Anda di halaman 1dari 15

See

discussions, stats, and author profiles for this publication at: https://www.researchgate.net/publication/265384866

Semitica del dibujo infantil: una aproximacin


latinoamericana sobre la influencia de la
televisin en los nios: casos de estudios en
ciudades de Chile, El Salvador y Mxico

Article October 2008

CITATIONS READS

3 58

2 authors, including:

Csar E. Jimnez Yaez


Autonomous University of Baja California
18 PUBLICATIONS 6 CITATIONS

SEE PROFILE

All in-text references underlined in blue are linked to publications on ResearchGate, Available from: Csar E. Jimnez Yaez
letting you access and read them immediately. Retrieved on: 02 August 2016
Semitica del dibujo infantil: una aproximacin
ODWLQRDPHULFDQDVREUHODLQXHQFLDGHODWHOHYLVLyQHQ
los nios: casos de estudios en ciudades de Chile, El
Salvador y Mxico

Children Drawing Semiotics: A Latin American


DSSURDFKDERXWWKHLQXHQFHRIWHOHYLVLRQRQFKLOGUHQ
Case studies in cities of Chile, El Salvador and
Mexico.
CSAR JIMNEZ YAEZ
Universidad Autnoma de Baja California
cjimenezy@gmail.com

ROSALBA MANCINAS CHVEZ


Universidad de Sevilla
rmancinas@gmail.com

Recibido: 10 de Septiembre 2008


$SUREDGRGH2FWXEUHGH

Los dibujos de un nio son un diario de vida abierto a quien lo pueda leer (Antezana, 2003)

Resumen:
El presente trabajo de investigacin une al nio y al dibujo como una sola unidad discursiva
SDUD GDU FXHQWD GH XQ IHQyPHQR VRFLDO DFWXDO OD LQXHQFLD GH OD WHOHYLVLyQ TXH VL ELHQ HV XQ WHPD
estudiado a travs de distintas disciplinas, pero que a travs del dibujo infantil nos entrega nuevos
elementos para su anlisis y discusin. Desde esta perspectiva, medir el contenido simblico del discurso
SUHVHQWHGHOQLxRQRVD\XGDDLGHQWLFDUDWUDYpVGHVXVGLEXMRVORVHOHPHQWRVVLJQLFDWLYRVTXHOHGDQ
IRUPD\DTXpHVSDFLRGHFRQRFLPLHQWRSHUWHQHFHQ\VLpVWRVSURFHGHQGLUHFWDPHQWHGHODLQXHQFLDGH
la televisin o si pertenecen al mundo cotidiano del nio. Para realizar esta investigacin se trabaj con
QLxRVHQHGDGHVFRODUGHGLVWLQWDVFLXGDGHVGHSDtVHVGH$PpULFD/DWLQD &KLOH(O6DOYDGRU\0p[LFR 
que por medio de sus dibujos nos revelan una realidad local concreta y puntual que, al mismo tiempo,
nos entrega elementos iniciales para hacer una aproximacin latinoamericana sobre este tema.

Palabras Claves:'LEXMRLQIDQWLOVHPLyWLFDLQXHQFLDGHODWHOHYLVLyQ

Jimnez,C. y Mancinas, R. 2009: Semitica del Dibujo Infantil: una aproximacin Latinoamericana
VREUHOD,QXHQFLDGHOD7HOHYLVLyQHQORVQLxRV&DVRVGHHVWXGLRVHQFLXGDGHVGH&KLOH(O6DOYDGRU\

ISSN: 1130-0531 Arte, Individuo y Sociedad


151 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Mxico. $UWH,QGLYLGXR\6RFLHGDG

Abstract:
The current work brings the child and the drawing together as one discursive unit to present a
PRGHUQVRFLDOSKHQRPHQRQ7KHLQXHQFHRIWHOHYLVLRQDWRSLFWKDWKDVEHHQZLGHO\H[DPLQHGEHIRUH
through several disciplines, but that through the analysis of children drawings delivers new elements
of study and discussion. From this perspective, measuring the symbolic content found in the children
drawings help us to identify the meaningful elements that provide those with shape and context, what
DUHDRINQRZOHGJHWKH\EHORQJWRDQGQDOO\LIWKHVHGUDZLQJVDUHRULJLQDWHGDVDGLUHFWLQXHQFHRI
television or if they are an expression of the children daily life. This research was carried out by working
ZLWK HOHPHQWDU\ VFKRRO DJH FKLOGUHQ IURP VHYHUDO /DWLQ$PHULFDQ FRXQWULHV &KLOH (O 6DOYDGRU DQG
0H[LFR 7KHLUGUDZLQJVUHYHDOHGDFRQFUHWHORFDOUHDOLW\DQGDWWKHVDPHWLPHGHOLYHUHGEDVLFHOHPHQWV
for a close Latin American approach to this area of study.

Keywords&KLOGUHQGUDZLQJVHPLRWLFVWHOHYLVLRQLQXHQFHGLVFXUVLYHXQLWPHGLD

Jimnez,C. y Mancinas, R. 2009: Children Drawing Semiotics: A Latin American approach about
WKHLQXHQFHRIWHOHYLVLRQRQFKLOGUHQ&DVHVWXGLHVLQFLWLHVRI&KLOH(O6DOYDGRUDQG0H[LFR Arte
,QGLYLGXR\6RFLHGDG

Sumario:
1. Introduccin
2. Aspectos metodolgicos
3. El dibujo como medio de comunicacin
4. El valor del dibujo infantil
5. La televisin, el dibujo y los nios
6. El dibujo y la semitica de Barthes
7. Los Medios de Comunicacin como constructores de la Realidad Social
8. Resultados
9. Conclusiones
 5HIHUHQFLDVELEOLRJUiFDV

Introduccin:
Hablar hoy de la presencia de los medios de comunicacin como dibujante de
ORVRFLDOQRHVQXHYRTXHODSHQHWUDFLyQGHHOORVHQHVWHiPELWRKDUHFRQJXUDGRQXHVWUD
sociedad y realidad, tampoco; pero an as se sigue investigando al respecto desde distintas
disciplinas y tendencias tericas para dar explicacin y entender este complejo fenmeno
social que nos involucra a todos quienes formamos parte de la sociedad y la estudiamos.

