e prvia indenizao) realizada em qualquer tipo de ato, porque se trata de formalidade
pela administrao para obter a propriedade de um imvel necessria para permitir o controle de legalidade dos atos
pertencente a um particular para a satisfao do interesse DGPLQLVWUDWLYRV ',3,(752S 
pblico. Em sntese: motivar explicar por escrito o motivo
A posio de supremacia da administrao extrema- (pressuposto ftico e pressuposto de direito) que levou a
mente importante, visto que legitima uma relao vertical administrao a praticar o ato.
com os particulares. O Poder Pblico se encontra em uma Ex.: considere que um servidor com um ano de exer-
posio de autoridade em relao aos administrados. Essa ccio em seu cargo faa um requerimento para gozar
licena para tratar de interesses particulares. Certamente, o
condio indispensvel para gerir os interesses pblicos
pedido vai ser indeferido, mas a autoridade deve explicar o
colocados em confronto com o individual. Em face dessa
porqu do indeferimento, como por exemplo: em resposta
desigualdade, o Estado tem a possibilidade de constituir ao pedido formulado pelo servidor, o mesmo no encontra
obrigaes por intermdio de atos administrativos. amaro no art. 91 da Lei n. 8.112/1990, pois este informa que
eIiFLOLGHQWLFDUHVVHSULQFtSLRTXDQGRD$GPLQLVWUDomR a concesso da licena para tratar de interesses particulares
UHDOL]DXPDVFDOL]DomRHSRVWHULRUPHQWHLQWHUGLWDXPHVWD- no direito do servidor que se encontra em estgio pro-
belecimento comercial (exerccio de poder de polcia), bem batrio. Assim, visto que o servidor requerente encontra-se
como quando um rgo pblico contratante aplica penali- em avaliao de estgio probatrio, o pedido formulado
LQGHIHULGR
dade a uma empresa contratada pelo no cumprimento de
J. W. GRANJEIRO / RODRIGO CARDOSO

Ento, no basta apenas a administrao praticar o


clusulas contratuais (clusulas exorbitantes) etc.
ato, deve, tambm, explicar suas razes por t-lo praticado.
Logo, a motivao deve apontar os fatos que levaram pr-
PRINCPIO DA AUTOTUTELA tica do ato, bem como o dispositivo legal que autorizou ou
determinou sua prtica.
sabido que em algumas situaes a Administrao Em regra, os atos devem ser motivados. Essa motiva-
pode errar, ou seja, agir de forma ilegal ou mesmo inconve- o dever ser anterior ou concomitante edio do ato,
niente e inoportuna. Nessas situaes, ela deve anular seus podendo ser motivada por rgo diverso do que praticou o
ato. A motivao poder ter a forma de pareceres, laudos ou
atos quando forem ilegais ou revogar os inconvenientes ou
relatrios realizados por rgos tcnicos.
inoportunos. O controle administrativo atinge a ilegalidade e
o mrito administrativo, pois a Administrao pode anular ou PRINCPIO DA RAZOABILIDADE
revogar seus atos.
Nesse sentido, o STF editou duas Smulas nos seguin- O administrador pblico tem de ser razovel ao agir.
tes termos: Deve agir com bom senso, ou seja, deve ter uma atitude
equilibrada. Esse princpio se relaciona diretamente com
473 A Administrao pode anular seus prprios o senso comum do ser humano, do justo, do aceitvel por
atos quando eivados de vcio que os tornem ilegais, todos.
porque deles no se originam direitos; ou revog- Para Celso Antnio Bandeira de Mello, a Administra-
-los, por motivo de convenincia ou oportunidade, o, ao atuar no exerccio de descrio, ter de obedecer
respeitando os direitos adquiridos, e ressalvada, em a critrios aceitveis do ponto de vista racional, em sinto-
todos os casos, a apreciao judicial. nia com o senso normal de pessoas equilibradas. A conduta
desarrazoada no apenas inconveniente, mas tambm ile-
gtima (invlida).
([HPSOLFDQGR R WHPD considere que um rgo de
VFDOL]DomR GH WUkQVLWR HPLWD DOJXPDV PXOWDV SRU H[FHVVR
GHYHORFLGDGH&RQWXGRRSUySULRyUJmRYHULFRXTXHRLQV-
WUXPHQWR GH YHULFDomR GH YHORFLGDGH HVWDYD FRP GHIHLWR
portanto, no estava aferindo corretamente a velocidade
mdia dos veculos. Nesse caso, o rgo deve anular as
multas emitidas por serem ilegais (autotutela).
([HPSOLFDQGRRWHPD considere que a Administra-
o concedeu uma autorizao para uma feira se instalar
HP XPD SUDoD S~EOLFD &RQWXGR R WUkQVLWR QD UHJLmR FRX
um caos. Nesse contexto, a Administrao pode UHYRJDU a
autorizao. Note que o ato era legal, mas se tornou ino-
portuno ou inconveniente no atende mais ao interesse
pblico.

34
NOES DE ORAMENTO PBLICO

SUM RIO

ORAMENTO NA CONSTITUIO FEDERAL. PPA. LDO. LOA. ASPECTOS ORAMENTRIOS E


FINANCEIROS DA EXECUO DA DESPESA. (TTULO VI DA LEI N. 4.320, DE 17 DE MARO DE 1964, E
ALTERAES POSTERIORES ............................................................................................................................... 478
a. Todas as alternativas esto corretas.
EXERCCIOS
b. Somente I e III esto corretas.
c. Somente I e II esto corretas.
1. Julgue as alternativas abaixo. d. Somente II e III esto corretas.
I $GHQLomRGDDGPLQLVWUDomRS~EOLFDFRPRDUWHRX e. Nenhuma das respostas acima satisfaz a questo.
FRPRFLrQFLDGHSHQGHGRVLJQLFDGRHGDrQIDVH
que se possa dar a esses termos. A resposta 3. Julgue as alternativas abaixo.
tambm afetada pelo tipo de administrao pblica I No ano de 1963 foram constitudos grupos encar-
a que nos referimos o estudo ou a disciplina de um regados da preparao de projetos de reforma, obje-
lado, a atividade ou o processo de outro. tivando reorganizao ampla e geral da estrutura
II As caractersticas individuais de um sistema admi- e das atividades do governo; a expanso e o forta-
nistrativo, vistas pela perspectiva costumeira dos lecimento do sistema de mrito; novas normas de
estudantes de administrao, subordinam-se me- aquisio e material no servio pblico e a organi-
lhor a dois conceitos, organizao e gerncia, zao administrativa do Distrito Federal.
FRQVLGHUDGRV DQiORJRV j DQDWRPLD H VLRORJLD II Os governos militares ps-64 acirraram o centralis-
num sistema biolgico. Gerncia a estrutura das mo poltico e consolidaram a tendncia intervencio-
interrelaes pessoais, autoritrias e habituais, nista do Estado no setor produtivo, com a expanso
num sistema administrativo. Organizao a ao da administrao indireta, operada atravs da insti-
planejada para conseguir-se cooperao racional tuio do Decreto-Lei n. 200 em 1967. Este decreto
num sistema administrativo. resultou de estudos desencadeados pelo Poder
III Os estudantes de administrao sabem agora que Executivo, considerando projetos elaborados, mas
no vo tomar o cu de assalto, isto , reduzir no implementados, durante o governo Goulart.
UDSLGDPHQWH DV TXHVW}HV KXPDQDV D XP JUiFR III Durante os governos militares ps-64, o planeja-
Alguns deles at, sem deixarem de desejar e esfor- mento torna-se um princpio dominante e, em decor-
ar-se por mais racionabilidade do que j alcana- rncia, a Secretaria de Planejamento SEPLAN
mos, perceberam que racionabilidade completa em adquire o status de agncia central, controlando o
questes humanas no meta indicada: que um sistema de planejamento e o sistema de contabili-
mundo no qual tudo seja bem organizado e previs- dade e auditoria interna. Alm de manter unidades
vel, sem lugar para a espontaneidade, a surpresa e descentralizadas nos ministrios, autarquias e fun-
atividade emocional, um mundo indesejvel. daes pblicas, a SEPLAN encarregava-se, atravs
da SEST, do controle das empresas estatais.
a. Todas as alternativas esto corretas.
b. Somente I e III esto corretas. a. Todas as alternativas esto corretas.
b. Somente I e III esto corretas.
c. Somente I e II esto corretas.
c. Somente I e II esto corretas.
d. Somente II e III esto corretas.
d. Somente II e III esto corretas.
e. Nenhuma das respostas acima satisfaz a questo.
e. Nenhuma das respostas acima satisfaz a questo.
2. Julgue as alternativas abaixo.
4. Julgue as alternativas abaixo.
I A dcada de cinquenta caracterizou-se por uma
I 2 'HFUHWR/HL Q  LQYLDELOL]RX D H[LELOL-
VLJQLFDWLYD FHQWUDOL]DomR QR QtYHO SROtWLFR H HFR-
zao das relaes de trabalho no setor pblico,
nmico, expresso de uma forma de Estado autori-
proibindo a aplicao da Consolidao das Leis do
trio que conduziu o incio de processo de moder-
Trabalho no processo de contratao de pessoal.
nizao e industrializao do pas. Neste perodo, II A retomada da democratizao do pas na segun-
assiste-se superao do Estado voltado para a da metade da dcada de 80, alimentada pelas
regulao da vida social e econmica, por um Es- demandas de participao poltica dos diversos
tado intervencionista, mais ativo na promoo do segmentos sociais, e que culminou no estabeleci-
desenvolvimento econmico do pas. Consolida-se, mento de um novo texto constitucional em 1988,
assim, o Estado administrativo. mostra-se incompatvel com o modelo centralizador,
II O Estado Administrativo foi implantado com a cria- nos planos poltico-institucional e econmico, vi-
THIAGO VESELY

o do Conselho Federal do Servio Pblico Civil, gente nas dcadas anteriores. A democratizao
em 1936 (Lei n. 284), rgo colegiado destinado a ope-se centralizao do perodo autoritrio e
disciplinar a administrao de pessoal e as ativi- impe a transformao do aparelho administrativo
dades-meio do setor pblico (oramento, material, HP XP HQWH UHGX]LGR RUJkQLFR HFLHQWH H iJLO
comunicaes, organizao e coordenao interna. para atender s demandas da sociedade.
III O DASP constituiu-se no rgo central de polticas III Com o objetivo de fortalecer a administrao direta,
pautadas pelos princpios da administrao cient- contra o que se avaliava como o escapismo pela
FD 7D\ORUH)D\RO HGRPRGHORZHEHULDQRGHEX- via da administrao indireta, houve uma tentati-
rocracia. Baseando-se numa orientao de incisiva va de reverter o processo de crescimento desta e
VHSDUDomRHQWUHDWLYLGDGHVPHDWLYLGDGHVPHLR reduzir o nmero de rgos e entidades superpos-
difundiu-se o princpio da departamentalizao, o tos ou duplicados. Neste perodo, foi elaborado o
formalismo tcnico e o carter prescritivo da ao Decreto-Lei n. 2.299/1986, que alterou o Decreto-
governamental. -Lei n. 200/1967.

36
a. Todas as alternativas esto corretas. sentido do desenvolvimento sustentado. Exige-se,
b. Somente I e III esto corretas. portanto, uma estrutura poltico-institucional rgida
c. Somente I e II esto corretas. e sensvel articulao com as iniciativas geradas
d. Somente II e III esto corretas. na sociedade civil, nos mbitos nacional e interna-
e. Nenhuma das respostas acima satisfaz a questo. cional.

