Anda di halaman 1dari 32

PENGARUHSEQUENTIALINFORMASIDANKEPRIBADIAN

TERHADAPINVESTORKEPERCAYAANREVISI(ANSTUDI
EKSPERIMENDALAMPENGAMBILANKEPUTUSAN)
AbdulHamidHabbe(FakultasEkonomidanBisnis/UniversitasHasanuddin/Indonesia/
62411587218ext.583851/hamidhabbe@fe.unhas.ac.id)
HenniMande(JurusanAkuntansi/STIEPancaBhaktiPalu/Indonesia/
+62451421303/hennimande@ymail.com)
ABSTRAKpenelitianinimengujibahwa(1)adaefekrecencypadarevisikeyakinaninvestor
dariinformasicampuranyangdisajikansecaraberurutan,(2)adaefekpenahanpadarevisi
keyakinaninvestordariinformasicampuranyangdisajikansecaraberurutan,dan(3)ada
interaksiantaraurutaninformasidantoleransikepribadianambiguitasdalammempengaruhi
keyakinanrevisiinvestor.Teoripenyesuaiankeyakinandigunakansebagaikerangkautamadari
penelitianini.Metodeeksperimen2x2antarasubjekyangdigunakandalampenelitianinidan
subjekyangdigunakanadalah75mahasiswapascasarjanaUniversitasHasanuddin(UNHAS)
jurusanakuntansi.HipotesisdiujidenganmenggunakanIndependentSamplettest,Kruskal
Wallis,ujiANOVA.Hasilpenelitianmenunjukkanbahwaadaefekkebaruandanefekpenahan
padarevisikeyakinaninvestordariinformasicampuranyangdisajikansecaraberurutan.
Sementaraitu,tidakadainteraksiantarainformasiurutandantoleransikepribadianambiguitas
padarevisikeyakinaninvestor.Penelitianinimemberikanperhatiankepadamanajemen
perusahaanuntukmempertimbangkanurutanpenyajianinformasikarenaurutanpresentasibisa
samapentingnyadenganisiinformasiyangdisajikankepadainvestor.Jikainformasiyang
disajikansecaraberurutandancampuran,manajemenperusahaanharusmenyajikaninformasi
dalaminformasinegatifawaldaninformasipositifdibagianterakhir.Manajemenperusahaan
dapatmempertimbangkanurutanpenyajianinformasisebagaialatstrategisdalam
mengkomunikasikanperencanaanmanajemenuntukberbagaipemegangsaham.Investorharus
menyadaribahwapersepsimerekabisadipengaruhiolehstrategiperusahaanuntukmenyajikan
informasi.Kesadaranpengaruhurutandanbagaimanafaktorfaktorurutantersebutbisa
mempengaruhiprosesrevisikeyakinanseseorangmemungkinkaninvestoruntuklebihberhati
hatidalammenilaiinformasiyangdisajikanperusahaan.
Katakunci:TeoriKepercayaanpenyesuaian,efekkebaruan,efekpenahan,campuraninformasi
dan
kepribadianambiguitastoleransi.
1.PENDAHULUANTeorikeyakinanpenyesuaianyangdiusulkanolehHogarthdanEinhorn
(1992)menunjukkanperilakureaksiindividuuntukurutandanwaktuinformasiduaperbedaan.
Teoriinimemprediksibahwaketikaduaiteminformasiyangtersediamemilikibiayayang
berbeda(informasiyangcampuran),yaitudikonfirmasibelumdikonfirmasiataubaikberita
beritaburuk(+/),dandisajikansecaraberurutan,individucenderunguntukmelakukanrevisi
keyakinanawaldalammembuatkeputusan.HogarthdanEinhorn(1992)menemukanbahwa
dalamkeadaantertentuindividucenderungpembobotaninformasisaatinilebihpentingdaripada
informasisebelumnya,ataudengankatalaintersebut.
Vol 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

150
efekkebaruanterjadi.Efekkebaruanmenyebabkanseseorangcenderungmengambilkeputusan
yangbias;karenakeputusanitudidasarkanpadainformasiterbaruyangditerimatidakpada
substansiinformasiitusendiri.Efekkebaruanmenggambarkanhasilakhirdarireaksiinvestor
untukmerevisikeyakinanmerekatetapiefekkebaruantidakmenjelaskanmengapainvestor
melakukanrevisikeyakinan.Efekanchoringdapatmemberikanpenjelasanmengapainvestor
melakukanrevisikeyakinan.EfekAnchoringmenjelaskanmengapainvestormerevisi
keyakinannyasesuaidenganprediksiefekkebaruan.Berdasarkanteorikepercayaan
penyesuaian,faktorfaktoryangmenyebabkanefekkebaruanadalahjangkar.Jangkaradalah
keyakinanawal.Teorimengatakanbahwajangkarbesar(kecil)akanmenurun(meningkat)
karenainformasinegatif(positif)dibandingkandenganjangkarkecil(besar).Efekkabupatendan
efekpenahanmerupakanbagiandariefekdariurutandiprediksiakanterjadidalamprosesrevisi
keyakinanataupenilaianyangdibuatolehinvestorjikainformasitersebutdisajikansecara
berurutandanmerupakancampuran(negatifdanpositif).Berdasarkanilmupsikologi,perbedaan
psikologisindividuakanmempengaruhipengolahaninformasimanusia.Adaduadimensiyang
membedakanindividudalampengolahaninformasiyangdimensigayadankepribadiankognitif
dimensi(Pratt1980NasutiondanSupriyadi2007).Berdasarkanlatarbelakangdiatas,penelitian
inibertujuanuntukmengetahuipengaruhurutaninformasi(efekkebaruandanefekanchoring)
daninteraksiantarakepribadiandenganinformasiurutanpadarevisikeyakinaninvestordalam
penyajianinformasisecaraberurutandancampuran.Psikologiindividu,dimensikepribadian
menggunakantoleransiuntukambiguitassebagaiindikator(diadopsidariMac.Donald,1970).
PenelitianinimerupakanpenelitianeksperimentalyangmereplikasipenelitianNasutiondan
Supriyadi(2007)danAlvia(2009).NasutiondanSupriyadi(2007)menggunakanurutanbukti
sebagaivariabelindependen,gayakognitifdankepribadiansebagaivariabelmoderator,dalam
pengaturanaudit.Alvia(2009)menggunakanurutanbuktisebagaivariabelindependen,gaya
kognitifsebagaivariabelmoderator,dalampengaturanpasarmodal.Penelitianinimenggunakan
urutanbuktisebagaivariabelindependen,kepribadiansebagaivariabelmoderator,dalam
pengaturanpasarmodal.Selainpenggunaanvariabelmoderatordanpasarmodalpengaturan,hal
lainmenjadiperbedaanpenelitianinidenganpenelitiansebelumnyaadalahpenggunaanKruskal
WallisTestsebagaialatanalisis.UjiKruskalWallisadalahalatanalisisuntukstudinon
parametrik.UjiKruskalWallisdigunakanuntukmemecahkanmasalahyangmungkindaridata
yangtidaknormal(tidakterdistribusinormal)atauasumsiasumsistatistikparametriklainnya
yangseringterjadipadasampelkecilpenelitianeksperimental.
2.TINJAUANPUSTAKA2.1.EfekkebaruandanrevisikeyakinaninvestorHogarthdan
Einhorn(1992)mengajukanmodelpenyesuaiankeyakinan,yangmenyiratkanbahwainformasi
prosesindividusecaraberurutanakanmenggunakanprosesanchoringdanpenyesuaian.Secara
khusus,penyesuaianmodelkeyakinanmemprediksitidakadaefekagarbukti/informasiyang
konsisten(secarakeseluruhanpositifataunegatifsecarakeseluruhan)tetapiefekkebaruan(urut)
terjadiketikaindividumendapatkanbuktibahwaberagam(beberapanegatifdanbeberapa
positif).
Pesananefekterjadiketikakeputusanmakeindividuyangberbedasetelahmenerimabukti/
informasidalamurutanyangberbeda.Dalamrangkabukti,sifatbuktiadalahcampuranantara
informasidikonfirmasi(positif)dandibenarkan(negatif).Jikainformasiawal,agar,memiliki
dampakterbesarpadakeyakinanindividu,efekdariurutandisebutefekkeutamaan.Sebaliknya,
jikainformasiterbarumemberikanefekterbesar,halitudisebutefekkebaruan.
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Jurnal