Para esta investigacin partimos de ciertas bases que nos entregan otros estudios,
tanto de la comunicacin como de otras disciplinas. Sabemos que el nio dibuja lo que
conoce, lo que ha aprendido, lo que ha interpretado, lo que ha convertido en fantasa y que
percibe e interpreta el mundo que le rodea de manera subjetiva e individual y responde al
mismo, en funcin de sus propias actitudes, intereses, aptitudes, hbitos, deseos o estados
de nimo. Todos estos factores biolgicos, sociales, culturales y simblicos propios de cada
cultura, determinan la forma y el fondo de su discurso al momento de dibujar sobre algo. Es
aqu donde radica la riqueza del dibujo infantil como objeto de estudio para el anlisis de esta
LQYHVWLJDFLyQLQYHVWLJDFLyQTXHQRVD\XGDUiDLGHQWLFDUDQDOL]DU\UHODFLRQDUDWUDYpVGH

Arte, Individuo y Sociedad


2009, vol. 21  152
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

cada dibujo, los elementos simblicos ms frecuentes para representar una idea y cules son
las fuentes que nutren dicho sistema de representacin.

El primer gran paso de esta investigacin fue hacer visible, a travs de la imagen
JUiFD OR TXH FDGD QLxR QRV FRPXQLFD IUHQWH D XQ HVWtPXOR JXLDGR 3DUD DQDOL]DU HVWD
SURGXFFLyQ JXLDGD JUiFD GHO QLxR XWLOL]DPRV OD VHPLyWLFD FRPR KHUUDPLHQWD DQDOtWLFD
capaz de dilucidar y entender el dibujo infantil. Esta mirada desde la perspectiva semitica nos
ayud a explorar en trminos visuales el dibujo de los nios y de esta forma poder entender
ORV HOHPHQWRV XWLOL]DGRV \ HO RUGHQ FRQVWUXFFLyQ GH VHQWLGR  TXH WHQGUiQ SDUD H[SOLFDU HO
WHPD SURSXHVWR D GLEXMDU \ DVt QDOPHQWH UHYLVDU ODV SRVLEOHV UHODFLRQHV TXH WLHQHQ HVRV
HOHPHQWRVFRQODLQXHQFLDGHODWHOHYLVLyQHQORVQLxRV

El valor agregado de esta investigacin se encuentra principalmente en la diversidad


JHRJUiFDGHORVSDUWLFLSDQWHVORVFXDOHVSHUWHQHFHQDFLXGDGHVGHGLVWLQWRVSDtVHVGH$PpULFD
Latina. Nios de Chile, El Salvador y Mxico plasmaron en sus dibujos libremente sus ideas
e imgenes acerca del concepto que se les pidi dibujaran, en este caso: La Sociedad del
Futuro. Cada dibujo nos entreg bastante informacin para contrastarlos entre s, primero
buscando los elementos simblicos ms frecuentes y relevantes para luego buscar sus vnculos,
VLPLOLWXGHV VLODVKD\ HQFXHQWURV\GHVHQFXHQWURVSDUWLHQGRGHVGHXQDEDVHWHyULFDFRP~Q
como la semitica.

Aspectos metodolgicos:
Para realizar este trabajo utilizamos el mtodo de accin directa frente al mtodo de
coleccionamiento para la recoleccin de los dibujos y el mtodo de tema sugerido frente al
PpWRGROLEUH3URSRQHUDXQQLxRTXHUHDOLFHXQGLEXMRVREUHXQWHPDGHWHUPLQDGR\HVSHFtFR
QRVSULYDGHORVEHQHFLRVSXUR\OLEUHGHOGLEXMRSHURQRVVLUYHSDUDSRGHUFRPSDUDUORFRQ
RWURVTXHFRQWLHQHQXQDLQIRUPDFLyQFRP~QDGHPiVXQWHPDHVSHFtFRKDFHTXHHOQLxR
UHFXUUDDWRGRVXPDWHULDOPHQWDO YLYHQFLDVH[SHULHQFLDVUHSUHVHQWDFLRQHVLQWHUSUHWDFLRQHV
LOXVLRQHVLPDJLQDFLRQHVLPiJHQHVPHQWDOHVHWF

Cada nio realiz un solo dibujo y participaron nios de escuelas pblicas de tres
FLXGDGHVGHGLVWLQWRVSDtVHVGH$PpULFD/DWLQD &KLOH(O6DOYDGRU\0p[LFR /DVHVFXHODV
participantes fueron:
x Escuela Pblica Thoms Jefferson D- 934 Los Angeles Chile
x Escuela Primaria Rafael Ramrez Castaeda Chihuahua Mxico
x Centro Escolar Catlico Madre del Salvador Santa Ana El Salvador

La propuesta o tema a dibujar fue La Sociedad del Futuro, para lo cual se


dispuso de un saln por cada escuela para que los nios pudieran trabajar durante 2 horas
aproximadamente en la concrecin de sus dibujos. Para realizar esta actividad se les instruy
DFHUFDGHOWUDEDMR\VHOHVHQWUHJyXQDKRMDEODQFDWDPDxRFDUWD [FP OiSL]
JUDWRJRPDGHERUUDU\YDULHGDGGHOiSLFHVGHFRORUHV$OWpUPLQRGHVXGLEXMRFDGDQLxR
respondi una encuesta con tres preguntas que apuntaban bsicamente a la explicacin de sus
dibujos y a conocer la fuente de sus ideas. Por cada escuela participaron ocho nias y ocho

Arte, Individuo y Sociedad


153 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

QLxRV QLxRVHQWRWDO WRGRVGHDxRVGHHGDGFXUVDQGRVH[WRJUDGR(OHJLPRVHVWDHWDSD


porque la habilidad motriz permite la expresin de gran cantidad de contenidos mientras que
el nio sigue motivado por la experiencia plstica, motivacin que empieza a decaer con el
inicio de la preadolescencia.