5. Julgue as alternativas abaixo. a. Todas as alternativas esto corretas.


I A SEDAP atuou, por meio da Fundao Centro b. Somente I e III esto corretas.
de Formao do Servidor Pblico FUNCEP, no c. Somente I e II esto corretas.
sentido de desenvolver o pessoal do Setor Pblico. d. Somente II e III esto corretas.
Embora no tenha havido uma plena implemen- e. Nenhuma das respostas acima satisfaz a questo.
tao de uma Poltica de Recursos Humanos, os
princpios bsicos de um regime jurdico nico e 7. Julgue as alternativas abaixo.
do sistema de carreira foram mantidos durante a I O tema das mudanas na esfera pblica tem-se
Nova Repblica. constitudo objeto da agenda poltica internacional.
II Do ponto de vista poltico, a Reforma Administra- Restries econmicas e o movimento simultneo
tiva da Nova Repblica enfrentou problemas refe- de globalizao induzem conformao de novos
UHQWHV j SUySULD GLFXOGDGH GH DSRLR GR JRYHUQR modelos institucionais, notadamente no que diz
junto ao Congresso, associada situao de coa- respeito ao formato das organizaes estatais e
lizes e alianas muito heterogneas que inviabi- das relaes de trabalho no setor pblico.
lizaram uma base poltica forte. O governo viu-se II A manuteno da estabilidade econmica, fragili-
fragilizado quanto ao direcionamento e articulao ]DGDFRPRFUHVFLPHQWRGDFULVHVFDOHGDHVFDV-
poltica de suas propostas, enfrentando, inclusive, VH] QDQFHLUD SDVVD D H[LJLU QRV SDtVHV GHVHQ-
constantes confrontos com o Legislativo. volvidos e subdesenvolvidos, a reestruturao das
III Baseado no suposto gigantismo do Executivo federal, DGPLQLVWUDo}HVS~EOLFDVSRUPHLRGDGHQLomRGH
o governo Collor iniciou uma grande transformao PRGHORV GH JHVWmR PDLV HFLHQWHV GH HVWUXWXUDV
das estruturas administrativas, extinguindo e mo- RUJDQL]DFLRQDLVPDLVHFD]HVHGHSDGU}HVEXUR-
GLFDQGR R VWDWXV GH GLYHUVRV yUJmRV S~EOLFRV $ FUiWLFRV TXH SHUPLWDP FULDWLYLGDGH H[LELOLGDGH H
proposta do governo Collor emerge num cenrio esprito empreendedor. Percebe-se que a estabi-
de forte crtica ao modelo de Estado intervencio- lidade fator preponderante para a manuteno
nista e empresarial, tomando o modelo de admi- do desenvolvimento econmico e social, dentro da
nistrao at ento vigente como um obstculo perspectiva da formao de mercados regionais.
modernizao do Estado e da economia. III 3DUD GDU UHVSRVWD D HVWH GHVDR DV QDo}HV WrP
buscado inovar no campo organizacional e na
a. Todas as alternativas esto corretas. forma de regular as relaes de trabalho no setor
b. Somente I e III esto corretas. pblico. Um processo de reengenharia organiza-
c. Somente I e II esto corretas.
cional surge como possibilidade de realizar a apro-
d. Somente II e III esto corretas.
ximao entre o Estado e a sociedade e promover
e. Nenhuma das respostas acima satisfaz a questo.
DTXDOLGDGHHHFLrQFLDGRVVHUYLoRVS~EOLFRV
6. Julgue as alternativas abaixo.
a. Todas as alternativas esto corretas.
I O foco das aes de reforma do perodo Collor, em
b. Somente I e III esto corretas.
realidade, concentrou-se no projeto de privatizao
das empresas estatais. Do ponto de vista da adminis- c. Somente I e II esto corretas.
trao direta, embora ressalte-se o papel de destaque d. Somente II e III esto corretas.
dado ao processo de descentralizao da gesto e. Nenhuma das respostas acima satisfaz a questo.
dos servios pblicos, notadamente no setor de
NOES DE ORAMENTO PBLICO

sade o que possibilitou a continuidade de aes 8. Julgue as alternativas abaixo.


fundadas no princpio institudo j na Constituio Registram-se como eixos gerais dos projetos de refor-
de 1988 no havia uma orientao orgnica de ma administrativa em nvel internacional.
reforma, a no ser a extino de rgos e o corte I Concentrao do governo central na realizao de
de pessoal. XP SURFHVVR HFLHQWH GH IRUPXODomR DYDOLDomR
II O advento da globalizao e da internacionaliza- e retroalinhamento das polticas pblicas, diretriz
omRGDHFRQRPLDFRORFDRGHVDRGHVHUHGHQL- que demanda o aperfeioamento das funes de
rem os padres de funcionamento do Estado e da coordenao e o desenvolvimento de sistemas de
Administrao Pblica brasileira, de modo a viabi- informao intergovernamental.
lizar a participao integrada e competitiva do pas II Centralizao da ao do Estado, acompanhada
na nova ordem internacional. da institucionalizao de mecanismos de participa-
III A acentuao do processo de democratizao do o e controle social e baseada no acesso infor-
pas e as presses por respostas s demandas mao.
sociais, num quadro de escassez de recursos, exi- III O desenho de um Estado pirmide em lugar de um
gem a construo de um Estado forte do ponto de Estado em rede, buscando-se otimizar os recursos
vista gerencial e capaz de coordenar esforos no escassos mediante o seu gerenciamento via de

37
instituies inter-relacionadas, que maximizem a 11. Julgue as alternativas abaixo.
coordenao, a obteno de economias de escala, I Uma repartio do Servio Pblico, um departa-
a explorao de sinergias. mento ou centro, um instituto ou uma empresa, um
escritrio, esto povoados e constitudos por seres
a. Todas as alternativas esto corretas. humanos que a desempenham suas tarefas e atri-
b. Somente I e III esto corretas. buies, contribuindo, cada um desses indivduos,
c. Somente I e II esto corretas. SDUDDFRQVHFXomRGRVREMHWLYRVHQDOLGDGHVGHVVD
d. Somente II e III esto corretas. organizao. Por isto so chamados contribuintes
e. Nenhuma das respostas acima satisfaz a questo. individuais.
II 1DFRQGLomRGHFRQWULEXLQWHVLQGLYLGXDLVLGHQWLFD-
9. Julgue as alternativas abaixo. dos com sua instituio, fazendo de suas ativida-
des extenses de seus prprios egos e assumindo
Registram-se como eixos gerais dos projetos de refor-
XPD ORVRD RUJDQL]DFLRQDO GHVHQYROYLPHQWLVWD
ma administrativa em nvel internacional.
os servidores pblicos podero tornar-se verdadei-
I Desenvolvimento de capacidades para a adminis-
URVDJHQWHVGHPXGDQoDTXHPRGLFDUmRRHVWDGR
trao intergovernamental, mediante o gerencia-
corrente de sua organizao ou instituio para outro
mento em redes pelo governo central e a conexo
estado melhor desenvolvido.
entre estados e municpios dentro de uma pers- III Dois so, fundamentalmente, os tipos de papis
pectiva mais orgnica. do indivduo: o que lhe atribudo pela sociedade,
II 0RGHORVRUJDQL]DFLRQDLVH[tYHLVGRWLSRPDWULFLDO pela organizao ou pelo grupo; e o que o indiv-
e gesto por projetos. duo subjetivamente atribui a si mesmo.
III Um novo estilo gerencial pblico que demanda a
IRUPDomRGHSURVVLRQDLVFRPDSWLG}HVSDUDRUHOD- a. Todas as alternativas esto corretas.
cionamento e a negociao com os diversos atores b. Somente I e III esto corretas.
HLQVWLWXLo}HVFRPFDSDFLGDGHSDUDLGHQWLFDUSUR- c. Somente I e II esto corretas.
blemas estratgicos e delegar competncias. d. Somente II e III esto corretas.
a. Todas as alternativas esto corretas. e. Nenhuma das respostas acima satisfaz a questo.
b. Somente I e III esto corretas.
c. Somente I e II esto corretas. 12. Julgue as alternativas abaixo.
d. Somente II e III esto corretas. I Paul R. LAWRENCE e Jay W. LORSCH caracte-
e. Nenhuma das respostas acima satisfaz a questo. rizam a organizao como sendo a coordenao
GDVDWLYLGDGHVGLYHUVLFDGDVGHFRQWULEXLQWHVLQGL-
10. Julgue as alternativas abaixo. viduais com o objetivo de realizar transaes pla-
I H duas consideraes bsicas referentes es- nejadas com o ambiente (ambiente este, acrescen-
trutura organizacional no setor pblico: macroes- temos ns, no qual ela se insere como tomadora
trutura governamental, onde se insere a questo ou prestadora de bens ou servios).
da dinmica versus estabilidade organizacional do II Por sua vez, como organizao queremos carac-
arranjo ministerial; e modelagem organizacional de terizar o aspecto eminentemente dinmico de uma
organizaes pblicas, no que tange adequao dada instituio, estrutura ou sistema. O que a dis-
GHVXDVHVWUXWXUDVRUJDQL]DFLRQDLVjVVXDVQDOLGD- tingue e singulariza no o somatrio das partes
des e recursos. ou setores, mais ou menos estanques e manifes-
II A macroestrutura da administrao pblica, basica- tamente estticos. Ao contrrio, a mobilidade, a
mente o arranjo ministerial e a composio secretarial XLGH]DSODVWLFLGDGHDFRPXQLFDELOLGDGHDLQWH-
GD3UHVLGrQFLDGD5HS~EOLFDUHHWHDFDUWHLUDGHIXQ- UDomR R GLQDPLVPR HQP TXH FRQVWLWXHP VXDV
es do estado, tpicas ou circunstanciais em funo caractersticas e at mesmo sua natureza. A capa-
dos projetos de desenvolvimento, implcitos ou no, e cidade e a possibilidade de mudanas e intercm-
da barganha poltica em torno da sustentao parla- bios que a fazem operante.
mentar do governo. III A mudana planejada visando ao desenvolvimen-
III No que diz respeito modelagem organizacional to organizacional da rea Pblica supe, neces-
em organizaes pblicas h o problema das es- VDULDPHQWHXPDEHPGHQLGDSROtWLFDHXPDEHP
THIAGO VESELY

truturas padro (comuns a ministrios e secreta- traada estratgia que conduza a esse objetivo
rias) que, embora uniformizem as nomenclaturas colimado.
hierrquicas, muitas vezes resultam em nveis
hierrquicos e unidades organizacionais de apoio a. Todas as alternativas esto corretas.
desnecessrios, tendo em vista diferentes portes, b. Somente I e III esto corretas.
misses, grau de diferenciao e complexidade c. Somente I e II esto corretas.
processual. d. Somente II e III esto corretas.
e. Nenhuma das respostas acima satisfaz a questo.
a. Todas as alternativas esto corretas.
b. Somente I e III esto corretas. 13. Julgue as alternativas abaixo.
c. Somente I e II esto corretas. I Por estratgia compreendemos, na perspectiva da
d. Somente II e III esto corretas. organizao do Servio Pblico, a arte de estabelecer
e. Nenhuma das respostas acima satisfaz a questo. objetivos organizacionais, mediante a interpreta-

38
o dos interesses e das aspiraes da comunida- b. 1DFODVVLFDomRIXQFLRQDODVIXQo}HVUHSUHVHQWDP
de organizacional e seu pblico cliente, e de orien- o maior nvel de agregao das diversas reas
tar a obteno e a consecuo desses objetivos. de despesas que competem ao setor pblico e as
II 3ROtWLFD VLJQLFD GHQWUR GR LQWHUHVVH UHODFLRQDGR j subfunes devem ser obrigatoriamente combinadas
rea Pblica, a arte de preparar e aplicar os recursos com as funes a que estejam relacionadas.
humanos, tendo em vista a conquista e a manuteno c. 0LQLVWpULRGD6D~GHpXPH[HPSORGHFODVVLFD-
do objetivo do desenvolvimento organizacional. Diz o institucional.
respeito assim aos meios, ao como alcanar aquele d. (GXFDomRpXPH[HPSORGHFODVVLFDomRIXQFLRQDO
P e. $FODVVLFDomRSURJUDPiWLFDQRVPRVWUDTXHPpR
III A estratgia est a servio de uma poltica, desta detentor do oramento e o realizador da despesa.
decorrendo. f. Todo programa deve possuir indicador, meta e,
pelo menos, uma ao a ele vinculada.
a. Todas as alternativas esto corretas. g. 2UoDPHQWRVFDOHRUoDPHQWRGDVHJXULGDGHVRFLDO
b. Somente I e III esto corretas. so exemplos de esferas oramentrias.
c. Somente I e II esto corretas. h. A construo de uma rodovia federal ligando Belo
d. Somente II e III esto corretas. Horizonte a Contagem um tipo de ao que pode
e. Nenhuma das respostas acima satisfaz a questo. VHUFODVVLFDGDFRPRRSHUDomRHVSHFLDO
i. As categorias econmicas so apenas duas: despe-
14. $VVLQDOHDDOWHUQDWLYDFRUUHWD3RGHPRVGHQLU sas correntes e despesas de capital.
a. clima cultural, consistindo nas condies de vida
que oferecem maior ou menor oportunidade de 17. Assinale a nica alternativa que contm caracterstica(s)
desenvolvimento intelectual aos indivduos. pertencente(s) a uma Unidade Oramentria.
b. clima intelectual, consistindo nas circunstncias
a. Representa o mesmo que Unidade Gestora.
que afetam as relaes emocionais da pessoa.
b. 1mRUHFHEHPGRWDo}HVHVSHFtFDVSDUDH[HFXomR
c. clima emocional, constituindo as condies que
de suas aes.
afetam o desenvolvimento cultural do indivduo.
c. Cada rgo s pode possuir uma UO.
d. clima social, constituindo a totalidade dos estmu-
los que fazem com que algum se sinta aceito ou d. Uma UO, quando da execuo do oramento, no
rejeitado pelo grupo. pode repassar recursos para outra UO.
e. 3RGHPRVLGHQWLFDUXPD82DWUDYpVGDFODVVLFDomR
15. Julgue as alternativas abaixo. institucional.
18. $&ODVVLFDomRSRU1DWXUH]DGD'HVSHVDpDWXDOPHQWH
I Os funcionrios, servidores ou empregados do
DGRWDGD SHOR *RYHUQR )HGHUDO  1HVVD FODVVLFDomR
Servio Pblico, e bem assim os de organizaes
foi criado um elemento novo, que mostra importantes
particulares, em sua convivncia diria, em sua troca
JDVWRVJRYHUQDPHQWDLV4XHHOHPHQWRpHVVH"
de experincias, em seu crescimento cultural e
a. O programa
SURVVLRQDOIHUWLOL]DPLGHLDVQRUPDVHYDORUHVH
b. A metafsica.
isto vem justamente a constituir sua cultura orga-
c. A atividade.
nizacional.
d. O projeto.
II Em termos de cultura, uma organizao ou sistema
e. O grupo de despesa.
difere de outro, tendo seus prprios padres pecu-
liares de sentimentos e crenas coletivas que vo
19. $ FODVVLFDomR SRU QDWXUH]D GD GHVSHVD p IRUPDGD
sendo transmitidos de indivduo a indivduo e, de for 06 dgitos. Alm dos elementos, da modalidade de
modo especial, aos novos participantes do grupo DSOLFDomRHGRVJUXSRVRTXHPDLVDFRPS}H"
medida que chegam. a. Subcategoria econmica
NOES DE ORAMENTO PBLICO