151
Fenomenaefekurutanterjadiketikamengevaluasibuktibaru,danpenyesuaianberikutnya
berdasarkanbuktitambahantidakcukup.HogarthdanEinhorn(1992)mengadopsikonsep
umumtermasukkeyakinanpenyesuaianbiasyangterjadidanmembentukkerangkapsikologi
dikenalsebagaimodelpenyesuaiankeyakinan.Modelinimemprediksikemutakhiranketika
mengevaluasiseripendekindividubuktiyangkompleksdanbuktisenyawaataucampuran
(positifdanbuktinegatif).Buktiseripendekterdiridarimaksimal12barangbukti.Kompleksitas
yangterkaitdengantugaskeakrabandanitempanjangbukti.Buktisenyawaataucampuran
terdiridaribarangbuktidariitempositifdannegatif.ModelHogarthdanEinhorn(1992)
memprediksibahwakeputusandibuatsetelahbuktiyangdiperoleh,dancenderunguntuk
menemukanefekrecencey.ModelresponinidikenalsebagaiLangkahdemilangkah(SBS).
Fenomenaefekrecencyjugadidukungdalambeberapapenelitian.Tubbsetal.(1990)meneliti
apakahurutanbuktimemilikidampakyangsignifikanterhadaprevisikeyakinanauditor.Hasil
menunjukkanbahwapertimbanganauditordankeputusanhanyamemberikanpenekananpada
urutanbuktiterbaruwalaupuntingkatsignifikansibuktibelumtentutinggi.Messier(1992)
memberikanbuktibahwastafauditoryangmenerimabuktiyangkompleksdanberagam
(informasinegatifdanpositif)denganpolaekspresiberurutan,makaefekrecencyakanterjadi.
Asare(1992)jugamemberikanbuktiserupamunculnyaefekrecencypadamanajerdanterkait
penilaianpartnerauditgoingconcernketikapolabuktiberurutan(langkahdemilangkah).Tuttle
etal.(1997)menelitiefekpesananpadaefisiensipasardanmenyimpulkanbahwainvestor
individuyangmenerimaempatinstruksi/buktimenunjukkanpengaruhkebaruan.Halinijuga
ditunjukkanolehTubbsetal.(1993),bahwaefekrecencyterjadiketikaseorangindividu
menerimabuktitidakkonsisten,meskipunindividutelahdiberikanpelatihanuntukmemahami
tugasdanmemberikanpenilaianyanglebihbaikdaribuktitetapiefekrecencytetapditemukan
dalamkondisiini.PenelitiantentangefekurutandiIndonesiatelahdilakukanolehHartono
(2004),Suartana(2006),NasutiondanSupriyadi(2007),Alvia(2009,AlviadanSulistiawan
(2009),danAlmilia(2010),
Berdasarkanargumenini,hipotesispenelitianpertamadapatdinyatakansebagaiberikut:
Terjadiefekrecencyrevisikeyakinaninvestordaripenyajian
H1:.informasiyangcampurandandisajikansecaraberurutan2.2efekAnchoringdan
kepercayaaninvestorTemuanrevisiAshtondanAshton(1988)menunjukkankebaruansuatu
efekdanefekpenahan.teoripenyesuaianKepercayaanmemprediksiefekkebaruandanpenahan
efekterjadipadasusunankarakteristikdariinformasiyangcampuran(positifdannegatif)dan
disajikansecarabertahapatauStepbyStep(SBS).hasilakhirdarireaksiinvestoruntukmerevisi
keyakinanmerekadapatdijelaskanolehefekkebaruan.Hartono(2004)menyatakanbahwaefek
recencymenjelaskanbagaimanainvestorbereaksiterhadapurutanbuktiataucampuraninformasi
(buktinmanainformasiterakhiregativedanpositif)memilikidampakyanglebihbesardaripada
informasipertamapadarevisikeyakinaninvestor.Iniberartibahwaefekkebaruantidak
menjelaskanmengapainvestormelakukanrevisikeyakinan.Penjelasanmengapainvestor
merevisikeyakinanmerekaadadiefekpenahan.Jangkaradalahkeyakinanawal.Berdasarkan
teoripenyesuaiankeyakinan,faktorfaktoryangmenyebabkanefekkebaruanadalahjangkar.
Teoriinimengatakanbahwajangkarbesar(kecil)akanmenurun(meningkat)karenainformasi
negatif(positif)dibandingkandenganjangkarkecil(besar),sepertiyangditunjukkanpada
Gambar1.EfekAnchoringmenjelaskanmengapainvestormerevisikeyakinannyasesuaidengan
prediksiefekkebaruan.Penahanefekmenjelaskanpenyebabefekkebaruan,
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Jurnal

152
sehinggakondisipenyajianinformasisecaraberurutandancampuran,diperkirakanakanterjadi
efekkebaruandanefekpenahan.
Gambar1ContrastatauEfekAnchoring

Anchoringefekmenunjukkanbahwainformasinegatifyangsama,jangkarbesarmenurunlebih
jauhdarianchorkecil.Alihalihinformasiyangsamayangpositifmemilikipengaruhpositif
lebihkuatdikecildibandingkandenganjangkarjangkarbesar.Ukuranpenahanefektergantung
padajumlahataunilaidarijangkar.Memberikaninformasinegatifyangsama,menyebabkan
penurunan jangkar kecil tidak besar seperti penurunan jangkar besar. Ini berarti bahwa
penurunankepercayaandisebabkaninformasinegatiflebihbesarpadajangkarbesardaripada
anchorkecil.
HogarthdanEinhorn(1992)memberikanrasionalisasiataspernyataanbahwabuktinegatif
yangsamamenyebabkanpenurunanlebihbesardalamanchorlebihtinggidarianchorrendah,
yaitubahwaituadalahperilakuindividuyangmemilikikecenderunganuntukberpikirbahwa
anchorrendahsudahpadarendahposisidantidakakanturunsebanyakjikaanchoryangtinggi.
Mengapaurutanbuktimempengaruhiperilaku?Teoripenyesuaiankeyakinanmenyatakanbahwa
perilakudisebabkanolehtingkatkeyakinanawal(penahanefek),meskipunHartono(2004)
menemukansedikitdukunganuntukefekpenahan.Berdasarkanargumendiatas,hipotesiskedua
penelitianinidapatdirumuskansebagaiberikut.
H2:Terjadiefekpenahanpadarevisikeyakinaninvestordaripenyajian
informasiyangcampurandandisajikansecaraberurutan2.2Kepribadiantoleransiuntuk
ambiguitasMenurutNasutiondanSupriyadi(2007)kepribadianyangdidefinisikansebagai
kumpulanperilakuumumataukeyakinanindividuyangrelatifstabildariwaktukewaktudan
dalamsituasiyangberbeda.Studiakuntansimenggunakanvariabelini,seringdenganfokuspada
toleransiuntukambiguitassebagaimengukurdimensikepribadian,antaralain:Gul1984,
McGhee,1978,dan(WrightdanDavidson,2000,Lamberton,Fedorowitcz,danRoohani2005,
Hartmann2005,NasutiondanSupriyadi2007).Individudengantoleransiyangrendahuntuk
ambiguitas(intoleransiuntukambiguitas)mungkinakanmelihathalseperti"hitamputih"saja,
danmudahuntukmenggantiataumemodifikasikeyakinannyaketikamenerimainformasibaru,
jikainformasitersebutbertentangandenganinformasiyangdiperolehsebelumnya.Sebaliknya,
individudengantoleransiyangtinggiterhadapambiguitas,cenderungmelihatsesuatudengan
lebihjelas,dantidakmudahmengubahkeyakinanketikamenerimainformasibaruyang
bertentangandenganinformasisebelumnya.Dengandemikian,informasiyangambigu
(konfirmasidiskonfirmasiatausebaliknya)disajikanpadaindividudengantoleransiyang
berbedauntukambiguitasyangakanmenghasilkana.
Vol 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