Los estudios sobre el dibujo infantil hablan en esta edad de una etapa de realismo y
ODFODVLFDQGHODVLJXLHQWHPDQHUDEtapa del realismo1 HQWUHORV\ORVDxRV ORVQLxRV
EXVFDQTXHVXVGLEXMRVVHDQPiVHOHVDODUHDOLGDG\JUDFDQREMHWRVSDLVDMHV\WDPELpQ
sensaciones, buscando ya la tercera dimensin y tomando en cuenta la superposicin. A esta
edad los nios comienzan a sentirse miembros de la sociedad y del ambiente en que viven.
Es la etapa de la pandilla de amigos. Muchas veces la atencin a los detalles del dibujo va en
detrimento de la accin y las representaciones resultan estticas. Los dibujos comienzan a ser
ms detallados y comienzan a entrar en la bsqueda de la proporcionalidad, la perspectiva y el
PRYLPLHQWRH[LELOL]DQGRODVJXUDVODOtQHDGHEDVHYDGHVDSDUHFLHQGRSRUTXHVHHPSLH]D
a concebir al suelo como un plano y lo que era la lnea de cielo pasa gradualmente a ser la
lnea de horizonte.

Cada dibujo y respuestas presentaron ciertas caractersticas que nos dieron las pautas
para su anlisis. Cules son los elementos simblicos ms frecuentes para representar la idea
de sociedad y de futuro? En este caso, principalmente la idea es observar el dibujo y reconocer
qu elementos utiliza cada nio para representar el concepto de sociedad y el de futuro. Al
mismo tiempo nos interesa conocer de dnde surgen estas ideas y Cules son las fuentes que
nutren dicho sistema de representacin? En cuanto a las posibles fuentes tenemos su medio
DPELHQWHSURSLRGHVXHVSDFLRJHRJUiFRVXFXOWXUD LGLRVLQFUDVLDYLGDFRWLGLDQDUHOLJLyQ
HGXFDFLyQVLVWHPDVRFLDOPHGLRVGHFRPXQLFDFLyQ )UHQWHDHVWDVIXHQWHVTXHUHPRVFRQRFHU
Cul es el grado de importancia que tienen los medios de comunicacin como fuente de
inspiracin de los nios al dibujar?

El dibujo como medio de comunicacin.

Cada dibujo es un discurso, por el cual el nio se expresa y nos comunica algo.
'LEXMDUHVXQPHGLRSDUDDOFDQ]DUXQQXQDKHUUDPLHQWDTXHD\XGDDUHVROYHUSUREOHPDV
crear nuevas ideas y ayudar a la comunicacin. El dibujo puede ser un instrumento invaluable
en la comunicacin. El dibujo es un medio personal y emocionante de expresin. Para Moreno
 DFHUFDUVHDOGLEXMRGHORVQLxRVLPSOLFDSRQHUVHHQFRQWDFWRFRQXQDGHODVIXHQWHV
ms puras, espontneas y candorosamente sinceras de la expresin plstica. La esencia del
dibujo yace en la conciencia de que es slo un instrumento y se utiliza para comunicarse con
uno mismo y con los dems. Todo dibujo representa una abstraccin. El dibujo es un lenguaje
en tanto que maneja aquello que se percibe como real, no la realidad misma.

Dibujar es ver2.(OGLEXMRDFW~DFRPRHOUHHMRGHODPHQWHYLVXDO(QVXVXSHUFLH
podemos ensayar, probar y desarrollar el producto de nuestra muy peculiar visin. El nio
siempre dibuja para alguien, aunque ese alguien puede ser l mismo o una persona que no est
presente. El dibujo es una forma de expresar mensajes de una persona a otra. Por lo general,

Arte, Individuo y Sociedad


2009, vol. 21  154
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

de acuerdo al esquema terico clsico, la comunicacin incluye un emisor, un receptor; un


canal; un mensaje y la correspondiente retroalimentacin. En el dibujo, el emisor y el mensaje
puede ser uno solo a la vez, detalle que hace nica a la materia que tratamos en el esquema de
la comunicacin. Con frecuencia, el dibujo mismo es el emisor. El simple hecho de mirar un
GLEXMRHVVXFLHQWHSDUDUHFLELUHOPHQVDMH\HOGLEXMRHVHQVtHOPHQVDMHREVHUYDEOH

El valor del dibujo infantil.

Cada espacio y accin a las cuales el nio accede tienen ciertas limitantes, estos
espacios no le son hechos a la medida del nio, en realidad ste debe construirlos con los
PDWHULDOHVGHVXFRQVWLWXFLyQELROyJLFDVXPDGRVDORVGHVXFRQVWLWXFLyQFXOWXUDO $QWH]DQD
 (OGLEXMRFRPRXQLGDGGLVFXUVLYDQRVGDFXHQWDGHORVSURFHVRVFRJQLWLYRV\FXOWXUDOHV
a los cuales el nio recurre para ordenar y dar forma en un soporte limitante, como la hoja
del dibujo, los elementos simblicos que representarn su visin de lo que se le pide. Es
DVtTXHHVWHGLVFXUVRSLFWRJUiFRTXHSDUDFDGDQLxRWLHQH\RWRUJDXQVHQWLGRSDUWLFXODU
vendr determinado por un contexto cotidiano que impone el uso regular de ciertos elementos,
primero, propios de su cultura, segundo, propios de sus interacciones y tercero, propios de su
estructura biolgica.