III Dentro da mesma organizao ou sistema tambm se b. Unidade oramentria


estabelecem subculturas prprias de cada subgrupo c. Atividades
ou setor. d. Programas
e. Categoria econmica
a. Todas as alternativas esto corretas.
b. Somente I e III esto corretas.
GABARITO
c. Somente I e II esto corretas.
d. Somente II e III esto corretas.
1. b
e. Nenhuma das respostas acima satisfaz a questo.
2. d
3. a
16. (PUHODomRjFODVVLFDomRGDGHVSHVDMXOJXHRVLWHQV
4. d
a seguir, assinalando C ou E.
5. a
a. Gastos com pagamento de Pessoal e Encargos 6. c
6RFLDLVGHYHPVHUFODVVLFDGRVFRPRGHVSHVDGH 7. a
capital. 8. e

39
9. a
10. a
11. a
12. a
13. e
14. d
15. a
16. EECCECCEC
17. e
18. e
19. e
THIAGO VESELY

40
LEI N. 8.112/1990

SUM RIO

REGIME JURDICO DOS SERVIDORES CIVIS DA UNIO (LEI N. 8.112, DE 11 DE DEZEMBRO DE 1990
E ALTERAES POSTERIORES).......................................................................................................................496
LEI N. 8.112/1990 sujeitos gerncia de grupos de pessoas. A vitaliciedade
decorre da Constituio, e essa contemplou como detentor de
INTRODUO cargos vitalcios os magistrados (art. 95, I, CF), os membros
do Ministrio Pblico (art. 128, 5, I, a, CF) e os membros
J. W GRANJEIRO / RODRIGO CARDOSO

A presente seo tem como objetivo detalhar os dis- dos Tribunais de Conta da Unio (art. 73, 3, CF).
positivos constitucionais referentes ao servidor pblico e,
O FDUJRHIHWLYR provido mediante concurso, por esse
tambm, abordar as disposies legais referentes aos ser-
motivo tem caracterstica de permanncia. J os cargos em
vidores pblicos estatutrios federais contidas na Lei n.
comisso so de ocupao transitria. O titular do cargo
8.112/1990.
em comisso pode ser exonerado a qualquer momento pela
Cabe lembrar que os entes polticos (Unio, Estados, autoridade que o nomeou (exonerao ad nutum). No h
Distrito Federal e Municpios) podem criar seu regime esta- que se falar em estabilidade para o detentores de cargo em
tutrio. O regime adotado na Unio a Lei n. 8.112/90, no comisso, so de livre nomeao e exonerao.
Distrito Federal a Lei Complementar n. 840/11, no Estado de As IXQo}HVGHFRQDQoD so destinadas a servidores
Gois a Lei n. 10.460/88. Cada ente pode criar seu pr- titulares de cargos de provimento efetivo. Tanto a funo de
prio regime. Como j foi dito, neste captulo estudaremos o FRQDQoDFRPRRFDUJRHPFRPLVVmRVmRGHVWLQDGRVjVDWUL-
regime estatutrio dos servidores civis federais (Unio). EXLo}HV GH GLUHomR FKHD H DVVHVVRUDPHQWR 1R HQWDQWR
DVIXQo}HVGHFRQDQoDVmRGHVWLQDGDVDSHQDVDVHUYLGR-
REGIME ESTATUTRIO res efetivos, enquanto os cargos comissionados podem ser
ocupados por servidores efetivos ou no.
Regime estatutrio o conjunto de regras que disci- oportuno registrar que o art. 5 da Lei n. 8.112/1990
plinam a relao jurdica funcional entre o servidor pblico estabelece os seguintes requisitos para a investidura do cargo:
estatutrio e o Estado. Cada ente federativo tem a prerroga- I a nacionalidade brasileira; II o gozo dos direitos polticos;
III a quitao com as obrigaes militares e eleitorais; IV o
tiva de adotar regime estatutrio prprios para disciplinar a
nvel de escolaridade exigido para o exerccio do cargo; V a
relao funcional entre o ente e o servidor. de saber que os
idade mnima de dezoito anos; VI aptido fsica e mental.
estatutos devem obedincia Constituio Federal quando
3RUPRGRDUWDXWRUL]DDH[LJrQFLDGHRXWURV
esta regulamenta assuntos relacionados a servidores. UHTXLVLWRV $V DWULEXLo}HV GR FDUJR SRGHP MXVWLFDU D H[L-
O regime estatutrio um regime legal (no contra- JrQFLD GH RXWURV UHTXLVLWRV HVWDEHOHFLGRV HP OHL 'HFRUUH
tual). No h contrato, qualquer alterao na lei altera o HQWmRTXHDOHLSRGH[DURXWURVUHTXLVLWRVWDLVFRPRH[DPH
regime jurdico, logo alterado unilateralmente. Portanto, no psicotcnico, investigao social, limite de idade etc.
h direito adquirido pela manuteno do regime.
$ G~YLGD p D VHJXLQWH a Lei n. 8.112/1990 abrange 3DUD[DU
apenas os servidores ocupantes de cargo efetivo (aquele Com base no Regime Jurdico dos Servidores Civis
SURYLGRPHGLDQWHFRQFXUVRS~EOLFR "$UHVSRVWDpQHJDWLYD da Unio, institudo pela Lei n. 8.112/1990, julgue os
O regime estatutrio alcana os cargos de provimento em itens subsequentes.
comisso (aquele de livre nomeao e exonerao). Dessa (CESPE/ 2008/ STJ/ TCNICO JUDICIRIO) A re-
forma, grande parte das determinaes da Lei n. 8.112/1990 ferida lei estabeleceu, para algumas carreiras espe-
so direcionadas aos ocupantes de cargo em comisso FtFDVGHQRPLQDGDVFDUUHLUDVGH(VWDGRRGLUHLWR
como, por exemplo: nomeao, posse, exerccio, regime dis- vitaliciedade e inamovibilidade.
ciplinar etc. Vale lembrar que, alguns direitos garantidos ao
servidor ocupante de cargo efetivo no so estendidos aos -XVWLFDWLYD Foi visto que a vitaliciedade prerroga-
WLYD GH FDUJRV GHQLGRV QD &RQVWLWXLomR 6HUYLGRU UHJLGR
ocupantes de cargo em comisso como, por exemplo: estabi-
pela Lei n. 8.112/1990 no tem a garantia vitaliciedade e
lidade, algumas licenas, os afastamentos, a previdncia etc.
inamovibilidade. Vale registrar que tais garantias so prerro-
gativas dos juzes conforme consta no art. 95, CF. Gabarito:
CARGO PBLICO errado.

(CESPE / TRE-ES/ ANALISTA JUDICIRIO/ 2011)


Cargo pblico o conjunto de atribuies e responsa- Cargo pblico o conjunto de atribuies e respon-
bilidades previstas na estrutura organizacional que devem sabilidades que, previstas na estrutura organizacio-
ser cometidas a um servidor (art. 3 da Lei n. 8.112/1990). nal, devem ser cometidas a um servidor.
Os cargos pblicos podem ser: de carreira ou isolada.
Cargo de carreira aquele em que h progresso funcional -XVWLFDWLYD Esse o conceito de cargo pblico.
dos servidores atravs de diversas classes. Essa progres- Gabarito: certo.
so funcional se d por meio de promoo. J o cargo iso-
lado no admite a promoo, tem natureza estanque. ACUMULAO DE CARGO PBLICO
Outra caracterstica dos cargos pblicos que podem
ser: YLWDOtFLRVHIHWLYRVRXHPFRPLVVmR. Segundo o texto constitucional, a regra a proibio da
acumulao de cargos pblicos. No entanto, se houver com-
Os FDUJRVYLWDOtFLRV so aqueles que os ocupantes tm
patibilidade de horrios e se for observada a remunerao
maior garantia de permanncia. Consiste em uma prerroga-
do teto constitucional estabelecido pela CF no inciso XI do
tiva para seus titulares. vitaliciedade necessria para que
art. 37, poder haver acumulao de cargos pblicos.
seus ocupantes tenham maior independncia, sem que sejam

42
O inciso XVI, do art. 37, da CF, tem a seguinte redao: dades mximas dos rgos envolvidos autorizarem,
o servidor poder exercer um cargo efetivo com o
XVI vedada a acumulao remunerada de car- RXWURHPFRPLVVmRRXIXQomRGHFRQDQoD
gos pblicos, exceto, quando houver compatibili-
dade de horrios, observado em qualquer caso o 3DUD[DU
disposto no inciso XI.
a) a de dois cargos de professor;
(CESPE /TJ-ES/ ANALISTA JUDICIRIO/ 2011) A
b) a de um cargo de professor com outro tcnico

LEI N. 8.112/1990
CF veda a acumulao ilegal de cargos pblicos.
RXFLHQWtFR
No entanto, permite que um servidor venha a acu-
c) a de dois cargos ou empregos privativos de pro-
PXODUXPFDUJRHIHWLYRFRPXPDIXQomRGHFRQDQ-
VVLRQDLV GH VD~GH FRP SURVV}HV UHJXODPHQWD-
das; a.

2XWURVFDVRVGHDFXPXODomRSHUPLWLGRVSUHYLVWRV -XVWLFDWLYD Em regra vedada a acumulao de


na Constituio Federal: cargos pblicos. permitida a acumulao de cargo efetivo
FRP XPD IXQomR GH FRQDQoD TXDQGR DXWRUL]DGRV SHORV
Art. 38, III vereador com cargo pblico (havendo rgos envolvidos. Gabarito: certo.
compatibilidade com horrio);
Art. 95, pargrafo nico, inciso I juiz e magistrio; (TRE-ES/ TCNICO JUDICIRIO/ REA: ADMINIS-
Art. 128, 5, II, d membros do Ministrio Pblico TRATIVA/ 2010) Ainda que interinamente, vedado
e magistrio. ao servidor pblico exercer mais de um cargo em
comisso.
A proibio de acumular estende-se a empregos e fun-
es, e abrange autarquias, fundaes, empresas pblicas,
-XVWLFDWLYD Foi visto que interinamente o servidor
sociedades de economia mista, suas subsidirias, e socieda-
pode exercer mais de um cargo em comisso. Gabarito:
des controladas, direta ou indiretamente pelo Poder Pblico
(XVII do art. 37 da CF). Por fora desse mandamento, temos errado.
como exemplo a proibio de acumular cargos em uma
empresa pblica estadual e em um Ministrio; ou em uma
autarquia federal e em uma prefeitura. CONCURSO PBLICO

ACUMULAO DE CARGO EM COMISSO Os cargos pblicos ou empregos pblicos devem ser


preenchidos aps prvia aprovao em concurso pblico.
Segundo o art. 119, da Lei n. 8.112/1990, o servidor no Trata-se de regra constante no art. 37, II, da Constituio,
poder exercer mais de um cargo em comisso, pois o cargo a saber:
comissionado de dedicao exclusiva. No entanto, o ser-
vidor ocupante de cargo em comisso ou de natureza espe-
II a investidura em cargo ou emprego pblico de-
cial poder ser nomeado para ter exerccio, interinamente,
pende de aprovao prvia em concurso pblico de
HPRXWURFDUJRGHFRQDQoDVHPSUHMXt]RGDVDWULEXLo}HV
de que atualmente se ocupa, hiptese em que dever optar provas ou de provas e ttulos, de acordo com a na-
pela remunerao de um deles durante o perodo da inte- tureza e a complexidade do cargo ou emprego, na
rinidade (pargrafo nico do art. 9 da Lei n. 8.112/1990). forma prevista em lei, ressalvadas as nomeaes
Vale registrar que a lei no estabeleceu prazos mnimos ou para cargo em comisso declarado em lei de livre
mximos para a permanncia do interino em suas funes, o nomeao e exonerao.
bom senso nos leva a um prazo razovel/necessrio.
Pode ocorrer que o servidor que acumular dois cargos Com efeito, os cargos em comisso podem ser ocu-
de maneira lcita seja nomeado em um cargo em comisso. pados por servidores no detentores de cargo pblico. Os
Nesse caso, o art. 120 da Lei n. 8.112/1990 disciplina que
ocupantes de cargo em comisso so de livre nomeao e
o servidor que acumular licitamente dois cargos efetivos,
exonerao ad nutum decorre ento que a permanncia
quando investido em cargo de provimento em comisso,
FDUiDIDVWDGRGHDPERVRVFDUJRVHIHWLYRVVDOYRQDKLSy- FD YLQFXODGD D FULWpULRV VXEMHWLYRV  FRQIRUPH D YRQWDGH
tese em que houver compatibilidade de horrio e local com arbtrio da autoridade competente.
o exerccio de um deles, declarada pelas autoridades mxi- O concurso ser de provas ou de provas e ttulos. O art.
mas dos rgos ou entidades envolvidos. 12, da Lei n. 8.112/1990, estabelece que o concurso pblico
ter validade de at dois anos, podendo ser prorrogado uma
6LPSOLFDQGR nica vez, por igual perodo. O prazo de validade do con-
servidor no poder exercer mais de um cargo em curso contado de sua homologao, que o ato admi-
comisso; QLVWUDWLYRPHGLDQWHRTXDODDXWRULGDGHFRPSHWHQWHFHUWLFD
servidor ocupante de cargo em comisso poder que o procedimento do concurso foi legal/legtimo.
ser nomeado para ter exerccio, interinamente, em
Exemplo: considere que determinado concurso tenha
RXWURFDUJRGHFRQDQoD
servidor que acumular dois cargos licitamente e for SUD]RGHYDOLGDGH[DGRHPHGLWDOGHXPDQR6HD$GPLQLV-
QRPHDGRSDUDXPRXWURFDUJRHPFRPLVVmRFDUi trao achar conveniente a sua prorrogao (discricionarie-
afastado dos dois efetivos. No entanto, se as autori- dade administrativa), poder prorrog-lo por mais um ano.