153
pertimbanganyangberbedakarenaperbedaanmerekadalamcaramengolahdan
menginterpretasikaninformasiInformasiyangsamaakanmenghasilkanpertimbanganyang
berbedadikalanganinvestordengantoleransiyangrendahterhadapambiguitasdaninvestor
dengantoleransiyangtinggiuntukambiguitas.Sehinggatigahipotesisdapatdirumuskansebagai
berikut.
H3:Adainteraksiantaratoleransiambiguitasdanurutanbuktiyangditunjukkandan
akanmempengaruhipertimbangan(keyakinanrevisi)yangdiambilolehinvestor.Investor
dengantoleransiyangtinggiterhadapambiguitasakanmerevisikeyakinannyalebihkecil
dariinvestordengantoleransiyangrendahterhadapambiguitas.
3.METODOLOGI3.1.DesainpenelitianPenelitianinimenggunakaneksperimenmetode2x2
desainfaktorialantarasubjekmengikutimodelAlvia(2009),NasutiondanSupriyadi(2007),dan
Hartono(2004).Antarasubjekdesaindigunakanuntukmenghindariefekpermintaanyang
tundukuntukmengetahuiarahdarikondisiataupengobatanyangdiberikan.Faktorperlakuan
adalahurutanpenyajianinformasi2tingkatsifatnya(beritaburukdanberitabaik),dantoleransi
untukambiguitas2tingkat(rendahdantinggitoleransiuntukambiguitas).Penelitianini
menggunakanmodelkeyakinanpenyesuaiandibidangakuntansikeuangankhususnya
menggunakanpasarmodalpengaturan,danmengadopsidesainpenelitianHogarthdanEinhorn
(1992).AdaduamoderespondalamteoripenyesuaiankeyakinanyangAkhirUrutan(EOS)dan
StepbyStep(SBS).Penelitianinimenggunakanresponmoduslangkahdemilangkah(SBS).
Kombinasiinformasipositifdannegatifdenganberbagaikemungkinanurutandanjenis
informasidisebutsebagaiinformasicampuran.Informasiurutandimanipulasiantarasubjek.
SubyekmenerimaduapotonginformasinegatifdiikutiolehduapotonganinformasipositifE(
++)atauduapotonginformasipositifdiikutiolehduapotonganinformasinegatifE(++).
3.2SampeldanPesertaPopulasidalampenelitianiniadalahMastersiswaProgramStudi
AkuntansipadaFakultasEkonomi,UniversitasHasanuddinyangtelahdiprogramCoursePasar
BerbasisRisetAkuntansi(mbar).Pesertadalampenelitianiniadalah75orangyangdipilih
secaraacak.Pengacakandilakukanuntukmengendalikanvariasiindividupotensialgangguan
(variabelusia,jeniskelamin,danpengalamansebelumnya).Alasanpemilihansiswasebagai
subyekpercobaandianggapmemilikipengetahuandasar,daripadamengandalkanpengalaman.
Informasiyangmendasardisajikanakrabkarenabahaninformasitentanginformasifundamental
yangtelahmerekapelajari.Siswayangeksperimensubjekdiperlakukansebagaiinvestorpemula
atauinvestortidakcanggih(Habbe2006).Yangdigunakansiswasebagaisubyekpercobaanjuga
dilakukanolehbeberapapenelitisebelumnya(Alvia2009,NasutiondanSupriyadi2007,dan
Habbe2006).Habbe(2006)menyatakanbahwatidakadapatokanberapajumlahpesertadalam
percobaan,tetapiberlakuhukumdasarbahwasemakinbesarsampel,baikkarenakekuatan
meningkattes.Berdasarkanbeberapapenelitianyangmenjadiacuanpenelitianini,jumlahmata
pelajarandalamsatukelompokataukelompokadalah15sampai20orang,sedangkanjumlah
subyekataurespondenpenelitianinisebanyak85orang.Dari85siswayangmenanggapi,10dari
merekatidakluluspemeriksaanmanipulasi,sehinggajumlahrespondenyangdigunakan
sebanyak
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

154
75orangdandibagimenjadi2kelompok.GrupE(++)sebanyak36orangdankelompokE(+
+)sebanyak39orang.3.3.VariabeldanPengukurana.IndependenVariabelInformasiPesanan
Urutanpenyajianinformasiadalahurutaninformasiyangditerbitkanataudikeluarkanoleh
perusahaansebagaidasarbagiinvestoruntukmembuatkeputusaninvestasisaham.Penelitianini
memanipulasiurutanpenyajianinformasisecarabertahapatauLangkahdemilangkah,dan
menyajikaninformasidalamcampuran.Campuraninformasimerupakankombinasidari
informasiyangpositif(kabarbaik)dannegatif(beritaburuk).Urutaninformasiadalahurutan
tahapanatauinformasitambahanyangakanditerimaolehmasingmasingsubjek.Empat
informasitambahanyangdisajikanpadakelompokpertamaadalah1)peningkatanpendapatan,
2)likuiditasdanprofitabilitasrasioditingkatkan,3)lababersihmenurun,dan4)adalah
penjualanterendah.Informasitambahanyangsamadisajikanpadakelompokkedua,tapidalam
arahyangberlawanan.Subjekakanmenerimakasuspercobaandengansalahsatudaridua
konfigurasi,yaituurutanE(++)atauE(++).Urutanpresentasidarisifatinformasiyang
dibagimenjadidua,yaituinformasikonfirmasi/kabarbaik(++)daninformasidisconfirmatory/
beritaburuk().Efekkebaruanefekkebaruanadalahbagiandariefekdariurutandiprediksidi
AdjustmentteoriKepercayaan.Efekkebaruandikatakanterjadijikasubjekbobotinformasi
urutanterakhirlebihbesardariinformasiurutansebelumnya(awal).Dalampercobaanini,
subyekmengatakanbobotinformasiterbarulebihbesardariinformasisebelumnyajikarevisi
kepercayaaninvestor(S4S0)padakelompokE(++)<GrupE(++).PenahanefekEfek
anchoringjugamerupakanbagiandariefekorderdiprediksidiAdjustmentteoriKepercayaan.
Efekpenahandikatakanterjadiketikasebuahjangkarbesar(kecil)akanmenurun(meningkat)
karenainformasinegatif(positif)dibandingkandengananchorkecil(besar).Dalamhalini,
urutanE(++),jangkarbesaradalahS2danjangkarkecilS3.PenurunanS3keS4adalahtidak
sebesarS2penurunankeS3(S2S3>S3S4).DalamrangkaE(++),jangkarkecilyangadalahS2
dananchorbesaradalahS3.PeningkatanS3keS4tidaksebesarpeningkatanS2untukS3
(S2S3>S3S4).b.ModeratorVariabelKepribadianToleransiuntukAmbiguitasKepribadian
ToleransiuntukAmbiguitasadalahvariabelmoderatordalamhubunganantararangkainformasi
danrevisikeyakinaninvestor.NasutiondanSupriyadi(2007)mendefinisikankepribadian
sebagaikumpulanperilakuumumataukeyakinandariindividuyangrelatifstabildariwaktuke
waktudandalamsituasiyangberbeda.Kepribadian,menurutkamusBahasaIndonesia,adalah
reaksipsikologisdansosialseluruhindividu,sintesiskehidupanemosionaldankehidupan
mental.Kepribadianumumnyadifokuskanpadapengukurantoleransidimensiuntukambiguitas
sebagaikepribadian.Toleransiambiguitasadalahkemampuanuntukmenerimaataumenafsirkan
pernyataanataukeadaanambigu(tidakkonsisten),misalnya,merasanyaman,atausetidaknya
tidakmerasanyamanketikamenghadapimasalahmasalahsosialyangkompleksyang
bertentangandenganprinsipseorangindividu.Toleransiambiguitasdiukurdengan
menggunakaninstrumenAT20yangdikembangkanolehMacDonald(1970).Ada20
pernyataandalaminstrumenAT20;subjekdiinstruksikanuntukmemberikanjawabanbenar
atausalah.Jawabanyangbenardiberinilai0danjawabanyangsalahdiberi
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