El valor narrativo en el dibujo, adems de las referencias de actualidad tiene una


VLJQLFDFLyQ VLPEyOLFD 1RV PXHVWUD OD PDQHUD HQ TXH HO QLxR YLYH ODV VLJQLFDFLRQHV
VLPEyOLFDV TXH OHV DWULEX\H D WUDYpV GH ODV FRVDV 6H UHHMD HQ VX GLEXMR HO FRQMXQWR GH
su mundo imaginario. Lo que no puede decirnos de sus sueos, de sus emociones en las
VLWXDFLRQHVFRQFUHWDVQRVORLQGLFDSRUVXGLEXMR $QWH]DQD 

Se ha escrito mucho sobre el dibujo infantil, pero con frecuencia se han olvidado o
despreciado algunos de sus aspectos ms importantes. Encontramos distintos trabajos sobre el
dibujo infantil a partir de los anlisis de pedagogos, psiclogos o terapeutas como medios de
GHVDUUROORPHGLRVGHH[SUHVLyQGHVHQWLPLHQWRVRFRPRPHGLRVGHHODERUDFLyQGHFRQLFWRV
Dentro del campo pedaggico se ha puesto excesivo nfasis en su valor de desarrollo del
sentido esttico, de la motricidad o de la inteligencia. La escuela, por tradicin, se ha ocupado
casi exclusivamente de ensear a dibujar y se ha olvidado de ensear por medio del dibujo
GLEXMDQGR  6DOYDGRU 

Para los pedagogos los aspectos de inteligencia y motricidad son los ms relevantes
al momento de considerar al dibujo como instrumento de medida. En el caso de los psiclogos,
stos centran su atencin en el dibujo por su riqueza como instrumento para el psicodiagnstico
\RFRPRPHGLRGHH[SUHVLyQGHVHQWLPLHQWRV YDORUSUR\HFWLYR 3DUD6DOYDGRU  SRU
medio del dibujo el nio juega, pero juega partiendo de cero, creando l los personajes y el
ambiente, no necesita transformar nada, busca en su interior y lo plasma en el papel. El dibujo
como tcnica proyectiva, pide al sujeto que dibuje una persona, una familia, una casa, un
iUEROXQDQLPDOSHURQXQFDGHWHUPLQDDSULRULTXpWLSRGHSHUVRQDKDGHGLEXMDU4XHGDDOD
HOHFFLyQGHOVXMHWRODHGDGVH[RWDPDxRFDUDFWHUtVWLFDVIRUPDOHV\HVWUXFWXUDOHVGHODJXUD
humana. De manera que, entre la enorme cantidad de personas que conoce, seleccionar
y dar como respuesta su persona que ser una proyeccin de su imagen corporal y del
Arte, Individuo y Sociedad
155 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

concepto que tiene de s mismo. De la misma manera, el dibujar la casa o l rbol dar como
resultado su imagen de casa o su imagen de rbol, que sern nicos como nico es el
VXMHWR 6DOYDGRU 

La expresin plstica, dentro del lenguaje visual, est vinculada a las distintas etapas
por las que atraviesa el individuo y que, pese a estar sometida a unos cnones predeterminados,
GHYHODQXQDSHUFHSFLyQVXEMHWLYDGHVXHQWRUQRXQDDFWLWXGHQGHQLWLYDXQDHVSHFLDOIRUPD
GHVHU 0RUHQR 

La televisin, el dibujo y los nios.

Los nios entre 4 y 12 aos de edad pasan ms de 900 horas al ao frente al televisor,
FDQWLGDGGHKRUDVVLPLODUDODVTXHSDVDQHQODHVFXHOD &RURQD&$&3 /RVQLxRV
ven ms televisin que los adultos y la consumen desde el principio de su vida consciente, en
XQDpSRFDGHIRUPDFLyQItVLFDGHVDUUROORPHQWDO\FUHDFLyQGHKiELWRV\DFWLWXGHV $ORQVR
9i]TXH]\0DWLOOD 
 3DUD&RURQD  ODPD\RUtDGHORVHVWXGLRVVREUHQLxRV\PHGLRVGHFRPXQLFDFLyQ
se ocupan principalmente del papel del nio como receptor-consumidor de los mensajes que se
le ofrecen. Si bien es cierto, una de las forma de aprender del nio es viendo, es haciendo como
se forma. La televidencia puede convertirse en una actividad creativa si sabemos aprovechar
una expresin infantil transformadora como el juego o el dibujo.

Cuando nuestro imaginario colectivo proviene de la televisin son otros los que
deciden qu debemos saber y qu debemos ignorar. El lenguaje audiovisual de la televisin
es parte integrante de los procesos de desarrollo cognoscitivo del nio y lo acompaa en
su crecimiento; expuestos al medio desde edades muy tempranas sus colores, luces, formas,
palabras, sonidos y movimientos percibidos, contribuyen a su estimulacin y son parte de la
educacin cultural del nio. As se inicia un aprendizaje de la cultura audiovisual caracterstica
de nuestra poca, en la que la programacin televisiva, est formando nuevas generaciones de
UHFHSWRUHV 0DUWtQH] 

 3DUD$ORQVR\RWURV  HVWHPRGHORGHWHOHYLVLyQHVHOSULQFLSDODJHQWHIRUPDGRU


de la cultura del nio. El nio que nunca vea el televisor gozaba de una autonoma que el
aparato arrebata hoy a sus descendientes. Esta prdida de autonoma del nio adquiere su
mximo exponente en la continua recepcin de mensajes estticos-culturales, de los cuales
no slo es receptor pasivo, sino a menudo tambin inconsciente y, desde luego, involuntario.
$WUDYpVGHODMDFLyQGHOQLxRDQWHHOWHOHYLVRUDWUDYpVGHVXDGLFFLyQDOHVTXHPDQDUUDWLYR
dominante, la televisin destruye radicalmente toda posibilidad de reproduccin de la vieja
cultura infantil, a la vez que destruye la capacidad misma de mantener un espacio infantil
autnomo, desde el cual los nios puedan construir creadoramente cualquier otra cultura al
PDUJHQGHODFXOWXUDGHOFRQVXPRTXHHOWHOHYLVRUOHVKDLQVWDODGR $ORQVR9i]TXH]\0DWLOOD
 

Arte, Individuo y Sociedad


2009, vol. 21  156
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Para Mara Acaso, est claro que los nios y nias construyen su identidad y su realidad a
SDUWLUGHHVDKLSHUUHDOLGDG FRQMXQWRGHLPiJHQHVIRUPDGDSRUODSXEOLFLGDGORVSURGXFWRVGH
HQWUHWHQLPLHQWR\TXHOOHJDDQRVRWURVDWUDYpVGHORVPHGLRV TXHORVURGHDPDVUHDOVLFDEH
que la realidad misma, donde los personajes mediados estn mas presentes que sus propias
familias y donde no hay distincin entre las representaciones bidimensionales y la realidad
WULGLPHQVLRQDO$SDUWLUGHDTXtORVQLxRVDSUHQGHQDFRQDUHQODVLPiJHQHVDFRQVLGHUDUODV
documentos en vez de construcciones, algo que siguen creyendo cuando son adultos. Vivimos
HQXQPXQGRHQHOTXHORYLUWXDOWLHQHPiVSUHVHQFLDTXHORUHDO $FDVR 

El dibujo y la semitica de Barthes.