43
Caractersticas ocupar determinado cargo pblico. A nomeao para cargos
o edital do concurso dever ser publicado no mnimo de provimento efetivo depende de prvia habilitao em
XP YH] QR 'LiULR 2FLDO GD 8QLmR H HP MRUQDO GH FRQFXUVRVS~EOLFRREHGHFLGRVDRUGHPGHFODVVLFDomRHR
grande circulao (art. 12, 1, da Lei n. 8.112/1990); prazo de sua validade.
J. W GRANJEIRO / RODRIGO CARDOSO

no se abrir novo concurso enquanto houver O 1, do art. 13, estabelece que a posse ocorrer no
candidato aprovado em concurso anterior com prazo de trinta dias contados da publicao do ato de provi-
prazo de validade no expirado (art. 12, 2 da Lei mento (nomeao). O ato de provimento (nomeao) ser tor-
n. 8.112/1990). Esse dispositivo probe que seja rea- nado sem efeito se a posse no ocorre no prazo previsto, ou
lizado um novo concurso enquanto houver candida- seja, em at 30 dias.
tos aprovados em concurso anterior. Deve-se lem-
brar que esse dispositivo vlido para a contratao IMPORTANTE
de servidores pblicos federais;
o inciso IV, do art. 37, da CF, estabelece que durante A Administrao, necessariamente, ter de nomear todos os
o prazo improrrogvel previsto no edital de convo- candidatos aprovados dentro do nmero de vagas previstas no
cao, aquele aprovado em concurso pblico de edital. A posio tradicional do STF sustentava que o candidato
provas ou de provas e ttulos ser convocado com WLQKD PHUD H[SHFWDWLYD GH GLUHLWR j QRPHDomR RX VHMD FD D
prioridade sobre novos concursados para assumir critrio da Administrao nomear o nmero de candidatos
FDUJRRXHPSUHJRQDFDUUHLUD que achasse necessrio. Por esse posicionamento, se o edital
constasse 100 vagas, poderia a Administrao nomear dez, vinte,
ou mesmo no nomear ningum. No entanto, o posicionamento
IMPORTANTE
atual mudou de modo existncia de direito subjetivo (direito
A Constituio apenas estabeleceu prioridade para a nomeao de exigir a nomeao) nomeao quando o candidato for
de aprovados em concurso anterior ainda dentro do prazo de FODVVLFDGR GHQWUR GR Q~PHUR GH YDJDV SUHYLVWDV QR HGLWDO
validade sobre os aprovados no novo concurso para o mesmo Temos como exemplo as decises: RMS 19.478-SP, 6 Turma,
cargo ou emprego. Assim, no proibida a abertura de um Rel. Min. NILSON NAVES, em 06.05.2008; RMS 15.420-PR
novo concurso pblico para cargo ou emprego dentro do prazo (jul. 17.04.2008); RMS 15.345-GO (DJ 24.04.2007).
de validade de um concurso anterior realizado pela mesma
administrao. A exigncia que apenas sejam nomeados os
antigos aprovados. 3DUD[DU

(CESPE/ MPE) Candidato aprovado em concurso


Devemos ressaltar que a Lei n. 8.112/1990 no ofende pblico dentro do nmero de vagas previsto no edi-
a Constituio ao disciplinar a no abertura de concurso tal possui o direito subjetivo nomeao, segundo
no prazo de validade, mesmo no prazo improrrogvel. Se entendimento do Supremo Tribunal Federal.
esse tema for cobrado em provas de concursos o candidato
dever observar se a banca examinadora est abordando o -XVWLFDWLYD Foi visto que o aprovado dentro do nmero
tema conforme a Constituio ou conforme o estabelecido na de vagas oferecidas em edital de concurso tem direito subje-
Lei n. 8.112/1990. tivo (de exigir) sua nomeao. Gabarito: certo.

RESERVA DE PERCENTUAL DE CARGOS E EMPREGOS PBLI- POSSE


COS AOS PORTADORES DE DEFICINCIAS
A investidura em cargo pblico ocorrer com a posse
Primeiro importante registrar que a Constituio de (art. 7 da Lei n. 8.112/1990). A partir da posse se passa
1988, com vista a promover aes garantia dos direitos da a ser servidor pblico. A posse ocorrer no prazo de trinta
pessoa portadora de necessidades especiais, assegura que dias contados da publicao do ato de provimento (nomea-
a lei reservar percentual dos cargos e empregos pblicos o). Se no for assinado o termo de posse dentro do prazo
SDUDDVSHVVRDVSRUWDGRUDVGHGHFLrQFLDHGHQLUiRVFULWp- de trinta dias, aps a nomeao, o ato de nomeao ser
tornado sem efeito. Aps a assinatura do termo de posse o
ULRVGHVXDDGPLVVmR &)DUW9,,, 
servidor ter quinze dias para entrar em exerccio, se assim
Com o objetivo de regulamentar esse tema na esfera
QmRR]HUVHUiH[RQHUDGRGHRItFLR
federal, a Lei n. 8.112/1990, estabelece que s pessoas por-
WDGRUDVGHGHFLrQFLDpDVVHJXUDGRRGLUHLWRGHVHLQVFUHYHU
QUESTES REFERENTES POSSE
em concurso pblico para provimento de cargo cujas atribui-
o}HVVHMDPFRPSDWtYHLVFRPDGHFLrQFLDGHTXHVmRSRUWD-
A posse poder dar-se mediante procurao espe-
doras; para tais pessoas sero reservadas at 20% (vinte por
FtFD GRDUWGD/HLQ 
cento) das vagas oferecidas no concurso (art. 5, 2).
Smula n. 226 do STJ: o diploma de habilitao
legal para o exerccio do cargo deve ser exigido na
NOMEAO
SRVVHHQmRQDLQVFULomRSDUDRFRQFXUVRS~EOLFR
$SRVVHGHSHQGHUiGHSUpYLDLQVSHomRPpGLFDR-
Para Cavalcante Filho (2008, p. 32), a nomeao o
cial e, s poder ser empossado aquele que for jul-
ato unilateral da Administrao por meio do qual o Estado
gado apto fsica e mentalmente para o exerccio do
demonstra interesse em que determinada pessoa passe a
cargo.

44
O 2 do art. 13 da Lei n. 8.112/1990 autoriza a prorro- ESTABILIDADE. AVALIAO. DESEMPENHO.
gao da posse quando o nomeado j for servidor pblico LICENA. PRAZO. Quando, dentro do perodo de
trs anos, a avaliao de desempenho do servidor
e se encontrar em licena ou nas hipteses legais de afas-
(art. 41 da CF/1988, com a redao dada pela EC
tamento, sendo que o prazo para posse (30 dias contados n. 19/1998) for impossibilitada em razo de afasta-
do ato de provimento) ser contado do trmino do impe- mentos pessoais, HVVHSUD]RGHYHUiVHUSURUURJD-
dimento. Diante disso, o prazo da posse ser prorrogado do pelo mesmo lapso de tempo em que perdurar
quando o nomeado estiver de: licena por motivo de doena o afastamento ou licena, de modo a permitir a

LEI N. 8.112/1990
referida avaliao, pois o efetivo exerccio da fun-
em pessoa da famlia, para o servio militar, para capacita- o -lhe condio. Mostra-se, portanto, impossvel
o, gestante, adotante, paternidade, por motivo de aproveitar aqueles perodos de licena ou afasta-
DFLGHQWHHPVHUYLoRRXGRHQoDSURVVLRQDOEHPFRPRQRV mento. Precedentes citados: RMS 9.931-PR, DJ
afastamentos em virtude de frias, de ps-graduao stricto 15.10.2001, e REsp 173.580-DF, DJ 17.12.1999.
RMS 19.884-DF, Rel. Min. Felix Fischer, julgado em
sensu no pas e para participar em competio desportiva.
08.11.2007.

3DUD[DU Em sntese: considere que um servidor j tenha cum-


SULGRXPDQRGHH[HUFtFLRSDUDQVGHFRQWDJHPGHWHPSR
(CESPE/CMARA DOS DEPUTADOS/POLCIA
para aquisio da estabilidade. Contudo, o servidor preci-
LEGISLATIVA/ 2014) Um cidado aprovado no car-
sou pedir licena para acompanhar cnjuge que foi remo-
go de tcnico legislativo da Cmara dos Deputados
vido para outro ponto do territrio nacional. Nesse caso,
que no possa comparecer sua posse por motivos
suspende a contagem para aquisio da estabilidade at o
de foro pessoal poder tomar posse mediante pro-
UHWRUQRGRVHUYLGRUDVHXFDUJR$QDOR67-HQWHQGHTXH
FXUDomRHVSHFtFD
apenas o efetivo exerccio no cargo permite a referida ava-
OLDomRSRLVRHIHWLYRH[HUFtFLRGDIXQomRpOKHFRQGLomR
-XVWLFDWLYD foi visto que a posse poder ocorrer
A estabilidade alcanada apenas pelos servidores
PHGLDQWHSURFXUDomRHVSHFtFD*DEDULWRFHUWR estatutrios, no h que se falar em estabilidade para servi-
dores ocupantes de cargo comissionado ou para emprega-
EXERCCIOS dos pblicos (CLT).

O exerccio representa o efetivo desempenho das atri- ESTGIO PROBATRIO


buies do cargo pblico. Conforme o 1 do art. 15 da Lei n.
8.112/1990 de quinze dias o prazo para o servidor empos- O art. 20 da Lei n. 8.112/1990 regulamenta o estgio
sado em cargo pblico entrar em exerccio, contados da probatrio nos seguintes termos:
GDWDGDSRVVH9LPRVTXHRVHUYLGRUHPSRVVDGRTXHQmR
entrar em exerccio no prazo de quinze dias ser exonerado Art. 20. Ao entrar em exerccio, o servidor nomeado
de ofcio. Aps entrar em exerccio, o servidor far jus retri- SDUDFDUJRGHSURYLPHQWRHIHWLYRFDUiVXMHLWRDHV-
buio pecuniria referente ao cargo, iniciam-se a contagem tgio probatrio por perodo de 24 (vinte e quatro)
meses, durante o qual a sua aptido e capacidade
do perodo do estgio probatrio e do da estabilidade.
sero objeto de avaliao para o desempenho do
cargo, observados os seguinte fatores: (vide EMC
ESTABILIDADE n. 19)
I assiduidade;
So estveis aps trs anos de efetivo exerccio os ser- II disciplina;
vidores nomeados para cargo de provimento efetivo em vir- III capacidade de iniciativa;
tude de concurso pblico (art. 41 da CF). A estabilidade a IV produtividade;
V responsabilidade.
garantia constitucional de permanncia no servio pblico
outorgada ao servidor aps trs anos de efetivo exerccio.
Questo a ser destacada em relao ao prazo do
O 4 do art. 41 da CF disciplina que condio obrigat-
estgio probatrio. Vimos que o estatuto dos servidores
ria para a aquisio da HVWDELOLGDGHDYDOLDomRHVSHFLDOGH
pblicos federais estabelece que o estgio probatrio de
desempenho por comisso. Portanto, a estabilidade no
vinte e quatro meses. Nesse perodo avaliado se o ser-
alcanada por mero decurso temporal, pois exigido que
vidor tem aptido para o cargo ao qual desempenha suas
o servidor seja avaliado por FRPLVVmRGHDYDOLDomRcriada
funes.
FRPHVVDQDOLGDGH No entanto, a doutrina dominante advoga que o do
Conforme consta no art. 41, da CF, requisito obje- art. 20 da Lei n. 8.112/1990 no foi recepcionado pela nova
tivo para a aquisio da estabilidade o HIHWLYRH[HUFtFLR do redao do art. 41 introduzida pela EC n. 19/1998, ou seja, o
servidor no cargo para o qual foi nomeado. Desse modo, o estgio probatrio deve ser de trs anos para coincidir com
STJ j se pronunciou que se o servidor afastar do seu cargo o prazo da estabilidade.
efetivo em razo de licenas ou afastamentos, o prazo Hely Lopes Meirelles (2008, p. 451-452) leciona que
da contagem da estabilidade ser suspenso, s iniciando estgio probatrio de trs anos o perodo de exerccio do
novamente a contagem aps o retorno do servidor em suas servidor durante o qual observado e apurada pela Adminis-
atividades. o que consta no seguinte julgado do Superior trao a convenincia ou no de sua permanncia no ser-
Tribunal de Justia: YLoRS~EOLFR  