155
1.Toleransidariambiguitaslebihrendahketikasubyekmenerima110poindantoleransiyang
tinggiterhadapambiguitasjikamendapatpoin1120.
c.VariabelDependentDalampercobaanini,variabeldependenadalahrevisikeyakinaninvestor
setelahmengevaluasiinformasiyangdisajikandalamberurutancampuranolehperusahaan.
Subyekakanmenerimaempatinformasitambahan,danakanmengambilkeputusansetiapkali
menerimainformasitambahandenganmemeriksatingkatkepercayaanuntukberinvestasipada
kuesioneryangdiberikan.Keyakinandihitungdenganmenggunakanterusskaladari0sampai
100.kepercayaaninvestorRevisidihitungdenganmengurangikeyakinanbahwaakhirkeyakinan
awalS4S0.
3.4.PenelitianInstrumenInstrumenExperimentaldiadopsiAlvia(2009)denganskenario
penyesuaian.Skenarioiniterdiridariempatbagian.Bagianpertamaadalahskenarioinvestasi
sahamyangmenyajikankondisiawalperusahaan;informasitambahandisajikansecaraberurutan
(duainformasipositifdiikutiduainformasinegatifpadakelompokdanberlawanandalamdua
kelompok).Bagianduaadalahcekmanipulasi,yangbertujuanuntukmenentukanapakahsubjek
telahmemahamiinformasiyangdisajikan,atautidak.Bagiantigaadalahkuesionertoleransi
ambiguitasyangterdiridariduapuluhpernyataanuntukmenentukanapakahsubjekmemiliki
toleransiyangtinggiataurendahuntukambiguitas.Bagianempatadalahkuesionerdemografi
untukmengetahuijeniskelamin,tahunkuliah,IPK,danpengalamankerja.
Tabel1.EksperimentalKondisiPengobatanEksperimentalKondisi
Informasi(1)
Informasi(2)
Informasi(3)
Informasi(4)
AkhirKeputusanKelompokorder1InformasiE(++)
++Beli/No
Grup2InformasirangkaE(++)
++Beli/Tidak

S1S2S3S4FDCatatan:S1,S2,S3,S4:revisiKepercayaaninvestorsetiap
kalimenerimainformasitambahanFD:Keputusanfinal.3.5.AnalisisDataTeknikanalisisyang
digunakandalampenelitianiniadalahujit,KruskalWallis,danAnovaTwoWay.Hipotesissatu
danduadianalisismenggunakanttestdandiperkuatdenganKruskalWallis.HipotesisKetiga
dianalisismenggunakanttestdanAnovaTwoWay.Hipotesisharusdidukungjikarevisirata
ratakeyakinan(S4S0)padakelompok1(kelompokyangmenerimainformasipesananE(++)
yanglebihkecildansecarastatistiksignifikandibandingkandenganrevisirataratakeyakinan
(S4S0)padakelompok2(kelompokyangmenerimainformasipesananE(++)secara
matematisdapatditulisdirevisikeyakinankelompokratarataE(++).<E(++).Hipotesisdua
yangharusdidukungjikakelompokpertama,penurunanrataratadalamrevisikeyakinandariS2
keS3lebihbesardaripenurunanrataratadalamrevisikeyakinandariS3keS4.perbedaan
dalamrevisikeyakinanS2S3lebihbesardariperbedaandalamrevisikeyakinanpadaS3S4.
dalamkelompok2,rataratapeningkatandalamrevisikeyakinandariS2keS3lebihbesardari
peningkatandalamrevisikeyakinandariS3keS4.perbedaandalamrevisikeyakinanS2S3lebih
besardariperbedaandalamrevisikeyakinanS3S4.secaramatematisdapatditulis(S2S3)>
(S3S4).Hipotesistigaharusdidukungjikaadainteraksiantaratoleransiambiguitydanurutan
bukti,danpengaruhrevisikepercayaanyangdiambilolehinvestor.Subyek
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

156
yangmemilikitoleransiyangtinggiterhadapambiguitas(AT),merevisikeyakinannyalebih
kecildarisubyekyangmemilikitoleransiyangrendahuntukambiguitas.Subyekdengan
toleransiyangtinggiterhadapambiguitasmemilikiS4S0lebihkecildarisubyekdengan
toleransiyangrendahuntukambiguitas.3.6.EksperimentalPelaksanaanProsedurpercobaan
dilakukanpadaduakelompokyangberbedayaituE(++)danE(++).Masingmasingmata
pelajaraninidalamkelompokakanmenerimanarasiawalberisigambaranumumPerusahaan
denganskorpenilaianawalkinerjaperusahaan(sebagaijangkarawal(S0))adalah50.Penentuan
jumlah50sebagaiawaljangkarberdasarkanpertimbanganbahwanomoradalahtitik
keseimbanganantaratitikterendah0dantertinggi100,jadijikarespondenmemilikiperingkatdi
bawahjangkar(400)ataudiatas(60100)dapatditampung.Narasiawaldisajikandalam
bentukgambaranumumdariperusahaan,yangdiharapkanuntukmerangsangrespondenuntuk
menyepakatijumlahtengah,yaitu50.Selainitu,setiapsubjekdalamkelompokakanmenerima
empatdariinformasitambahandalamurutan(S1,S2,S3,danS4)menurutkelompok
eksperimentelahditentukan.Dalaminstrumenlembar,jenisinformasiyangdisajikandalam
bentukinformasifundamentalyangdisajikanolehsifatnyaadalahberitabaikdanberitaburukE
(++)atauE(++).UrutaninformasiyangdisajikanadalahcampurandariE(++)yang
memilikiduakelompoksepertiyangditunjukkanpadaTabel1,yaitu:E(++)danE(++).
Setiapkalipenyediaaninformasitambahan,subjekdimintauntukmenyatakanberapabanyak
kepercayaandiriuntukberinvestasidiperusahaanberdasarkaninformasitambahan.Selanjutnya,
subjekdimintauntukmembuatkeputusaninvestasiuntukmembeliatautidakmembelisaham
yangterdapatdalamskenariokeputusaninvestasi.Keputusaninvestasiyangdibutuhkanuntuk
melihatapakahkeputusaninvestasidarimasingmasingkelompokidealatautidakideal.
Keputusaninvestasiadalahuntukmenjadiidealjikarataratadarisubyekdalamkelompok
pertamamemutuskanuntuktidakmembeli,dankelompokduamemutuskanuntukmembeli.Cek
manipulasilebihlanjutyangdiberikankepadasubjekdalambentukkuesioneruntukmenentukan
pemahamansubjekpadainformasiyangdisajikan.Setelahmengisikuesionermemeriksa
manipulasi,subjekdimintauntukmengisitoleransialatuntukambiguitas.Padaakhirpercobaan,
subjekdimintauntukmengisidatademografis.4.HASIL4.1.StatistikDeskriptif
Tabel2.StatistikDeskriptifKepercayaanRevisiKeyakinanRevisiNMinimum
MaximumBerartiS4S07540,0050.0094,667S2S37510,0070,00249,333S3S4750.00
40.00122,667AT753.0014.0086,400Sumber:DataOlahan(2016).Tabel2menggambarkan
statistikdeskriptifdarivariabeldependen,variabelindependendanvariabelmoderator.Revisi
keyakinanadalahS4S0,S2S3adalahperbedaanantaraS2danS3,S3S4adalahperbedaan
antaraS3danS4,danATadalahtoleransiuntukambiguitas.Jumlahsubjekdalampenelitianini
adalah75orang.
Tabel3.BerartiNilaiKepercayaanRevisi
InformasiPemesanan
PertimbanganUrutan
S0S1S2S3S4(++)(++)
N