Sabemos que la mayora de las imgenes no representan prioritariamente el detalle


GHODPDWHULDOLGDGGHORVREMHWRVVLQRDQWHWRGRHOVLJQLFDGRFXOWXUDOGHpVWRV(OGLEXMR
FRQWLHQHHOHPHQWRVTXHSRGHPRVLGHQWLFDUWLHQHQXQRUGHQOyJLFRSDUDTXLHQGLEXMD\TXL]iV
tambin para el observador; el dibujante quiere, al poner esos elementos ah, formar un todo,
XQWRGRFRQVHQWLGRXQWRGRTXHVLJQLFDUiDOJRXQDOJRTXHWHQGUiTXL]iVSDUDORV
observadores, un nuevo sentido. A esto llamamos denotacin y connotacin.

 (OGLEXMRSUR\HFWDXQVLJQLFDGR\QRVRIUHFHXQDLQWHUSUHWDFLyQXQDFRQVWUXFFLyQ
FUHDWLYD GHO VLJQLFDGR SRVLEOH 3DUD HQWHQGHU HO GLEXMR LQIDQWLO %DUWKHV QRV SURSRQH WUHV
PHQVDMHVSDUDHODQiOLVLVXQPHQVDMHOLQJtVWLFR\GRVOHQJXDMHVLFyQLFRV/DLPDJHQOLWHUDO
es la denotada y la imagen simblica es la connotada. Gracias a esta estructura podemos
H[SOLFDU \ H[SUHVDU OR TXH FDGD GLEXMR UHSUHVHQWD \ UHWUDWD 3DUD %DUWKHV   HO GLEXMR
FRPRPHQVDMHGHQRWDGRHVXQPHQVDMHFRGLFDGR(OFDUiFWHUFRGLFDGRGHOGLEXMRDSDUHFH
en tres niveles: en primer lugar, reproducir mediante el dibujo un objeto o una escena, exige
XQFRQMXQWRGHWUDQVSRVLFLRQHVUHJXODGDV\ORVFyGLJRVGHWUDQVSRVLFLyQVRQKLVWyULFRV VREUH
WRGRHQORUHIHUHQWHDODSHUVSHFWLYD HQVHJXQGROXJDUODRSHUDFLyQGHOGLEXMR ODFRGLFDFLyQ 
H[LJHGHLQPHGLDWRXQDFLHUWDGLYLVLyQHQWUHORVVLJQLFDQWH\ORLQVLJQLFDQWHHOGLEXMRQR
reproduce todo, sino a menudo, muy pocas cosas, sin dejar por ello de ser un mensaje fuerte.
/DGHQRWDFLyQGHOGLEXMRHVPHQRVSXUDTXHODGHQRWDFLyQIRWRJUiFDSXHVQXQFDKD\GLEXMR
sin estilo. En tercer lugar, como en todos los cdigos, el dibujo exige un aprendizaje.

Los Medios de Comunicacin como constructores de la Realidad Social.

Los medios de comunicacin no slo aportan informacin sino tambin proporcionan


una construccin selectiva del conocimiento de la sociedad, sealando lo que es importante
y trivial mediante lo que dice o muestra, o lo que omite, silencian u ignoran. Los medios
pretenden incidir en las estructuras bsicas de relevancia y lo hacen. Por lo que para un auditor/
lector cobra especial importancia ser debido a la capacidad de los medios para mostrar los
DFRQWHFLPLHQWRVFRPRDXWpQWLFRV\QDWXUDOHV 5DPRV 

 3DUD%HUJHU\/XFNPDQQ  ODEDVHGHQXHVWUDFRPXQLFDFLyQLQGLYLGXDOFRPR


seres sociales, est en la interaccin constante con nuestro entorno, tenemos pues que la
LQWHUDFFLyQGLDULDGHQLGDFRPRXQSURFHVRLQWHUSUHWDWLYRGHOPXQGRWLHQHFRPRUHVXOWDGR
Arte, Individuo y Sociedad
157 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

lgico una interpretacin subjetiva del mundo, este mundo es la realidad, entendida esta ltima
como fenmeno externo al individuo, preexistente a l. De acuerdo a esto, toda la realidad,
nos dicen estos autores, queda abarcada por el alcance conceptual del universo simblico
vigente. As el individuo crea imgenes, percepciones y representaciones construidas a partir
de fenmenos objetivos concretos y reconocidos por otros.

Los medios de comunicacin como instituciones legitimadas y con un alto grado


GHFUHGLELOLGDGSURGXFHQVLJQLFDGRVTXHVHJUDYDQSRGHURVDPHQWHHLQGHOHEOHPHQWHHQOD
FRQFLHQFLD\VHFRQVWLWX\HQFRPRFRQRFLPLHQWRTXHVHUHDUPDHQWRGRHOHQWUDEDGRVLPEyOLFR
de la cultura. Su lenguaje altamente especializado en el universo icnico-simblico produce
LQWHQVDVLGHQWLFDFLRQHVGHO\RFRQODVWLSLFDFLRQHVGHODVDFFLRQHVTXHPXHVWUDQ/RVPHGLRV
de comunicacin crean roles de comportamiento que tienen la funcin de mediadores entre
VHFWRUHVHVSHFtFRVGHOF~PXORGHOFRQRFLPLHQWRQRVyORHQHOVHQWLGRFRJQRVFLWLYRVLQR
WDPELpQHQHOFRQRFLPLHQWRGHQRUPDVGHFRQGXFWDYDORUHV\HPRFLRQHV 5DPRV 