45
Merece destacar que o STF atualmente acolhe a (CESPE / TCE-ES/ PROCURADOR/ 2009) Con-
forme recente entendimento do STJ, o prazo do
orientao segundo a qual o estgio probatrio o per-
estgio probatrio no foi alterado, com o advento
odo compreendido entre o incio do cargo e a aquisio de GD (PHQGD &RQVWLWXFLRQDO Q  TXH [RX R
J. W GRANJEIRO / RODRIGO CARDOSO

estabilidade no servio pblico, que se d aps trs anos prazo para aquisio da estabilidade em trs anos.
(Informativo/STF n. 317).
(CESPE/TCU/ANALISTA DE CONTROLE EXTER-
Vale destacar que, apesar de a doutrina e de a jurispru- NO/ 2009) Conforme recente entendimento do STJ,
dncia disciplinarem que a estabilidade e o estgio devem o prazo do estgio probatrio dos servidores pbli-
ter perodos iguais, so institutos totalmente diversos: o cos de 24 meses, visto que tal prazo no foi altera-
do pela Emenda Constitucional n. 19/1998, que tra-
estgio probatrio tem como objetivo avaliar a aptido ta apenas da estabilidade dos referidos servidores.
do servidor para o exerccio do cargo e a estabilidade
caracterizada como expectativa de permanncia no servio (CESPE / ANALISTA DE CORREIOS/ 2011) Ao en-
trar em exerccio, o servidor nomeado para cargo de
pblico, que se adquire com trs anos de efetivo exerccio, SURYLPHQWRHIHWLYRFDUiVXMHLWRDHVWiJLRSUREDWyULR
desde que seja aprovado em avaliao especial de desem- por perodo de vinte e quatro meses, durante o qual
SHQKRSRUFRPLVVmRLQVWLWXtGDSDUDHVVDQDOLGDGH &)DUW sua aptido e sua capacidade sero objetos de ava-
liao para o desempenho do cargo, observados os
41, e 4). seguinte fatores: assiduidade, disciplina, capacida-
de de iniciativa, produtividade e responsabilidade.
3DUD[DU
-XVWLFDWLYD Todas as questes esto erradas, pois
(CESPE/ TRF/ JUIZ/ 2009) Conforme recente enten- vimos que a jurisprudncia orienta que o prazo do est-
dimento do STJ, o prazo do estgio probatrio de gio deve ser o mesmo da estabilidade. Entende-se que a
PHVHVQmRWHQGRVLGRPRGLFDGRDQWHDDOWHUD- Emenda Constitucional n. 19/1998, que alterou a redao
omRFRQVWLWXFLRQDOTXH[RXRSUD]RGHDQRVFRPR do o art. 41da CF, revogou tacitamente o art. 20, caput, da
requisito objetivo para a obteno da estabilidade. Lei n. 8.112/1990.

PARA FIXAR
Criao do cargo por lei edital do concurso realizao da prova homologao

posse exerccio estgio probatrio (3 estabilidade (3 anos,


nomeao
(30 dias, contados da nomeao) (15 dias, contados da posse) anos, segundo o STF) art. 41 da CF)

DEMISSO E EXONERAO

Apesar de serem atos administrativos que visam a


extino do vnculo do servidor com a Administrao Pblica,
devem ser empregados de maneira distinta. A demisso
ato de carter punitivo (penalidade aplicada ao servidor que
incorreu em infrao funcional grave), enquanto a exone-
rao o rompimento do vnculo estatutrio por razes de
interesse do prprio servidor ou da Administrao. A exone-
rao no tem carter punitivo.
A exonerao pode ser a pedido (o servidor manifesta
o interesse de sair do servio pblico), ou ocorrer de ofcio
(ocorre quando a Administrao manifesta seu interesse em
dispensar o servidor). O art. 34 da Lei n. 8.112/1990, disci-
plina o tema nos seguintes termos:

Art. 34. A exonerao de cargo efetivo dar-se- a


pedido do servidor, ou de ofcio.
Pargrafo nico. A exonerao de ofcio dar-se-:
I quando no satisfeitas as condies do estgio
probatrio;
II quando, tendo tomado posse, o servidor no en-
trar em exerccio no prazo estabelecido.

Outra forma de exonerao de ofcio se d a juzo da


autoridade competente, no caso de cargo em comisso.

46
NOES DE DIREITO PROCESSUAL
MATRIA
CIVIL

SUM RIO

CDIGO DE PROCESSO CIVIL: DOS ATOS PROCESSUAIS ........................................................................530


ATOS PROCESSUAIS DOS ATOS DAS PARTES

$WRSURFHVVXDOSRGHVHUGHQLGRFRPRDDWXDomRGHQWUR
GHXPSURFHVVRTXHWHQKDDQDOLGDGHGHLQVWDXUDUPRGLFDU Artigos importantes do CPC
desenvolver ou extinguir uma relao jurdica processual.
Art. 158. Os atos das partes, consistentes em
declaraes unilaterais ou bilaterais de vontade, pro-
CLASSIFICAO DOS ATOS PROCESSUAIS
GX]HPLPHGLDWDPHQWHDFRQVWLWXLomRDPRGLFDomRRX
a extino de direitos processuais.
$FODVVLFDomRGDGDSRU&KLRYHQGDTXHpDDGRWDGD Pargrafo nico. A desistncia da ao s produ-
pelo nosso Cdigo de Processo, se d de forma subjetiva, zir efeito depois de homologada por sentena.
ou seja, considerando os sujeitos do processo. Podem ser Art. 159. Salvo no Distrito Federal e nas Capitais
DVVLPFODVVLFDGRV dos Estados, todas as peties e documentos que ins-
Atos das partes (arts. 158 a 161): praticados pelo trurem o processo, no constantes de registro pblico,
autor, ru, terceiros intervenientes e pelo Ministrio sero sempre acompanhados de cpia, datada e assi-
Pblico. nada por quem os oferecer.
$WRV GR MXL] DUWV  D   despachos, deci- 1 Depois de conferir a cpia, o escrivo ou chefe
ses interlocutrias e sentenas. da secretaria ir formando autos suplementares, dos
$WRVGRHVFULYmR DUWVD atos de comu- quais constar a reproduo de todos os atos e termos
nicao e de documentao. do processo original.
2 Os autos suplementares s sairo de cartrio
para concluso ao juiz, na falta dos autos originais.
FORMA DOS ATOS PROCESSUAIS
Art. 160. Podero as partes exigir recibo de peti-
es, arrazoados, papis e documentos que entrega-
Podem ser: rem em cartrio.
solenes Art. 161. defeso lanar, nos autos, cotas margi-
no solenes nais ou interlineares; o juiz mandar risc-las, impondo
Como regra, os atos processuais no dependem de a quem as escrever multa correspondente metade
forma determinada, pois prevalece o princpio da do salrio mnimo vigente na sede do juzo.
TALLITA RAMINE

liberdade das formas.

Art. 154 do CPC: Os atos e termos processuais no DOS ATOS DO JUIZ


dependem de forma determinada seno quando a
lei expressamente a exigir, reputando-se vlidos os
TXHUHDOL]DGRVGHRXWURPRGROKHSUHHQFKDPD- Artigos importantes do CPC
nalidade essencial.
Art. 162. Os atos do juiz consistiro em senten-
Os atos devem ser necessariamente em Portugus as, decises interlocutrias e despachos.
ou ento traduzidos para nossa lngua, caso sejam 1 Sentena o ato do juiz que implica alguma
redigidos em lngua estrangeira. das situaes previstas nos arts. 267 e 269 desta Lei.
2 Deciso interlocutria o ato pelo qual o
Art. 156 do CPC: Em todos os atos e termos do juiz, no curso do processo, resolve questo incidente.
processo obrigatrio o uso do vernculo. 3 So despachos todos os demais atos do juiz
Art. 157 do CPC: S poder ser junto aos autos praticados no processo, de ofcio ou a requerimento da
documento redigido em lngua estrangeira, quando parte, a cujo respeito a lei no estabelece outra forma.
DFRPSDQKDGRGHYHUVmRHPYHUQiFXORUPDGDSRU 4 Os atos meramente ordinatrios, como a
tradutor juramentado. juntada e a vista obrigatria, independem de despa-
cho, devendo ser praticados de ofcio pelo servidor e
Os atos processuais so pblicos, ressalvados os revistos pelo juiz quando necessrio.
processos que correm em segredo de Justia. Art. 163. Recebe a denominao de acrdo o
julgamento proferido pelos tribunais.
Art. 155 do CPC: Os atos processuais so pbli- Art. 164. Os despachos, decises, sentenas
cos. Correm, todavia, em segredo de justia os pro- e acrdos sero redigidos, datados e assinados
cessos: pelos juzes. Quando forem proferidos verbalmente,
I em que o exigir o interesse pblico; o taqugrafo ou o datilgrafo os registrar, subme-
,,TXHGL]HPUHVSHLWRDFDVDPHQWROLDomRVHSD- tendo-os aos juzes para reviso e assinatura.
rao dos cnjuges, converso desta em divrcio, Pargrafo nico. A assinatura dos juzes, em
alimentos e guarda de menores. todos os graus de jurisdio, pode ser feita eletroni-
Pargrafo nico. O direito de consultar os autos e camente, na forma da lei.
de pedir certides de seus atos restrito s partes Art. 165. As sentenas e acrdos sero profe-
e a seus procuradores. O terceiro, que demonstrar ridos com observncia do disposto no artigo 458; as
interesse jurdico, pode requerer ao juiz certido do demais decises sero fundamentadas, ainda que de
dispositivo da sentena, bem como de inventrio e modo conciso.
partilha resultante do desquite.

48
DOS ATOS DO ESCRIVO OU DO CHEFE DE SECRETARIA Em casos excepcionais, a citao e a penhora, podero
realizar-se nos domingos e feriados, ou nos dias teis, fora
do horrio estabelecido.
Artigos importantes do CPC Determinadas causas e atos podem ser praticados
durante as frias e feriados. So eles:
Art. 166. Ao receber a petio inicial de qual- citao;
quer processo, o escrivo a autuar, mencionando o atos de jurisdio voluntria e os necessrios con-
juzo, a natureza do feito, o nmero de seu registro, os servao de direitos;
nomes das partes e a data do seu incio; e proceder produo antecipada de provas;
do mesmo modo quanto aos volumes que se forem for- arresto, sequestro, penhora, arrecadao, busca e
mando. apreenso, depsito, priso, separao de corpos,
Art. 167. O escrivo numerar e rubricar todas abertura de testamento, embargo de terceiros, nun-
as folhas dos autos, procedendo da mesma forma ciao de obra nova e outros atos anlogos;
quanto aos suplementares. causas de alimentos provisionais (somente at a
Pargrafo nico. s partes, aos advogados, aos concesso de alimentos provisrios), dao ou
remoo de tutores e os relativos ao procedimento
rgos do Ministrio Pblico, aos peritos e s teste-
sumrio;
munhas facultado rubricar as folhas corresponden-
causas que a lei federal determinar.
tes aos atos em que intervieram.
Art. 168. Os termos de juntada, vista, concluso
e outros semelhantes constaro de notas datadas e Nesses casos acima mencionados, o prazo para a
resposta do ru s comear a correr no primeiro dia til
rubricadas pelo escrivo.
seguinte ao feriado ou s frias.
Art. 169. Os atos e termos do processo sero
So feriados, para efeito forense, os domingos e os

NOES DE DIREITO PROCESSUAL CIVIL


datilografados ou escritos com tinta escura e indel-
dias declarados por lei.
vel, assinando-os as pessoas que neles intervieram.
4XDQGRHVWDVQmRSXGHUHPRXQmRTXLVHUHPUPiORV
PRAZOS DOS ATOS PROCESSUAIS
RHVFULYmRFHUWLFDUiQRVDXWRVDRFRUUrQFLD
1 vedado usar abreviaturas.
2VSUD]RVSRGHPVHUFODVVLFDGRVFRPR
2 Quando se tratar de processo total ou parcial-
Dilatrios: podem ser ampliados ou reduzidos de
mente eletrnico, os atos processuais praticados na pre- acordo com a conveno das partes, mas, para que
sena do juiz podero ser produzidos e armazenados de WHQKDPHFiFLDDVSDUWHVGHYHPID]HUXPUHTXH-
modo integralmente digital em arquivo eletrnico inviol- rimento ao juiz, antes do vencimento do prazo (art.
vel, na forma da lei, mediante registro em termo que ser 181 do CPC).
assinado digitalmente pelo juiz e pelo escrivo ou chefe de  1HVVH FDVR R MXL] [DUi QRYR GLD SDUD R YHQFL-
secretaria, bem como pelos advogados das partes. mento do prazo.
3 No caso do 2 deste artigo, eventuais con- Peremptrios: so os atos improrrogveis, fatais,
tradies na transcrio devero ser suscitadas oral- QDLV
mente no momento da realizao do ato, sob pena defeso s partes, ainda que todas estejam de
de precluso, devendo o juiz decidir de plano, regis- acordo, reduzir ou prorrogar os prazos peremptrios.
trando-se a alegao e a deciso no termo. O juiz poder, nas comarcas onde for difcil o trans-
Art. 170. eOtFLWRRXVRGDWDTXLJUDDGDHVWHQR- porte, prorrogar quaisquer prazos, mas nunca por
tipia, ou de outro mtodo idneo, em qualquer juzo mais de sessenta dias (art. 182 do CPC).
Em caso de calamidade pblica, poder ser exce-
ou tribunal.
dido o limite previsto no art. 182 do CPC.
Art. 171. No se admitem, nos atos e termos,
/HJDLVVmRHVWDEHOHFLGRVQDOHLGHIRUPD[D
espaos em branco, bem como entrelinhas, emendas
-XGLFLDLVVmR[DGRVSHORMXL]
ou rasuras, salvo se aqueles forem inutilizados e estas Quando a lei no determinar o prazo, o juiz o far,
expressamente ressalvadas. considerando a complexidade da causa (art. 177 do
CPC).
Convencionais: so os que a lei permite sejam
TEMPO E LUGAR DOS ATOS PROCESSUAIS acordados pelas partes (art. 181 do CPC). So os
prazos dilatrios.
O lugar dos atos, como regra, na sede do juzo,
e sero realizados das 6 s 20 horas, nos dias teis (de CONSIDERAES ACERCA DOS PRAZOS
segunda-feira ao sbado).
No entanto, podero ser concludos depois das 20 Todo prazo em regra contnuo, no se interrompendo
horas os atos iniciados antes, quando o adiamento prejudi- nos feriados (art. 178 do CPC).
car a diligncia ou causar grave dano. As frias suspendem os prazos, o que lhe sobejar
Nos juizados especiais, podem ser praticados atos pro- recomear a correr do primeiro dia til seguinte ao
cessuais em horrio noturno. termo das frias. (art. 179 do CPC).