3639505068,6144,8773,6138,97

Catatan:S0adalahawaljangkar/awalinformasiS1,S2,S3,S4adalahinformasitambahanyangdisajikanteratur.

Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Jurnal

157
Tabel3menunjukkannilairataratamempertimbangkanataurevisikeyakinanmasingmasing
menerimainformasitambahan.
Tabel4.StatistikDeskriptifJumlahPesertaTiapJual
InformasiPemesanan
AmbiguitasTinggiToleransiRendah

(AT)
Total
E(++)112536E(++)132639
Total245175Sumber:DataOlahan(2016).

Tabel4menunjukkanjumlahpesertadisetiapsel.Ada36pesertakedalamkategoriurutanbukti
E(++)dan36pesertakedalamkategoriE(++).Sedangkanjumlahmatapelajarankedalam
kategoritoleransiyangtinggiterhadapambiguitasadalah24orangdanjumlahmatapelajaran
dalamtoleransiyangrendahuntukambiguitasadalah51orang.
4.2.PengujianHipotesisa.PengujianHipotesisSatu
Tabel5.KelompokStatistik(muatEffect)
GrupNMinMaxMeanStd.
Deviasi
Std.KesalahanBerartiS4S0(1)E(++)(2)E(++)
3639
40,0020,00
10,0050,00
11,1128,46
14,49714,242
2,4162,280
t=11,919,alpha=0,000
Sumber:DataOlahan(2016).

BerdasarkanTabel5menunjukkanbahwanilairataratarevisikeyakinankelompok1E(++)
adalah11,11denganstandardeviasi14497danrataratastandarderroryang2416.Sementara
ratarataskorkeyakinankelompokrevisi2E(++)adalah28,46denganstandardeviasi14242
danratarataerrorstandar2280.RevisiKeyakinanrataratakelompok2lebihbesardarirevisi
rataratagrup1.Perbedaaninisecarastatistiksignifikandengannilaitdari11919(1%).
Tabel6.UjimuatEffectdigunakanKruskalWallisUjiGrupNBerartiRankingS4S0E(++)S4S0E(++)
Jumlah
363975
19,8554,76
ChiSquaredfAsymp.Sig
49,01910,000

Sumber:DataOlahan(2016).TesdenganujiKruskalWallis,sepertipada
Tabel6menunjukkanbahwarataratarankinguntukkelompokE(++)adalah19,85lebih
rendahdibandingkankelompokE(++)di54,76.PerbedaanperingkatinimemilikinilaiChi
Square49,019denganAsymp.Sig.0.000.Hasilinimenunjukkanadaperbedaandalamrevisi
keyakinanyangsignifikansecarastatistikantarakelompokE(++)dankelompokE(++).
Hasilinimemberikanbuktiempirisyangterjadiefekrecencyrevisikeyakinaninvestordari
penyajianinformasiyangcampurandandisajikansecaraberurutan.Dengandemikianhipotesis
pertamadidukung.
Vol. 72 | No. 10 | Oktober 2016 Internasional Ilmiah Penelitian Journal

158
b.PengujianHipotesisDua
Tabel7.StatistikGroup(efekpenahan)
GrupNMinMaxMeanStd.
Deviasi
Std.KesalahanBerarti
S2S3(1)S3S4(2)
75
10,00
70,00
24,933
17,427
2,01275
0,00
40,00
12,266
9,666
1,116
t=5,504,alpha=0,000

Sumber:DataOlahan(2016).Tabel7saatinirataratamenurundanmeningkatkan
revisikeyakinanS2S3(anchor1)adalah24,933denganstandardeviasiadalah17,427danrata
rataerrorstandar2,012.UntukpenurunanrataratadanmeningkatkanrevisikeyakinanS3S4
(anchor2)adalah12,266denganstandardeviasi9,666danratarataerrorstandar1,116.
Perbedaanrevisikeyakinanantaraduakelompoksignifikan(t=5504;pvalue=0,000).Dengan
demikiandikatakanpendudukrataratatidaksama.Rataratapenurunandankenaikanrevisi
keyakinan(perbedaan)dalamS2S3(anchor1)lebihbesardaripenurunanrataratadan
peningkatanrevisikeyakinan(perbedaan)dalamS3S4(anchor2),dandarihasiltersebut
menunjukkanbahwaterdapatperbedaanyangsignifikanantaraaveragethedifferenceinbelief
revisiononS2S3andanaveragedifferenceofbeliefrevisioninS3S4.Itcanbesaidthatthe
resultsexplainthattheanchoringeffectoccurs.
Table8.AnchoringeffecttestusedKruskalWallisGroupNMeanRank
Anchor1Anchor2Total
92.8258.18
ChiSquaredfAsymp.Sig
7575150

25.0761.000Source:ProcessedData(2016).KruskalWallistestshowedthattheaverage
rankingforthegroupanchor1is92.82andgroupanchor2is58.18.Thetestresultsdemonstrate
thevalueofChiSquare25076withAsymp.Sig.0000.Itcanbeconcludedthatthereare
differencesinbeliefrevisionstatisticallysignificantbetweenanchor1andanchor2.Thisresult
documentsthatoccuredanchoringeffectoninvestorbeliefrevisionofthepresentationof
informationwhichismixtureandispresentedsequentially.Hypothesis2issupported.c.Testing
ofHypothesisThree
Table9.GroupStatistics(AT)ATNMeanStd.DeviasiStd.ErrorMean
S4S0AThigh
ATlow
24
10.00
23.03
4.7051
9.22
25.36
3.55
t=0.129,alpha=0.898
Source:ProcessedData(2016).

Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

159
Fortheaveragerevisionoftheindividual'sbeliefwithahightoleranceforambiguityis10.00
withstandarddeviationis23:03andstandarderroris4.70.Meanwhiletheaverageindividual
beliefrevisionwithalowtoleranceforambiguityis9.22withastandarddeviationof25.36and
theaveragestandarderrorwas3.55.Directionsofrelationshippredictedbythehypothesisthat
investorswithahightoleranceforambiguitywillrevisehisconvictionsmallerthaninvestors
withalowtoleranceforambiguityarenotproven.Thedifferencewasnotstatisticallysignificant
withavalueoft=0.129withalphaof0.898.Theseresultsprovethatthereisnosignificant
differencebetweentheaveragerevisionsoftheconvictionofindividualswithahightolerance
forambiguitytoanaveragerevisionofindividualbeliefswithalowtoleranceforambiguity.
Table10.DescriptiveStatisticsofInteractionGroupATMeanStd.DeviationNE(++)AThigh
ATlowTotal
7.2712.8011.11
13.4814.8614.49
112536E(++)AThigh
ATlowTotal
24.6130.3828.46
18.9811.1314.24
132639TotalAThigh
ATlowTotal
10.009.219.46
23.0325.3624.49

245175Source:ProcessedData(2016).DescriptivestatisticsofANOVAtestshowedthatthe
averagerevisionconfidenceofsubjectathighAT(10.00)isgreaterthantheaveragerevisionof
subjectatlowTA(9.21).Thismeansthatthedirectionoftherelationshippredictedinthe
hypothesisthatinvestorswithahightoleranceforambiguitywillrevisehisconvictionsmaller
thaninvestorswithalowtoleranceforambiguityisnotproven.
Table11.TestofBetweenSubjectsEffectsANOVATwoWaySourceTypeIIISumof
Squares
dfMeanSquareFSig.
InformationorderATInformationOrder*ATError
22882.901.238518.12514541.413
11171
22882.901.238518.125204.809
111.728.0012.530
.000.973.116
a)DependentVariable:S4S0b)RSquare=.672(AdjustedRSquare=.658)

TheANOVAtestshowthatthesequenceofinformationprovidesFvalueof111728and
significantat0.05(p<0.05).Thismeansthatthereisasignificantdifferenceintheaverage
revisionofbeliefbetweenthegroupinformationsequential.ToleranceforambiguitygivesF
valueof0.001andisnotsignificantat0.05(p>0.05).Thismeansthatthereisnosignificant
differencebetweentheaveragebeliefrevisionsofhighATandanaveragebeliefrevisionoflow
AT.TheresultoftheinteractionbetweentheinformationorderandToleranceforAmbiguityisF
valueof2.530andisnotsignificantat0.05(p>0.05).Thismeansthatthereisnomutual
influenceorjointeffectbetweentheinformationorderandtoleranceforambiguityonthe
averagerevisionofbelief.ToleranceforAmbiguitydoesnotmoderatetheeffectoftheorderof
informationontherevisionofbelief.Hypothesis3wasnotsupported.AdjustRsquareof0.658
meansthatthevariabilityrevisionofbeliefcanbeexplainedbythevariablesequence
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

160
ofinformation,ToleranceforAmbiguity,andtheinteractionbetweentheinformationsequential
andToleranceforAmbiguityamountedto65.8%.5.DISCUSSIONa.RecencyEffectand
investorbeliefrevision.Thetestresultsshowedthattheaveragebeliefrevisiongroup2greater
thantheaveragebeliefrevisiongroup1.Theseresultsalsoprovedthatthereisasignificant
differencebetweentheaveragebeliefrevisiongroup1andtheaveragebeliefrevisiongroup2
bothttestandtheKruskalWallistest.Thusitcanbeconcludedthattherearerecencyeffecton
investorbeliefrevisionofthepresentationofinformationthatisamixtureandarepresented
sequentially.Beliefadjustmenttheorystatesthatwhenindividualsobtainnewevidencefrom
availableinformation,theywillreviewhisbeliefbyusinganchorsandadjustmentprocess.
Recencyeffectdescribeshowinvestorsreacttotheevidenceandarepresentedsequentiallyand
mixture.Provingthehypothesis1supportTheoryofBeliefAdjustment.Inthisstudy,four
additionalinformation(ieS1,S2,S3,andS4)arepresentedsequentiallyandmix,proven
investorsrevisetheirbeliefwheneverreceivednewinformationbasedontheanchorandmake
adjustments.Fromprovingthehypothesisoneshowthatinvestorbeliefrevisiontendtoweight
thelatestinformationoutweighthantheinitialinformationsothatrecencyeffectoccurs.The
resultsstraightenwhatitisdocumentedbyAshtonandAshton(1988),Asare(1992),Nasution
andSupriyadi(2007),andseveralotherresearchers.Wheninvestorsaregiveninformation,
whichisamixtureofdisconfirmationandconfirmation(negativeandpositive),andare
presentedsequentially,thentheinvestorwillrevisehisconvictionbasedontheorderof
presentationofinformationandnotonthesubstanceoftheinformation.Thisbecauseof
investorsgiveshigherweightonrecentinformationpresentedorobtained.Investorbehavioral
thatisweightedhigherthelatestinformationthantheinitialinformationiscalledrecencyeffect.
Indetail,thisstudysupportsthetheoryofbeliefadjustmentproposedbyHogarthandEinhorn
(1992)thatpeoplewillrevisehisconvictionwhennewevidenceattainedbyusingtheanchor
andadjustment.Similarly,itsupportresearchofAshtonandAshton(1988),whichindicatesthat
theauditorreviewsconfidencewilldependonthecompositionoftheevidencereceivedandthe
waytheevidenceispresented.FindingsAshtonandAshton(1988)indicatesthatthesubjectwill
easilychangehisconvictionwhennewevidenceisreceived,althoughbehavioraldecisiontheory
intheliteratureshowthatingeneralpeopletendtoavoidnewevidence.Thisstudyalsosupports
thetestingofthepresenceofrecencyeffectsusinganexperimentaldesignwithsettingcapital
marketconductedbyAlvia(2009)whichshowedthattheeffectsarepresentinthestock
investmentdecisionswhenaccountinginformationandinformationnonaccountingeach
containedgoodnewsandbadnews(informationmixtures)arepresentedsequentially.In
essence,investorstendweightingthecurrentinformationismoreimportantthantheprevious
informationonthetypeofinformationthatisamixtureof(acombinationofgoodnewsandbad
news).
b.AnchoringEffectandInvestorbeliefrevision.Provingthehypothesistwodoneusing
independentsamplesttestandalsostrengthenedbytheKruskalWallistest.Thetestresults
indicatethatthehypothesisissupported.TheaveragedifferenceinbeliefrevisionS2S3
(anchor1)isgreaterthantheaveragedifferenceinbeliefrevisionS3S4(anchor2),andfromthese
resultsitisevidentthattherearetheanchoringeffectoccurs.Thetestresultscorroboratethe
resultsobtainedbyAshtonandAshton(1988)andHartono(2004).Italsoshowsthatthere
anchoringeffectoninvestorbeliefrevisionofthepresentationofinformationthatisamixture
andispresentedsequentially.Theanchoring
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