Es as como los medios de comunicacin construyen lo real, seleccionando aspectos


GHOPXQGRTXHDSDUHFHQOWUDGRVDQWHQXHVWURVVHQWLGRV(OFRQRFLPLHQWRTXHSURSRUFLRQDQ
pone en juego nuestras capacidades cognitivas, si no que tambin emocionales: Ante ellos
VH UtH VH OORUD \ WRGR HVWR JHQHUD FLUFXQVWDQFLDV TXH IDYRUHFHQ QXHVWUD LGHQWLFDFLyQ FRQ
VXGLVFXUVRDSURSLiQGRVHGHHVWHPRGRGHORVVLJQLFDQWHVTXHH[SRQHQDODVSHUVRQDVHQ
XQDGLDOpFWLFDHQWUHODDXWRLGHQWLFDFLyQ\ODLGHQWLFDFLyQTXHORVPHGLRVKDFHQGHHOORV
'HODPLVPDPDQHUDRSHUDQFRQODVVLJQLFDFLRQHVGHVHQWLGRVRFLDO\ODUHDOLGDGHQHOODV
HVWDEOHFLGDV(VDVtFRPRORVVLJQLFDGRVPHGLiWLFRVFULVWDOL]DQHQQXHVWURLQWHULRUODUHDOLGDG
REMHWLYDGDHQVXOHQJXDMH\ODWUDGXFHQHQQXHVWUDUHDOLGDGVXEMHWLYD(VWDUHDOLGDGHVUHDUPDGD
en los otros, que al estar, a su vez, inmersos en el consumo de informacin entregada por
los medios de comunicacin, acentan a modo de coro reforzndola. Es evidente que los
PHGLRVQRGHQHQODQDWXUDOH]DGHOPXQGRVLQRTXHDFW~DQVREUHXQWUDVIRQGR\DHVWDEOHFLGR
\SODXVLEOH&RQGLFLyQSDUDTXHODLQWHULRUL]DFLyQGHVXVVLJQLFDGRVVHDHIHFWLYD 5DPRV
 

Resultados.

 'HQLWLYDPHQWH OD ULTXH]D GH HVWH WUDEDMR TXHGD DYDODGD SRU OD JUDQ FDQWLGDG GH
informacin que nos entreg cada nio con su particular mirada a travs de sus dibujos de
la Sociedad del Futuro. A continuacin les presentamos algunos resultados. Ante la pregunta
'HGyQGHVDFDVODVLGHDVDFHUFDGHOIXWXUR"(QTXpWHEDVDV"'HORVQLxRV PXMHUHV
\KRPEUHV REWXYLPRVUHVSXHVWDVGRQGHODPD\RUtDGHORVQLxRV  GLRGRVODV
principales fueron:

'HORVGDWRVUHFRJLGRVSRUODHQFXHVWDPiVGHODPLWDGGHORVQLxRVDUPDVDFDUVXV
ideas de su cabeza o mente como ellos sealan, haciendo alusin directa a su imaginacin
RSHQVDPLHQWRV8QGDWRLPSRUWDQWH\VLJQLFDWLYRSDUDHVWDLQYHVWLJDFLyQHVTXHXQ
de ellos reconoce que su fuente de ideas son las pelculas y la televisin. Al mismo tiempo
muchos de ellos advierten que sus ideas nacen desde lo que viven hoy, en su presente, como
lo es la actualidad y los avances tecnolgicos.
Arte, Individuo y Sociedad
2009, vol. 21  158
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Cuadro N 1: Fuentes o Bases de Ideas acerca del Futuro

CANTIDAD PAISES
FUENTE MUJERES HOMBRES TOTAL % SALVADOR MEXICO CHILE TOTAL

Imaginacin o Pensamiento 14 13 27 56.3% 12 7 8 27


Pelculas 8 7 15 31.3% 2 6 7 15
Avances Tecnolgicos 6 8 14 29.2% 4 7 3 14
Actualidad 10 3 13 27.1% 7 5 1 13
Televisn 2 5 7 14.6% 3 4 7
Libros o Revistas 3 3 6.3% 2 1 3
Naturaleza 2 1 3 6.3% 3 3
Contaminacin 3 3 6.3% 3 3
Vivencias 1 1 2 4.2% 1 1 2

Fuente: Elaboracin Propia 2008


Corazn 2 2 4.2% 1 1 2
Evolucin 1 1 2.1% 1 1
Clases 1 1 2.1% 1 1
Inventos 1 1 2.1% 1 1
Destruccin 1 1 2.1% 1 1
Cambios 1 1 2.1% 1 1
Totales 48 46 30 32 32
Nota: La participacin fue de 48 nios donde el 98% de ellos dio dos respuestas (dos hombres dieron una sola respuesta); es
decir, por gnero obtuvimos 94 respuestas y por pas, en Mxico y Chile obtuvimos 32 y de El Salvador obtuvimos 30.

+DFLHQGR HO DQiOLVLV GH ORV GLEXMRV HQFRQWUDPRV TXH HQ FHUFD GHO  GH ORV GLEXMRV ORV
elementos simblicos ms importantes para representar la idea de SociedadVRQFDVDVHGLFLRV
FDOOHVDXWRVSDUTXHV\SHUVRQDV PX\SRFRV FRPRHOHPHQWRSULQFLSDOGHODVRFLHGDG3DUD
representar la idea de Futuro, la mayora de los dibujos se basa en la tecnologa, construcciones
ovaladas, vehculos voladores, aparatos de tecnologa avanzada y la interaccin con seres
extraterrestres. Por ciudad la idea de futuro es distinta.

Al analizar cada dibujo y reconocer sus elementos que le dan forma y sentido podemos
connotar cules son los temas ms importantes para ellos en torno a esta idea de La Sociedad
del Futuro. Algunos de estos temas importantes tienen relacin con su calidad de vida y desde
sa visin la preocupacin por el medio ambiente y la naturaleza, la seguridad, los avances
tecnolgicos y en menos grado la poltica.