49
Tambm suspendem os prazos os obstculos cria- 2. (FCC/ 2012/ TRF/ 5 REGIO/ Analista Judicirio/rea
dos pela parte contrria, a morte ou perda da capa- Judiciria) 4XDQWRDRVDWRVSURFHVVXDLVpFRUUHWRDU-
cidade processual, a conveno das partes e a mar que:
exceo de incompetncia (art. 180 do CPC). a. os atos e termos processuais no dependem de
Decorrido o prazo, extingue-se, independente- forma determinada seno quando a lei expressa-
mente de declarao judicial, o direito de praticar o mente a exigir, tendo-se por vlidos aqueles que,
DWRFDQGRVDOYRSRUpPjSDUWHSURYDUTXHRQmR UHDOL]DGRVGHPRGRGLYHUVROKHSUHHQFKDPDQD-
realizou por justa causa (art. 183 do CPC). lidade essencial.
Exclui-se o dia do comeo e inclui-se o dia do ven- b. o direito de consultar os autos e de pedir certido
de seus atos livre a qualquer pessoa, salvo ape-
cimento, salvo disposio em contrrio (art. 184 do
nas o segredo de justia.
CPC).
c. em todos os atos e termos do processo faculta-
Considera-se prorrogado o prazo at o primeiro dia
tivo o uso do vernculo, pois pode ser anexado ao
til se o vencimento cair em feriado ou em dia em
processo documento redigido em lngua estrangei-
que:
ra, sem ressalvas.
for determinado o fechamento do frum; d. os atos processuais, como regra, correm em segre-
o expediente forense for encerrado antes da do de justia, podendo ser tornados pblicos por
hora normal. ordem judicial fundamentada.
2V SUD]RV FRPHoDP D XLU D SDUWLU GR GLD ~WLO e. possvel s partes lanar nos autos cotas mar-
seguinte ao da intimao (art. 184, 2, CPC). ginais ou interlineares, desde que em linguagem
Intimao feita na sexta-feira: o prazo tem incio na processual de praxe.
segunda-feira, se for dia til.
Intimao feita no sbado: o prazo tem incio na 3. (FCC/ 2010/ TRF/ 4 REGIO/ Analista Judicirio/ rea
tera-feira, se for dia til. Judiciria) Quanto aos atos processuais, considere:
No havendo preceito legal nem assinao pelo I No havendo preceito legal nem assinao pelo
juiz, ser de cinco dias o prazo para a prtica de juiz, ser de dez dias o prazo para a prtica de ato
ato processual a cargo da parte (art. 185 do CPC). processual a cargo da parte.
A parte poder renunciar ao prazo estabelecido II Quando os litisconsortes tiverem diferentes procu-
radores, ser-lhes-o contados em dobro os prazos
TALLITA RAMINE

exclusivamente em seu favor (art. 186 do CPC).


Quando a lei no marcar outro prazo, as intimaes para contestar, para recorrer e, de modo geral,
somente obrigaro a comparecimento depois de para falar nos autos.
decorridas vinte e quatro horas (art. 192 do CPC). III defeso s partes, ainda que todas estejam de
Sendo comum s partes o prazo, s em conjunto ou acordo, reduzir ou prorrogar os prazos perempt-
rios.
mediante prvio ajuste por petio nos autos, pode-
IV Computar-se- em qudruplo o prazo para contes-
ro os seus procuradores retirar os autos, ressal-
tar e em dobro para recorrer quando a parte for a
vada a obteno de cpias para a qual cada procu-
Fazenda Pblica ou o Ministrio Pblico.
rador poder retir-los pelo prazo de 1 (uma) hora
independentemente de ajuste (art. 40, 2, CPC).
De acordo com o Cdigo de Processo Civil, est corre-
to o que consta APENAS em
EXERCCIOS a. I e IV.
b. II e III.
c. II, III e IV.
1. (FCC 2013/ MPE-SE/ Analista/ Direito) Quanto forma d. III e IV.
GRVDWRVSURFHVVXDLVpFRUUHWRDUPDU e. I, II e III.
a. Os atos processuais realizam-se em dias teis, das
seis s vinte horas, em nenhuma hiptese podendo 4. (FCC/ 2012/ TRF/ 2 REGIO/ Tcnico Judicirio/ rea
ultrapassar esses horrios, que so peremptrios. Administrativa) Pode ser expedida por meio eletrnico,
b. Os atos das partes, consistentes em declaraes com assinatura eletrnica do juiz, na forma da lei:
unilaterais ou bilaterais de vontade, produzem ime- a. somente a carta precatria e a carta rogatria.
GLDWDPHQWHDFRQVWLWXLomRDPRGLFDomRRXDH[- b. somente a carta de ordem e a carta precatria.
tino de direitos processuais. c. a carta de ordem, a carta precatria e a carta ro-
c. Os atos do juiz que lhe competem, exclusivamente gatria.
so as sentenas, todos os demais podendo ser d. somente a carta precatria.
praticados pelo escrivo e revistos posteriormente e. somente a carta de ordem.
pelo juiz.
d. vedado ao juiz determinar prazos para a prtica 5. (FCC/ 2012/ TRF/ 2 REGIO/ Analista Judicirio/
Execuo de Mandados) O ato de juntada de peties
dos atos processuais, pois sempre a lei que os
aos autos:
determina.
a. depende de deciso interlocutria do juiz, resolven-
e. O prazo legal interrompe-se nos feriados e na su-
do pedido da parte no curso do processo.
pervenincia de frias, contando-se do incio a par-
b. depende de prvio despacho do juiz, ordenando
tir do primeiro dia til posterior a elas. que o servidor assim o proceda.

50
c. pode ser feito pelos advogados de quaisquer das 9. (FCC/ 2013/ TRT/ 1 REGIO (RJ)/ Analista Judicirio/
partes, independentemente de ordem judicial. Execuo de Mandados) No que concerne aos atos
d. independe de despacho, devendo ser praticado de processuais, os atos do juiz que designam audincia
ofcio por servidor e revisto pelo juiz quando neces- de conciliao, que extinguem o processo sem reso-
srio. luo do mrito e que indeferem a produo de prova
e. s pode ser feito em decorrncia de sentena pelo pericial so, respectivamente:
juiz, ao apreciar requerimento formulado pela parte. a. decises interlocutrias, despachos e sentenas.
b. sentenas, despachos e decises interlocutrias.
6. (FCC/ 2011/ PGE-MT/ Procurador) A respeito do tem- c. decises interlocutrias, sentenas e despachos.
po e lugar dos atos processuais, certo que: d. despachos, decises interlocutrias e sentenas.
a. a produo antecipada de provas pode ser pratica- e. despachos, sentenas e decises interlocutrias.
da nos feriados.
b. os atos processuais realizar-se-o em dias teis, 10. (FCC/ 2012/ TRF/ 2 REGIO/ Tcnico Judicirio/
das nove s dezoito horas. rea Administrativa) Quanto forma dos atos proces-
c. os prazos estabelecidos pelo juiz suspendem-se suais, considere:
nos feriados. I Em todos os termos e atos do processo obrigat-
d. podem as partes, de comum acordo, reduzir ou rio o uso do vernculo.
prorrogar os prazos dilatrios, mesmo depois do II Poder ser juntado aos autos documento redigido
respectivo vencimento. em lngua estrangeira, cabendo ao juiz, se no do-
e. a parte no poder renunciar ao prazo estabeleci- minar o idioma, ordenar a traduo.
do exclusivamente em seu favor.
III eOtFLWRRXVRGDWDTXLJUDDGDHVWHQRWLSLDRXGH
outro mtodo idneo, em qualquer juzo ou tribu-
7. (FCC/ 2010/ MPE-RN/ Agente Administrativo) No que
nal.
diz respeito aos atos processuais no processo civil,
Est correto o que consta SOMENTE em
FRUUHWRDUPDUTXH

NOES DE DIREITO PROCESSUAL CIVIL


a. I e II.
a. a desistncia da ao produz efeito a partir da jun-
b. I e III.
tada do pedido ao respectivo processo.
c. II e III.
b. nos processos que correm em segredo de justia,
d. I.
o terceiro, que demonstrar interesse jurdico, pode
requerer ao juiz certido do dispositivo da senten- e. II.
a, bem como de inventrio e partilha resultante
do desquite. 11. (FCC/ 2012/ TRE-PR/ Analista Judicirio/ rea Admi-
c. documento em lngua estrangeira somente pode- nistrativa) Quando a lei prescrever determinada forma
r ser juntado aos autos quando acompanhado para o ato processual,
de verso em vernculo, que pode ser feita pelo a. em nenhuma hiptese poder ser aproveitado, se a
prprio advogado, sob declarao de veracidade. forma determinada tiver sido preterida.
d. no tem valor legal a assinatura do juiz feita ele- b. mesmo que sob cominao de nulidade, o juiz con-
tronicamente. siderar vlido o ato se, realizado de outro modo,
e. pYHGDGRRXVRGDWDTXLJUDDRXGDHVWHQRWLSLDHP OKHDOFDQoDUDQDOLGDGH
qualquer juzo ou tribunal. c. desde que sem cominao de nulidade, o juiz con-
siderar vlido o ato se, realizado de outro modo,
8. (FCC/ 2013/ MPE-MA/ Tcnico Ministerial/ Execuo OKHDOFDQoDUDQDOLGDGH
de Mandados) Sobre os atos processuais, de acordo d. somente a requerimento da parte prejudicada o juiz
com o Cdigo de Processo Civil brasileiro, INCOR- OKHQHJDUiHFiFLDVHDIRUPDGHWHUPLQDGDQmRIRU
5(72DUPDU atendida.
a. defeso lanar, nos autos, cotas marginais ou in- e. somente a requerimento de ambas as partes o
terlineares, cabendo ao juiz mandar risc-las, im- juiz considerar vlido o ato se, realizado de outro
pondo a quem as escrever multa correspondente PRGROKHDOFDQoDUDQDOLGDGH
metade do salrio mnimo vigente na sede do
juzo. 12. (FCC/ 2012/ TRF/ 2 REGIO/ Analista Judicirio/ rea
b. A assinatura dos juzes, em todos os graus de juris Judiciria) O ato pelo qual o juiz, no curso do processo,
dio, pode ser feita eletronicamente, na forma da resolve questo incidente denominado
lei.
a. deciso interlocutria.
c. Os atos meramente ordinatrios, como a juntada
e a vista obrigatria, independem de despacho, b. despacho.
devendo ser praticados de ofcio pelo servidor e c. ato ordinatrio.
revistos pelo juiz quando necessrios. d. senteno constitutiva.
d. S poder ser juntado aos autos documento redi- e. sentena declaratria.
gido em lngua estrangeira, quando acompanhado
GHYHUVmRHPYHUQiFXORUPDGDSRUWUDGXWRUMX- 13. (FCC/ 2012/ TRT/ 20 REGIO (SE)/ Juiz do Trabalho
ramentado. - Tipo 1) As espcies de precluso so:
e. A desistncia da ao produzir efeito imediata- a. todas as condies de procedibilidade processual,
mente, independentemente de homologao por que objetivam a formao e o desenvolvimento v-
sentena. lido e regular do processo.