161
effectisprovencanexplainwhytherecencyeffectoccursasdescribedBeliefAdjustmenttheory
thatthefactorsthatcausetherecencyeffectistheanchor(initialbeliefs).Thetheorysaysthat
large(small)anchorwillbedecreased(increased)duetonegativeinformation(positive)
comparedtoanchorasmall(large).Accordingtothetable4.6inorderE(++),S2(+)isalarge
anchorinalargerdeclineduetothenegativeinformationthatisS3(),comparedtothedecline
ofsmallanchorthatS3()duetonegativeinformationthatisS4(),Thedeclineof22.23S2to
S3isgreaterthanthedecreaseinS3toS4at12.50.Likewise,inorderE(++),S2()isalittle
anchorinalargerincreaseduetothepositiveinformationthatS3(+)comparedtoanincreasein
largeanchorthatS3(+)causedpositiveinformationthatS4(+).Anincreaseof27.44S2toS3is
greaterthantheincreaseinS3toS4of12.05.SothedifferenceinbeliefrevisionS2S3isgreater
thanthedifferenceinbeliefrevisiononS3S4.Anchoringeffectstatesthattheadmissionof
evidenceornegativeinformationonalargeanchorwillbemoredownhillthanasmallanchor.
Theanchoringeffectsizedependsonthesizeoftheanchor.Inthiscase,thesequenceE(++),
biganchoristheS2andsmallanchoristheS3.Whentheanchorisalreadysmall,negative
informationdoesnotdegradeasmuchwhenanchorinalargestate,sothedeclineS3toS4isnot
asbigadeclineS2toS3(S2S3>S3S4).Thismeansthatthedropinbeliefcausedbynegative
informationislargeronthebiganchorthanthesmallanchor.Onthecontrary,withthesameof
evidenceorpositiveinformationhaspositivestrongeronthesmallanchorcomparedtothelarge
anchor.InorderE(++),thesmallanchoristheS2andthegreatanchorisS3.ImprovedS3to
S4isnotasbigasanincreaseinS2toS3(S2S3>S3S4).c.Interactioneffectbetweenevidence
orderandtoleranceforambiguityand,andbelief
revision.Theresultoftheinteractionbetweentheorderinformationandtolerancefor
ambiguitygiveFvalueof2.199andisnotsignificantat0.05(p>0.05).Thismeansthatthereis
nomutualinfluenceorjointeffectbetweentheorderinformationandAmbiguityToleranceon
theaveragerevisionofbelief.Ambiguitytolerancedoesnotmoderatetheeffectoftheorderof
informationontherevisionofbelief.Hypothesis3wasnotsupported.AdjustRSquareof0.658
meansthatthevariabilityrevisionofbeliefcanbeexplainedbythevariablesequenceof
information,ToleranceforAmbiguity,andtheinteractionbetweenthesequenceofinformation
andToleranceforAmbiguityamountedto65.8%.Notsupportedhypothesisthreewhichmeant
thatAmbiguityTolerancedoesnotmoderatetheeffectoftheorderofinformationonthe
revisionofbelief,inlinewiththeresultsofNasutionandSupriyadi(2007)whofoundthat
toleranceforambiguitydoesnotinteractornotmoderatetherelationshipbetweentheorderof
evidenceandconsiderationofinvestorstorevisetheirbeliefs.Theresultsofthisstudyalso
supportstheresultsofresearchconductedbyGul(1984)andMcGhee(1978)thatpersonalityin
theformoftoleranceforambiguitydoesnotaffecttherelationshipbetweenthetypesoftasksor
informationandjudgment.Directionsrelationshipexpressedinthehypothesisthatindividuals/
subjectswithahightoleranceforambiguitywillrevisehisconvictionsmallerthansubjectswith
lowtoleranceambiguityisnotenoughevidence.Therejectedofthehypothesisislikelydueto
theinfluenceofsubjectstoleranceforambiguitylowat51ismuchlargerthanthesubjectswho
toleranceforambiguityhighofonly24.Thetheoryinpsychologystatesthatpeoplewithalow
toleranceforambiguitywillbeeasiertochangehisconvictionwhenreceivenewevidenceor
informationcomparedtoindividualswithahightoleranceforambiguity.Ifthenumberof
subjectswithatoleranceofambiguitylowisgreaterthansubjectswithhighoftolerancefor
ambiguitythenrecency
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

162
effectandanchoringeffectoccurs.Basedonthepsychologyunderstandingthatthesubjectwith
lowoftoleranceforambiguitywillbeeasiertorevisehisbeliefsthansubjectwithhighof
toleranceforambiguity,hencewhenreceivinginformationinsequenceandthemixture,then
recencyeffectandanchoringeffectoccurs.Ifmostoraverageofthesubjectshadahighof
tolerance for ambiguity, then the subject is not easy to revise his beliefs when received
information sequence and nature mix, so that recency effect and anchoring effect may not
happen.
6.CONCLUSION6.1.ConclusionRecencyeffectoccursinthepresentationofinformationin
sequenceandmix.Investorweightinginformationthelatterismoreimportantorgreaterthan
previousinformation.Anchorlarge(small)moredecrease(increase)duetonegativeinformation
(positive)comparedtoanchorsmall(large).Thereisnointeractionorjointeffectbetweenthe
orderinformationandambiguitytoleranceontheaveragerevisionofbelief.Ambiguitytolerance
doesnotmoderatetheeffectoftheorderofinformationontherevisionofbelief.Directions
relationsproposedinthehypothesisthatinvestorswithahightoleranceforambiguitywillrevise
hisconvictionsmallerthaninvestorswithalowtoleranceforambiguityisnotproven.
6.2.ImplicationsThisstudyhasimplications,boththeoreticallyandpractically.Herearesome
oftheimplicationsofthisresearch.Theoretically,theseresultssupportthebeliefadjustment
model(HogartandEinhorn,1992)andthefindingsomepreviousresearch.Thisstudygives
attentiontothecompany'smanagementtoconsiderthesequencingofthepresentationof
informationbecausethesequenceofpresentationcanbeasimportantasthecontentofthe
informationpresentedtoinvestors.Iftheinformationpresentedsequentiallyandmix,the
company'smanagementshouldpresentinformationinnegativeinformationearlyandpositive
informationinthelastsection.Themanagementofthecompanymayconsiderthesequencingof
thepresentationofinformationasastrategictoolincommunicatingmanagementplanningtothe
variousshareholders.Investorsshouldrealizethattheirperceptioncouldbeinfluencedbythe
company'sstrategyofpresentinginformation.Awarenessoftheinfluenceoftheorderandhow
factorssuchsequencecaninfluenceaperson'sbeliefsrevisionprocessallowsinvestorstobe
morecarefulinassessingtheinformationpresentedcompany.6.3.LimitationThisresearchhas
beencultivatedforwelldesigned,butrealizetheirlimitations.Thelimitationsareamongas
follows.Thisstudyusesonlyonetypeofinformationthatisonlyfundamentalinformation
(financialstatements),whereasaninvestorwhenitwillmakeanassessmentofthecompany
certainlyisnotjustbasedonthecompany'sfinancialinformationonly.Besides,thisstudyonly
usesinformationbasedonthepositiveandnegativedirectionwithoutconsideringthelevelor
strengthofthedirectionofthepositiveandnegativeinformation.Personalityvariablesusedin
thisstudyisonlyatoleranceforambiguity.Basedontheliteratureofpsychology,personality
variablescanbemeasuredwithdifferenttypesofvariables,andthelastisthestudyonlytested
thepresentationoftheinformationgraduallyorstepbystep,whiletestingthesimultaneous
presentationorendofthesequenceisnotdone.
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