Arte, Individuo y Sociedad


159 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Diana Armendriz Mara Martnez Jovanka Barrientos


(Chihuahua) (Santa Anta) (Los ngeles)

Dibujos relacionados al cuidado del Medio Ambiente y Naturaleza

Andrea Gonzalez *HUDOGLQH9HJD &pVDU2UDQWHV


(Chihuahua) (Los ngeles) (Santa Ana)

Dibujos relacionados con la Seguridad

Ima Turcios Luca Garca Constanza Flores


(Santa Anta) (Santa Ana) (Los ngeles)

Dibujos relacionados con Avances Tecnolgicos

Andrea Gonzalez *HUDOGLQH9HJD &pVDU2UDQWHV


(Chihuahua) (Los ngeles) (Santa Ana)

Arte, Individuo y Sociedad


2009, vol. 21  160
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Dibujos relacionados a la Poltica

Denisse Bauelos Noe de Len


(Chihuahua) (Santa Anta)

Por cada ciudad, y pas en este caso, las representaciones de los nios sobre la Sociedad del
Futuro se pueden agrupar en tres grandes ideas ya que contienen elementos comunes y se
UHLWHUDQDOJXQDVLPiJHQHV(QORVQLxRVGH&KLOHHO&RQLFWRHQWUH$OLHQtJHQDV\7HUUHVWUHV
es lo ms dibujado; en Mxico la idea de Ciudades Tecnolgicas o Futuristas es la ms
representada y en El Salvador el tema de Ciudades Ambientales o Ciudades y Naturaleza
predomina.

Chile (Los ngeles):&RQLFWRHQWUH$OLHQtJHQDV\7HUUHVWUHV

Mauricio Robles Lizardo Cayupa

Mxico (Chihuahua): Ciudades Tecnolgicas o Futuristas

Karen Ponce Luisa Madrid Myriam Carbajal

Arte, Individuo y Sociedad


161 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

El Salvador (Santa Ana): Ciudades Ambientales o Ciudades y Naturaleza

Hugo Escalante Mara Bernal Lus Chacn

Conclusiones.

No cabe duda que el dibujo infantil como herramienta de estudio es muy importante
y valioso. La cantidad de informacin que nos entrega y las mltiples posibilidades de anlisis
hacen de l el soporte ideal para trabajar y conocer el mundo interno y externo del nio
DFWLWXGHVLQWHUHVHVDSWLWXGHVDSUHQGL]DMHVUHODFLRQHVKiELWRVGHVHRVRHVWDGRVGHiQLPR
HWF TXHFRPRELHQVDEHPRVHVDIHFWDGRWDQWRSRUIDFWRUHVELROyJLFRVVRFLDOHV\FXOWXUDOHV
que determinan la forma y el fondo de su discurso al momento de dibujar sobre algo.

 3DUWLPRV FRQ DOJXQDV KLSyWHVLV HQ UHODFLyQ D OD LQXHQFLD GH OD WHOHYLVLyQ HQ OD
FRQVWUXFFLyQGHOGLVFXUVRGHOQLxRIUHQWHDDOJXQRVWHPDVFRQRFHUORVHOHPHQWRVVLJQLFDWLYRV
para l que sirven para representarlos y las fuentes que nutren dicho sistema de representacin,
fue el norte de esta investigacin.

Luego del anlisis de los dibujos y la comparacin entre ellos obtuvimos ms de


algn resultado que, por decir lo menos, nos llam la atencin. Si bien la televisin est
presente como fuente de imgenes e ideas en el nio, no es la ms importante. El hecho de
TXH OD PD\RUtD GH ORV QLxRV GLEXMDUD FDVDV FDOOHV DXWRV HGLFLRV QDWXUDOH]D \ SHUVRQDV
para representar la idea de sociedad nos habla de que el sistema educativo est cumpliendo
VX IXQFLyQ 4XH SDUD UHSUHVHQWDU OD LGHD GH IXWXUR GLEXMDUDQ DSDUDWRV WHFQROyJLFRV DXWRV
volares, construcciones ovaladas y casas en el espacio es que las imgenes televisivas son
casi su nica fuente de nutricin en este tema. Al mismo tiempo, la preocupacin por el medio
ambiente, por la seguridad social y la poltica nos indica que el nio de 11 aos se mueve en
WRGRVORViPELWRVTXHOHHVSHUPLWLGRVXHVSDFLRSHUVRQDO DVSHFWRSVLFROyJLFR \HOHVSDFLR
VRFLRFXOWXUDO TXH HQ HVWH FDVR HV GLIHUHQWH GH XQD FLXGDG D RWUD 3HUR Vt SRGHPRV DUPDU
TXHVXFRQWH[WR VXYLGDFRWLGLDQD IRUPDSDUWHLPSRUWDQWHGHVXVYLGDV\TXHSRUORWDQWR
les preocupa y estn pendientes de las cosas que les atae y que no le son ajenas, que viven
cercanos a su realidad y que no le es indiferente. Es importante sealar que con respecto a la
idea de futuro los nios construyen esta nocin desde sus caractersticas presentes haciendo
un ejercicio de proyeccin en el tiempo, es decir, recurren a su conocimiento actual de las
cosas y las proyectan, generando una idea sobre un posible futuro.

Arte, Individuo y Sociedad


2009, vol. 21  162
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

La posibilidad de haber desarrollado el mismo trabajo con nios de diferentes


nacionalidades y realidades locales puntuales nos hizo ampliar la mirada y dejar atrs algunas
generalizaciones que muchas veces, sin darnos cuenta, hacemos. La diversidad cultural qued
UHHMDGDHQORVGLEXMRV GHMDURQVXPDUFD \QRVHQWUHJyXQDULTXH]DGHLQIRUPDFLyQDOD
cual muy pocas veces tenemos acceso. Los nios nos mostraron que si bien hay elementos
comunes en sus discursos, producto de una identidad latinoamericana compartida y de los
efectos de la globalizacin, pero que an as permanecen diferencias culturales y sociales de
forma y de fondo. Sus preocupaciones o sus vidas, son distintas.

Si bien se hace necesario seguir investigando en torno a este tema, no debemos


olvidar que el dibujo infantil, como medio de comunicacin, tiene un riqueza invaluable y
TXH HQWUHJD PXFKD PiV LQIRUPDFLyQ VLJQLFDWLYD TXH YD PiV DOOi GH VX XWLOL]DFLyQ HQ ORV
tradicionales anlisis pedaggicos y psicolgicos.