51
b. a perempo, a litispendncia e a coisa julgada, eletrnico inviolvel, na forma da lei, mediante registro
extinguindo-se o processo, em razo de seu reco- em termo que ser assinado digitalmente pelo juiz e
nhecimento, com resoluo do mrito. pelo escrivo ou chefe de secretaria, bem como pe-
c. a decadncia e a prescrio, extinguindo-se o pro- los advogados das partes. Eventuais contradies na
cesso, quando reconhecidas, sem resoluo do transcrio devero ser suscitadas
mrito. a. oralmente no momento da realizao do ato, re-
d. todas as excees processuais, meios de defesa gistrando-se a alegao, devendo o juiz decidir
indireta, que visam a obstar o regular prossegui- no prazo de cinco dias, sendo as partes intimadas
mento do processo. desta deciso.
e. temporal, consumativa e lgica, impossibilitando a b. oralmente no momento da realizao do ato, re-
prtica do ato processual ulterior se antes reconhe- gistrando-se a alegao, devendo o juiz decidir no
cidas nos autos. prazo de quarenta e oito horas, sendo as partes
intimadas desta deciso.
14. (FCC/ 2013/ TRT/ 15 Regio (Campinas)/ Analista c. oralmente no momento da realizao do ato, sob
-XGLFLiULR 2FLDO GH -XVWLoD$YDOLDGRU  &RQVLGHUH DV pena de precluso, devendo o juiz decidir de plano,
DUPDWLYDVDEDL[R
registrando-se a alegao e a deciso no termo.
I O direito processual brasileiro marcado pelo for-
d. oralmente no momento da realizao do ato, de-
malismo, no permitindo, por exemplo, o aproveita-
vendo ser as razes da contradio feitas por es-
mento de ato no revestido da forma legal, mesmo
crito no prazo de cinco dias e o juiz decidir no prazo
TXHGHRXWURPRGRWHQKDDOFDQoDGRDQDOLGDGH
de quarenta e oito horas, sendo as partes intima-
e ainda que a lei no tenha cominado nulidade pela
das desta deciso.
no observncia da prescrio legal.
e. por escrito no prazo de vinte e quatro horas, sob
II O direito processual brasileiro no permite suprir
pena de precluso, devendo o juiz decidir no pra-
a irregularidade de forma, o que se vislumbra, por
exemplo, no fato de poder alegar nulidade at zo de cinco dias, sendo as partes intimadas desta
aquele que lhe deu causa. deciso.
III Por ser questo de ordem pblica, o ato que no
17. (FCC/ 2011/ TRT/ 1 REGIO (RJ)/ Juiz do Trabalho)
TALLITA RAMINE

atende forma deve ser repetido, com as formali-


dades legais, ainda que no tenha trazido prejuzo eFRUUHWRDUPDU
s partes. a. Os atos das partes, consistentes em declaraes
unilaterais ou bilaterais de vontade, produzem ime-
(VWi,1&255(72RTXHVHDUPDHP GLDWDPHQWHDFRQVWLWXLomRDPRGLFDomRRXDH[-
a. I, II e III. tino de direitos processuais.
b. I e II, apenas b. O direito de consultar os autos e de pedir certides
c. I e III, apenas. de seus atos irrestrito a qualquer terceiro que de-
d. III, apenas. monstre interesse jurdico.
e. II e III, apenas. c. Os atos processuais so pblicos, correndo porm
em segredo de justia os referentes a direitos dis-
15. (FCC/ 2011/ TRE-AP/ Analista Judicirio/ rea Admi- ponveis patrimoniais.
nistrativa) Quando a carta precatria for enviada para d. A desistncia da ao produz efeito to logo seja
Juiz que carecer de competncia em razo da hierar- juntada a petio correspondente ao processo.
quia, este: e. Como regra, os atos e termos processuais depen-
a. a cumprir, cabendo s partes a arguio da nuli- GHPGHIRUPDGHWHUPLQDGDHHVSHFtFD
dade do ato.
b. recusar cumprimento, enviando-a para a Correge-
doria-Geral do Tribunal competente.
c. a cumprir e posteriormente enviar para a auto-
GABARITO
ULGDGH KLHUDUTXLFDPHQWHFRPSHWHQWHSDUDUDWLFD-
o dos atos.
d. recusar cumprimento, devolvendo-a com despa- 1. b 12. a
cho motivado. 2. a 13. e
e. recusar cumprimento, enviando-a para o Tribunal 3. c 14. a
Superior competente para apreciao da irregulari- 4. c 15. d
dade atravs de processo administrativo. 5. d 16. c
6. a 17. a
16. (FCC/ 2011/ TRF/ 1 REGIO/ Analista Judicirio/ rea 7. b 18. a
Judiciria) Quando se tratar de processo total ou par- 8. e 19. e
cialmente eletrnico, os atos processuais praticados 9. e 20. c
na presena do juiz podero ser produzidos e arma- 10. b
zenados de modo integralmente digital em arquivo 11. c

52
NOES DE ADMINISTRAO/ GESTO DE PESSOAS/ NOES
DE GESTO DE PROCESSOS/ NOES DE ARQUIVOLOGIA

SUM RIO

NOES DE ADMINISTRAO
ESTRUTURA ORGANIZACIONAL. PODERES ADMINISTRATIVOS. PLANEJAMENTO, ORGANIZAO,
DIREO E CONTROLE. COMPORTAMENTO, CLIMA E CULTURA ORGANIZACIONAL ..........................540

GESTO DE PESSOAS
CARACTERSTICAS. CONCEITOS E PRTICAS DE GESTO DE PESSOAS NA ADMINISTRAO
PBLICA. MOTIVAO, LIDERANA, DESEMPENHO. GESTO DA QUALIDADE E MODELO DE
EXCELNCIA GERENCIAL. GESTO POR COMPETNCIAS E GESTO DO CONHECIMENTO ..................542

NOES DE GESTO DE PROCESSOS


TCNICAS DE MAPEAMENTO, ANLISE E MELHORIA DE PROCESSOS .....................................................544

NOES DE ARQUIVOLOGIA
ARQUIVSTICA (PRINCPIOS E CONCEITOS); GESTO DE DOCUMENTOS; PROTOCOLOS: RECEBI-
MENTO, REGISTRO, DISTRIBUIO, TRAMITAO E EXPEDIO DE DOCUMENTOS; CLASSIFICA-
O DE DOCUMENTOS DE ARQUIVO. ARQUIVAMENTO E ORDENAO DE DOCUMENTOS. PRE-
SERVAO E CONSERVAO DE DOCUMENTOS DE ARQUIVO .............................................................546
CLASSIFICAO DE MATERIAIS. GESTO DE ESTOQUES. COMPRAS NO SETOR PBLICO. PERFIL
DO COMPRADOR. ELABORAO DE TERMOS DE REFERNCIA. PESQUISA DE PREOS. CADASTRO
DE FORNECEDORES. RECEBIMENTO, CONFERNCIA E ARMAZENAGEM. ARRANJO FSICO (LEIAUTE).
DISTRIBUIO DE MATERIAIS. TOMBAMENTO DE BENS. CONTROLE DE BENS. INVENTRIO. ALIE-
NAO DE BENS. ALTERAES E BAIXA DE BENS ....................................................................................569
CONVERGNCIAS E DIFERENAS ENTRE A GESTO PBLICA E A GESTO PRIVADA. NOVAS
TECNOLOGIAS GERENCIAIS .......................................................................................................................591
NOES DE ADMINISTRAO Componentes da Estrutura Organizacional

ESTRUTURA ORGANIZACIONAL DAS EMPRESAS a) Sistema de responsabilidade:


departamentalizao;
O conceito de estrutura organizacional refere-se linha e assessoria;
forma pela qual as atividades de uma organizao so divi- especializao do trabalho.
didas, organizadas e coordenadas (STONER, 1992). Todas
as empresas possuem dois tipos de organizaes, que b) Sistema de autoridade:
devem ser respeitadas e sempre levadas em considerao,
amplitude administrativa ou de controle;
so as formais e informais.
nveis hierrquicos;
delegao;
Organizaes Formais
centralizao e descentralizao.
So aquelas planejadas e formalmente representadas,
em alguns aspectos, por meio do seu organograma 1. Tm c) Sistema de comunicaes:
como caractersticas: o que;
nfase nas posies em termos de autoridade e como;
responsabilidades; quando;
estvel; de quem;
est sujeita ao controle; para quem.
est em uma estrutura;
existe uma liderana formal. 1tYHLVGHXPDHVWUXWXUDRUJDQL]DFLRQDO

Organizaes Informais Nvel estratgico.


Nvel ttico.
H interao social dos trabalhadores. Se desenvolve
Nvel operacional.
espontaneamente quando esse grupo se rene. So rela-
es que no aparecem no organograma da empresa,
SRUpPH[LVWHPHLQXHQFLDPGHPDVLDGDPHQWHHPWRGRVRV Tipos de Estrutura Organizacional
processos formais.
a) Matricial: R JHUHQFLDPHQWR FD GLYLGLGR HQWUH JH-
Caractersticas: rncias funcionais e gerncias de projetos, buscan-
est nas pessoas; do a ao integrada para a realizao dos objetivos
sempre existiro; empresariais.
D DXWRULGDGH XL QD PDLRULD GDV YH]HV GH IRUPD
horizontal; Gerente
instvel; Geral
no est sujeita a controle;
est sujeita a sentimentos; Secretaria Assessoria
existe um lder informal;
desenvolve sistemas e canais de comunicao.
Engenha-
Suprimentos Adm/Finanas Uni/Info
ria
Vantagens da estrutura informal:
proporciona maior rapidez no processo; Projeto
complementa a estrutura formal; 1
reduz a carga de comunicao dos chefes;
Projeto
motiva e integra as pessoas na empresa.
2

'HVYDQWDJHQV Projeto
GHVFRQKHFLPHQWRGDVFKHDV 3
GLFXOGDGHGHFRQWUROH Fonte: autor, 2012.
Z CARLOS

possibilidade de atritos entre pessoas. b) Funcional: so agrupadas de acordo com as fun-


es da empresa.
Tipologia de Estrutura Organizacional
Presidente
Funcional.
Clientes.
Produtos.
Diretor de
Territorial. Diretor Financeiro Diretor de Marketing
Recursos Humanos
Por projetos.
Matricial.
Assistente Finan-
Assistente de MKT Assistente de RH
ceiro
1
Organograma: refere-se a um grfico que representa a estrutura formal
Fonte: autor, 2012.
de uma organizao.

54
c) 3URMHWR as atividades e as pessoas recebem atri- f) Estrutura Horizontal (Sistmica)
buies temporrias. Mercado

Setor Setor Setor Rotas Setor Rotas Setor Rotas


Setor
Rotas Domsticas Domsticas
Executivo Rotas Rotas Domsticas
Coordenao Asia e
Amrica Europa Dinamarca Sucia Noruega
Chefe de Projetos Africa

Diviso
Gerente Gerente Gerente Comercial
Funcional Funcional Funcional Finanas Vice
Presidente

Pessoal Pessoal Pessoal Presidente


Unidades
Planejamento e
Centrais de
Pessoal Pessoal Pessoal Controle
Administrao

Pessoal Pessoal Pessoal


SAS SAS SAS
Dinamarca Sucia Noruega
Fonte: autor, 2012.
Fonte: Organograma da Scandinavian Airlines System (SAS), 1991.

CULTURA ORGANIZACIONAL
d) Mista: muitas organizaes usam esse tipo de de-
partamentalizao, principalmente as grandes em- A Cultura Organizacional um modelo de pressupostos
presas. bsicos, que determinado grupo tenha inventado, descoberto
ou desenvolvido no processo de aprendizagem para lidar com
os problemas de adaptao externa e adaptao interna. A
Conselhos de
Cultura Organizacional envolve padres de comportamento,
Acionistas
valores, crenas e pressupostos, onde o processo de mudana
Conselho Conselho pode ocorrer de duas formas distintas: uma na forma de subsis-
Consultivo Tcnico
tema que se liga estrutura mor 2 da organizao, estratgia
e aos sistemas polticos e tcnicos; e outra como uma superes-
Presidente Unidade trutura que determina todos os demais componentes.
Informtica Alguns dos componentes da Cultura so, normalmente,
Secretaria
de origem histrica, do ambiente e territrio onde a orga-
Auditoria nizaao est inserida, de suas crenas e pressupostos, de
regras e regulamentos, do processo de comunicao, de
ritos e cerimnias, de heris e tabus ou, ainda, de produtos
Depto. de Depto. de Depto. de Depto. de e servios com que est envolvida.
Produo Markenting Suprimentos Finanas
Cultura Organizacional
Diviso Diviso de Diviso de &2 &RQDQoD&RODERUDomR$SUHQGL]DGR3HUVSHFWLYD
Petroquimica Plsticos Embalagens 6LVWrPLFD7HPSR

NOES DE ADMINISTRAO/ GESTO DE PESSOAS/ NOES


Fonte: autor, 2012. Funes da Cultura Organizacional: DE GESTO DE PROCESSOS/ NOES DE ARQUIVOLOGIA
estabilidade, previso e reproduo;
fornecer modelos de comportamentos;
e) Estrutura em rede fornecer o que importante, vlido e as prioridades;
desenvolver linguagens de comunicao adequa-
das s organizaes;
Empresa de Empresa de
reduzir incertezas e inseguranas no ambiente de
Desenhos e Projetos Contabilidade
trabalho.

Empresa Intermediria 3DUWHVHQYROYLGDVQD&XOWXUDGD2UJDQL]DomR


(Core Business) fundadores e lderes;
grupos internos;
Empresa de ambiente social pas, sociedade, mundo dos
Empresa de Vendas
Distribuio QHJyFLRV VHWRU HVSHFtFR D RUJDQL]DomR QR VHX
conjunto e histria;
Empresa de toda cultura refere-se a um grupo, a um tempo e a
Manufatura
XPHVSDoRHVSHFtFRV

Fonte: Chiavenato, 1998. 2


maior; principal.

55
Cuidados com a mudana cultural: Dessa forma, a qualidade no servio pblico passa
reconhecer as rupturas e a desordem; a ser analisada tendo como base os valores de empresa
RVOtGHUHVGHYHPH[SULPLUFRQDQoD (pblica), servidores pblicos e usurios dos servios pbli-
mudana como construo de novas habilidades e cos. Dessa forma, temos como aes um aumento conside-
pensamentos; rvel das exigncias (legais) por parte dos cidados. O Pro-
tempo para adaptao e consolidao; grama de Qualidade no Servio Pblico (PQSP) destinado
os novos padres da organizao devem ser claros a orientar os rgos e entidades pblicas a implementarem
HDDYDOLDomREHPGHQLGD Do}HVYROWDGDVSDUDDPHOKRULDGDTXDOLGDGHHGDHFiFLD
dos seus servios e para a reduo dos custos operacionais
Impactos durante o processo de mudana da Cultura de seus processos.
Organizacional:
LQVHJXUDQoDQRVQRYRVREMHWLYRVHPHWDVGHQLGRV 3ULQFtSLRVGDTXDOLGDGHQRVHUYLoRS~EOLFR
incerteza de padres de autoridade;
elevao dos rumores, fofocas e vulnerabilidades; Satisfao do cliente (cidado).
oportunistas estrategistas individuais; Envolvimento de todos (empresa pblica, servido-
queda na produtividade e lideranas fracas. res pblicos e cidados).
Gesto participativa.
GESTO DE PESSOAS Gerncia de processos.
Valorizao das pessoas.
RECURSOS HUMANOS NO SERVIO PBLICO Constncia de propsitos.
Melhoria contnua.
O setor de Recursos Humanos no servio pblico tem Gesto pr-ativa.
sido colocado em destaque nas ltimas dcadas em funo
GESTO DE COMPETNCIAS
de dois fatores bsicos, que comprometem o processo de
evoluo das empresas pblicas: a evoluo constante
Segundo Prahalad (1990), as competncias combi-
e rpida das ferramentas tecnolgicas, que promovem
nam conhecimento e habilidades; representam tanto a base
um acesso em tempo real a contedos do mundo inteiro,
dos conhecimentos tcitos quanto o conjunto de habilida-
somando-se ao processo de constante estabilizao eco-
GHVQHFHVViULDVSDUDDUHDOL]DomRGHDo}HVSURGXWLYDV8P
nmica do Brasil. Como consequncia de todo esse pro-
dos mais conhecidos conceitos de competncia o desen-
cesso, as empresas pblicas necessitam capacitar, treinar
volvido por Boyatzis (1982): uma caracterstica sobres-
e/ou aperfeioar sua mo de obra, de maneira que oferea
salente de uma pessoa, que est casualmente relacionada
servios de alta qualidade e no tempo ideal para seus usu-
com um desempenho bom ou excelente em um posto de
rios. WUDEDOKRFRQFUHWRHPXPDRUJDQL]DomRFRQFUHWD
O processo de gesto de Recursos Humanos na Admi- 6SHQGHU   DUPD TXH H[LVWHP FLQFR WLSRV GH
nistrao Pblica tem sido alvo de grandes discusses por caractersticas nas competncias, que sugerem uma classi-
parte dos estudiosos no assunto, pois se depara com um FDomRGDVHJXLQWHIRUPD
JUDQGHGHVDR&RPRPRWLYDURVVHUYLGRUHVS~EOLFRV" motivacionais: determinam o comportamento que as
Normalmente, o que ouvimos e lemos nas diversas pessoas tm frente a um determinado tipo de ao;
mdias que os servidores pblicos so indivduos que necessidade de sucesso, de poder ou de relaciona-
no buscam nenhum tipo de especializao e muito menos mento;
GHVHQYROYLPHQWRSURVVLRQDOYLVWRTXHSRVVXHPDJDUDQWLD WUDoRVGHSHUVRQDOLGDGHMXVWLFDPRVWLSRVGHUHD-
GHUHFHEHUVHXVVDOiULRVVHMDPERQVRXPDXVSURVVLRQDLV es perante determinadas situaes;
(VVDDUPDWLYDHUUDGDGLJDVHGHSDVVDJHPMiVHSHUGHX capacidades pessoais: esto relacionadas s atitu-
nos antigos discursos das dcadas de 70 e 80, apesar de des, valores e autoimagem;
ainda termos alguns representantes dessa classe que ainda conhecimentos e habilidades: capacidade de realizar
deixam muito a desejar no que diz respeito a necessidade determinados tipos de atividades fsicas e mentais.
de, cada vez mais, especializar ou aprimorar suas habilida-
des e competncias. COMPETNCIAS IDENTIFICADAS
O processo de modernizao nas instituies pblicas
QR%UDVLOpFRPSURPHWLGRSRUYiULRVIDWRUHVTXHGLFXOWDPD a) Capacidade empreendedora: facilidade de identi-
DGRomRGDVPHGLGDVPDLVHFD]HVSDUDDGHTXDUDVLQVWLWXL- FDURSRUWXQLGDGHVTXHVXUJHPRXTXHMiH[LVWDP
Z CARLOS

es para o cumprimento de suas misses, ou seja, prestar no mercado de trabalho, seja por uma nova rea
um bom servio pblico. que surge nas organizaes, seja por oportunida-
des de negcios.
3URJUDPDEUDVLOHLURGDTXDOLGDGHHSURGXWLYLGDGH
b) Capacidade de trabalho sob presso: refere-se
O Programa Brasileiro da Qualidade e Produtividade jFDSDFLGDGHTXHRSURVVLRQDOSRVVXLHPPHVPR
(PBQP) foi implantado em 1991. Da por diante deu-se o trabalhando sobre presso, buscar fontes alternati-
processo de mudana na Administrao Pblica brasileira, vas de resoluo dos problemas.
que tinha, como uma de suas premissas, iniciar um pro- c) Comunicao: reconhecido como um grande pro-
cesso de mudana nas organizaes pblicas, procurando blema nas organizaes, refere-se capacidade
WRUQDUVHXVVHUYLGRUHVFDGDYH]PDLVHFLHQWHVQDSUHVWD- da pessoa saber se comunicar e ser entendido. Um
o do servio pblico. ponto interessante a ser destacado que muitas or-

56
JDQL]Do}HVQmRVHSUHRFXSDPFRPTXHPVHUiR um sistema complexo, composto por subsistemas
receptor da informao a ser repassada. Isso um que devem estar sempre interligados e interdepen-
grande engano, pois, apesar do emissor ser uma dentes.
pessoa altamente capacitada, o meio de comunica-
o escolhido no ideal para o receptor e, como 2TXHVLJQLFDiUYRUHVGHFRPSHWrQFLDV"
consequncia, a comunicao sofrer problemas
de entendimento. Portanto, a primeira anlise que um modelo de gesto que tem como base a coopera-
deve ser feita refere-se s habilidades e competn- o mtua dos membros da organizao, independente do
cias do receptor. setor ou departamento que desenvolvem as suas atividades,
permitindo, dessa forma, um maior e melhor direcionamento
d) &ULDWLYLGDGH: refere-se capacidade de buscar e SDUDDGHQLomRGRVSODQHMDPHQWRVGDRUJDQL]DomR
FRQFHEHUVROXo}HVSDUDSUREOHPDVLGHQWLFDGRV
DIFERENA ENTRE GRUPO E EQUIPE DE TRABALHO
e) Cultura da qualidade: natural pensarmos em
qualidade, mas no mais utilizando o conceito de
Um Grupo de Trabalho tem objetivos, algumas vezes
qualidade como diferencial entre um produto ou ou-
divergentes, onde cada indivduo preocupa-se com si s. J
tro. Superar as expectativas dos clientes internos e
uma Equipe de Trabalho foca em uma causa maior, eviden-
externos faz parte dessa caracterstica.
ciando os objetivos da organizao como um todo, e no os
f) Dinamismo: pr-atividade sempre, capacidade de individuais. Os membros da equipe reconhecem que exis-
atuar de maneira preventiva, sempre frente dos tem habilidades e competncias dos outros membros da
provveis problemas que possam surgir. organizao e as valoriza.

g) FlexibilidadeFDSDFLGDGHGHWHURMRJRGHFLQWXUD Polarizao: a adoo de posies extremas,


adequado e ideal para resolver alguns problemas causadas, geralmente, por falhas na percepo.
LGHQWLFDGRV3HQVDUHDJLU 5LJLGH]LQFDSDFLGDGHGHVHULQH[tYHOSDUDPXGDQ-
as de ponto de vista.
h) Liderana: seja qual for o estilo ou o tipo de lideran- Egocentrismo: viso centrada exclusivamente em si
oD HOHV GHYHP VXUJLU GH PDQHLUD QDWXUDO GHQWUR prprio. No existe equipe de trabalho.
de um grupo formal ou informal. Parcialismo: refere-se percepo de somente
uma das partes da situao.
i) 0RWLYDomR p R JUDQGH GHVDR GDV RUJDQL]Do}HV Viso otimizada: refere-se observao de elemen-
hoje em dia. Maslow, entre outros, jamais ser es- tos soltos, sem nenhuma forma de integrao.
quecido, mas sim lembrado como referncia para 'LVWRUo}HV GH YDORUHV SHVVRDLV GLFXOGDGH HP
RXWUDVDQiOLVHV'HVDR"6LP4XDO"3URFXUDULGHQ- SURPRYHU D LGHQWLFDomR H DQiOLVH GH YDULiYHLV
WLFDUTXDLVDVQHFHVVLGDGHVTXHVHXVIXQFLRQiULRV ambientais.
tm, nesse exato momento, e tentar san-las. O Soberba: superestima pessoal que, ao mesmo
difcil quando temos um nmero expressivo de WHPSRGHVTXDOLFDDVKDELOLGDGHVHFRPSHWrQFLDV
funcionrios na organizao. Por isso, o maior dos demais membros da organizao.
GHVDR Baixo autocontexto: sentimento de menos valia,
onde o funcionrio pensa que no capaz de reali-
M  Negociao: refere-se capacidade de ouvir e ser
zar tal tarefa, de ser inferior.
RXYLGRFRPSUHHQGHUHVHUFRPSUHHQGLGRHQR-
QDOGDVGLVFXVV}HVVHUFDSD]GHUHVROYHURVFRQL-
NOES DE ADMINISTRAO/ GESTO DE PESSOAS/ NOES
GERENCIAMENTO DE CONFLITOS
tos de maneira que se torne aceitvel para as duas
partes. DE GESTO DE PROCESSOS/ NOES DE ARQUIVOLOGIA
2V FRQLWRV VXUJHP JHUDOPHQWH TXDQGR RFRUUH XPD
k) Organizao: refere-se capacidade de organizar quebra de contrato entre as partes envolvidas no processo,
processos, para realizar tarefas da maneira mais que criam expectativas e responsabilidades. dessa forma
HFD] TXHRVOtGHUHVVXUJHPSDUDJHUHQFLDUHVVHVFRQLWRV
No podemos deixar de perceber que, na maioria
l) Relacionamento interpessoal: capacidade de re- das vezes, os lderes de equipes sentem-se constrangidos
lacionamento entre os membros da equipe de tra- quando ocorre algum evento negativo entre seus mem-
balho para que as tarefas sejam realizadas de ma- EURV1mRSRGHPRVDUPDUTXHRVFRQLWRVVXUJHPGHXP
neira positiva e com comportamentos maduros de momento para o outro, eles podem, e normalmente ocorre
todos os membros das equipes de trabalho. dessa forma, surgir gradualmente. Nesse momento, s
existe uma opo para a liderana: enfrent-lo.
m) Tomada de deciso: a capacidade de analisar
a situao e tomar a deciso acertada de maneira 2 TXH SRGHPRV ID]HU SDUD HYLWDU TXH HVVHV FRQLWRV
que seja perspicaz e sistematizada. ocorram?

n) Viso sistmica: talvez a forma mais completa e Realizar reunies constantes com as equipes de
FRPSHWHQWHGHVHYHUDRUJDQL]DomRRXVHMDWHU trabalho, bem como com todos os membros da
uma viso sistmica, analisar a organizao como organizao.

57
Reunies de renegociao dos contratos previa-
PHQWHHVWLSXODGRVSURFXUDQGRHYLWDUTXHRVFRQL-
tos surjam de uma hora para a outra.
2IHUHFLPHQWRGRSURVVLRQDOGDiUHDGH3VLFRORJLD
de maneira que algumas caractersticas individuais
possam ser trabalhadas durante a execuo das
tarefas, evitando-se, dessa forma, o surgimento de
FRQLWRV
FLAVIO DE SOUSA

58