Un tema importante respecto a esto y que debemos tener muy presente es que debido
a los avances tecnolgicos y a la presencia cada ms fuerte de los medios de comunicacin
en nuestra vida cotidiana hace que no slo los nios miren, interacten y construyan su vida
en torno a lo que ven, leen o escuchan. Este nuevo escenario nos indica que debemos poner
ms atencin a estas situaciones y que en vez de demonizarlas debemos saber encaminarlas
para que el nio las convierta en un modo de aprendizaje que le sirva para adquirir nuevas
competencias y destrezas que le ayuden a construir su mundo.

Bibliografa

$FDVR/ySH]%RVFK0DUtD/D,QXHQFLDGHORVPHGLRVGHFRPXQLFDFLyQGHPDVDV
en el dibujo infantil en la Comunidad de Madrid. GIMUPAI, Grupo de Investigacin del
Museo Pedaggico de Arte Infantil, Universidad Complutense de Madrid. En http://www.
ucm.es/info/mupai/macaso.htm
Acaso, Mara; Fernndez, Mara y Avila, Noem. 2002. La representacin de lo bueno y lo
PDORHQHOGLEXMRLQIDQWLOXQHVWXGLRLFRQRJUiFR5HYLVWD$UWH,QGLYLGXR\6RFLHGDG
1H[WUD1
En http://www.ucm.es/BUCM/revistas/bba/11315598/articulos/ARIS0202110195A.PDF

Alonso, Manuel; Vzquez, Miguel y Matilla, Luis. 1981. Los telenios. Barcelona. Editorial
Laia.
Antezana Barrios, Lorena. 2001. Dibujo Infantil: Una Escritura del Cuerpo. Universidad de
Chile, Facultad de Ciencias Sociales. Santiago, Chile: Tesis de Magster dirigida por el Dr.
Rafael del Villar en el ao 2001. Indita.
Antezana Barrios, Lorena. 2003. Primeros trazos infantiles: Una aproximacin al
LQFRQVFLHQWH5HYLVWDHOHFWUyQLFD&RPXQLFDFLyQ\0HGLRV1
En http://www.icei.uchile.cl/comunicacionymedios/14lantezana.html
Barthes, Roland. Retrica de la imagen. En La semiologa. 1974. Buenos Aires, Tiempo
Contemporneo, pp. 127-140.

Arte, Individuo y Sociedad


163 2009, vol. 21 
Csar Jimnez y Rosalba Mancinas Semitica del dibujo infantil...

Barthes, Roland.1990. La Aventura Semiolgica. Barcelona. Editorial Paids.


Corona, Sarah. 1990. El genio en la botella (un uso activo de la televisin). Mxico. Editorial
Jus.
Corona, Sarah. 1989. Televisin y juego infantil: Un encuentro cercano. Mxico. Editorial
Universidad Autnoma Metropolitana, Unidad Xochimilco .
Jimnez, Csar y Muoz, Jorge. 2007. Estructura de los medios de comunicacin en
Chile: Lineamientos para una estrategia de comunicacin que apoyen los procesos de
descentralizacin y regionalizacin. Universidad de La Frontera. Temuco, Chile: Tesis de
Licenciatura dirigida por el Dr. Carlos del Valle Rojas, el 4 enero de 2007. Indita.
.XUW +DQNV \ %HOOLVWRQ /DUU\  El Dibujo: La imagen como medio de comunicacin.
Mxico. Editorial Trillas.
Martnez Zarandona, Irene. 1996. La televisin infantil en Mxico: aproximaciones al estudio
GHVXOHQJXDMHDXGLRYLVXDO5HYLVWD7HFQRORJtD\&RPXQLFDFLyQ(GXFDWLYDV1HQHUR
junio 1996.
En http://investigacion.ilce.edu.mx/panel_control/doc/tecycomeduno26.pdf
Moreno Sez, M del Carmen. 2002. Imagen espacial proxmica de los nios de 5, 7, 10 y 13-
DxRVVHJ~QVXVGLEXMRV5HYLVWD$UWH,QGLYLGXR\6RFLHGDG1H[WUD1
En http://www.ucm.es/BUCM/revistas/bba/11315598/articulos/ARIS0202110205A.PDF
Ramos, Celina. 1995. Los medios de comunicacin, constructores de lo real. Revista
&RPXQLFDU1RFWXEUHSS
En http://redalyc.uaemex.mx/redalyc/pdf/158/15800520.pdf
Salvador Alcaide, Ana. 2001. Conocer al nio a travs del dibujo0p[LFR$OID2PHJD*UXSR
Editor.

AGRADECIMIENTOS.

- Licenciada Ana Elsa Godoy de Gonzlez, Santa Ana, El Salvador.


- Direccin de la Escuela Pblica Thoms Jefferson D- 934 Los Angeles Chile
- Direccin de la Escuela Primaria Rafael Ramrez Castaeda Chihuahua Mxico
- Direccin del Centro Escolar Catlico Madre del Salvador Santa Ana El Salvador

Citas.

1.- Respecto a las etapas del dibujo infantil consultar en Salvador Alcaide, Ana. 2001. Conocer
DOQLxRDWUDYpVGHOGLEXMR0p[LFR$OID2PHJD(GLWRULDO\HQKWWSHOGLEXMRLQIDQWLOEORJVSRW
com/2006/03/etapas-del-dibujo-en-el-nio_29.html -http://www.planetamama.com.ar/view_
nota.php?id_nota=12190&id_etapa=36&id_tema=93
.XUW+DQNV\%HOOLVWRQ/DUU\(O'LEXMR/DLPDJHQFRPRPHGLRGHFRPXQLFDFLyQ
Mxico. Editorial Trillas.
&RQVHMR$XGLRYLVXDOGH&DWDOXxD &$& /LEUR%ODQFR/DHGXFDFLyQHQHOHQWRUQR
DXGLRYLVXDO4XDGHUQVGHO&$&1H[WUDRUGLQDULRQRYLHPEUH
En http://www.consejoaudiovisualdenavarra.es/publicaciones/documents/libroblancoCAC.pdf

Arte, Individuo y Sociedad


2009, vol. 21  164