163
6.4.SuggestionBasedonthelimitationsnotedabove,therearesomesuggestionsthatcanbe
givenforthedevelopmentoffurtherresearch,namelyusingmorethanonetypeofinformation,
suchasinformationfundamentalandtechnicalinformation.Subsequentresearchmayalso
considerthelevelorstrengthofdirectionalinformation,andthenextstudycanmeasurethe
personalityvariablesbyusingmeasurementsotherthantoleranceforambiguity,forexample
usingthePersonalityPlusTestdevelopedbyFlorenceLitteur.Furtherresearchcouldalso
examinetheinteractionbetweenthevariablesofpersonalityandcognitivestyle,andtestingthe
presentationofinformationsimultaneouslyorendofthesequencemethodcandevelopthis
research.
7.ACKNOWLEDGEMENTSThankstotheUniversityofHasanuddinthathasfundedthis
research,thereforethisresearchhavebroadimpactontheeconomyandwelfareofthepeopleof
Indonesia.
REFERENCES
Almilia,Luciana.(2010).EffectofOrderEffectandPatternsofInvestmentDisclosureDecisionMaking.
AccountingNationalSymposiumXIII.
Alvia, Liza. (2009). Influence of Sequence Peyajian Information and Cognitive Style to the Revision Process
InvestorConfidence(AnExperimentalStudyofDecision).Thesisinthepublicationprocess.January2009.
Alvia,LizaandSulistiawan,Dedhy.(2009).EffectsTestingreviewerPresentationofInformationandKnowledge
onFundamental&TechnicalAnalysis:ExperimentalStudyonStockInvestmentDecisionMaking.Accounting
NationalSymposiumXII.
Asare,StephenK.(1992).TheAuditor'sGoingConcernDecision:InteractionofTaskVariablesandthe
SequentialProcessingofEvidence.AkuntansiUlasan.67(2).pp.379393.
Ashton,AH,danRHAshton.(1988).ASequentialBeliefRevisioninAuditing.TheAccountingReview,
pp.623641.
Bazerman.(1994).JudgmentinManagerialDecisionMaking.NewYork.Willey&Sons.Inc.
Baird,JaneE.danRobertC.ZelinII.(2000).TheEffectsofInformationOrderingonInvestorPerceptions:An
ExperimentUtilizingPresidentsLetters.JournalofFinancialandStrategicDecisions.13(3).pp.7180.
Beaver,WH(1989).FinancialReporting:AnAccountingRevolution.Edisikedua.EnglewoodCliffs.
NJ:PrenticeHall.
BudiHartono(http://www.behavioralfinance.net/).AccesesonApril20,2016.
Dilla,WilliamN.,danSteinbartPaulJ.(2005).RelativeWeightingofCommonandUniqueBalancedScorecard
MeasuresbyKnowledgeableDecisionMakers.BehavioralResearchInAccounting.17(4).pp.4556.
Friedrich,James,danSmith,Paul.(2015).SuppressiveInfluenceofWeakArgumentsinMixedQualityMessage:
An Exploration of Mechanism via Argument Rating, Pretesting, and Order Effects. Basic and Applied Social
Psychology,20(4),pp.293304.
Gul,A.Ferdinand.(1984).TheJointandModeratingRoleofPersonalityandCognitiveStyleonDecision
Making.TheAccountingReview,9(2),pp.264277.
Habbe,AbdulHamid.(2006).TestingHeuristicsandRepresentativenessAnchoringAdjustmentofthebehaviorof
the Over/Underreaction investor to gain information, and consequently the profit forecast and stock valuation.
Dissertation.LibraryUGMcenter.
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

164
Hair,Jr.JF,AndersonRE,TathamRL,Black(1998).MultivariateAnalysis.UpperSaddleRiver,NewJersey:
PrenticeHalllnc.
Hartono,Jogiyanto.(1998).TheEffectofTimingandOrderofEarningsandInitiatingDividentChangesonStock
Returns:aTestofBeliefAdjustmentTheory.SeminarAccountingResearchResults,Yogyakarta.
.........(2007).BusinessResearchMethodology:SalahKaprahandexperiences.Yogyakarta.BPFE.
.........(2004).How,WhyandWhenInvestorsReviseTheirBeliefsToCompanyInformationandTheir
ImplicationstoFirmsAnnouncementPolicy.Yogyakarta.ANDI.
Highhouse,S.danAndrewGallo.(1997).OrderEffectinPersonnelDecisionMaking.HumanPerformance:
2(3).pp.3146.
Hogarth,M.Robin,danEinhorn,Hillel.(1992).OrderEffectsinBeliefUpdating:TheBeliefAdjustment
Model.CognitivePsychology.24(1).pp.155.
.........WithouttheYear.OptimalStrategiesforPersonnelSelectionWhenCandidatesCanRejectOffers.
JournalofBusiness.
.........(1990).VentureTheory:AModelofDecisionWeights.ManagementScience.36(7).pp.5667.
........(1981).BehavioralDecisionTheory:ProcessesofJudgementandChoice.JournalAccountingResearch
19(1).pp.1829.
.........(1987).DecisonMaking:GoingForwardinReserve.HarvardBusinessReview.5(4).pp.87103.
Hogarth,M.Robin,danKunreuther,Howard.(2001).AmbiguityandInsuranceDecisions.RiskPerceptionand
MarketPerformance75(2).pp.4562.
Jr,MacDonaldAP.(1970).RevisedScaleForAmbiguityTolerance:ReliabilityandValidity.Psychological
Reports.26(1).pp.791798.
Kahneman,D.danA.Tversky.(1979).Prospecttheory:ananalysisofdecisionunderrisk.Econometrica.47(2).
pp.263291.
Krishnamoorthy,Ganesh.,JMTheodore.,danTWMary.(1999).AComparativeEvaluationofBelief
RevisionModelsinAuditing.Auditing:AJournalofPractice&Theory.
McGheeWalter,Shields,MichaelD.,andJaconG.Birnberg.(1978).TheEffectsofPersonalityonaSubject's
InformationProcessing.AkuntansiUlasan.3(3),pp.681697.
Messier,WilliamF.(1992).TheSequencingofAuditEvidence:ItsImpactontheExtentofAuditTestingand
ReportFormulation.AccountingandBusinessResearch.22(86).pp.143150.
Nasution,DamaiandSupriyadi.(2007).EffectofEvidenceOrder,theCognitiveStyleandPersonalityofthe
RevisionProcessConfidence.AccountingNationalSymposiumX.
Nelson,W.Mark,danKinney,R.William.(1997).TheEffectofAmbiguityonLossContingencyReporting
Judgement.AkuntansiUlasan.72(2).pp257274.
Pinsker,B.(2007).LongSeriesofInformationandNonprofessionalInvestors'BeliefRevision.Behavioral
ResearchinAccounting.19(1).pp.197214.
Sekaran,Uma.(2009).ResearchMethodsforBusiness.Jakarta.SalembaEmpatPublisher.
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

165
Suartana,IWayan.(2006).TestingandMechanismsPengurangbiasanRecencyEffect:ExperienceAudit,
AssessingIndividualandGroupAssessingtheAuditorConsiderations.UnpublishedDissertation.
Suartana, I Wayan. and Suhendro, S. Without the Year. Belief ModelAdjustment and Investor Perception:
ExperimentationcircuitShortInformationSimpleandSimultaneousResponse.Thearticlewasnotpublished.
Thaler,H.Richard.(1986).ThePsychologyandEconomicsConferenceHandbook:CommentsonSimon,on
EinhornandHogarth,andonTverskynadKahneman.JournalofBusiness.59(4),pt.2.
Tubbs,RichardM.,GaryJ.Gaeth,IrwinP.LevindanLauraA.VamOsdol.(1993).OrderEffectinBeliefUpdating
withConsistentandInconsistentEvidence.JournalofBehavioralDecisionMakingVol6:257269.
Tubbs,RichardM.,WFMessier,danWRKnechel.(1990).Notes:RecencyEffectinTheAuditor'sBelief
RevisionProcess.TheAccountingReview65(2).pp.452480.
Tuttle,B.,M.Coller,danFGBurton.(1997).AnExaminationofMarketEfficiency:InformationOrderEffects
inaLaboratoryMarket.Akuntansi,OrganisasidanMasyarakat.22(1).pp.89103.
Tversky,A.andD.Kahneman.(1974).JudgmentUnderUncertainty:HeuristicsandBiases.Science,185(4):
pp.11241131.
Wahyuni.S.,danJ.Hartono.(2011).Remindereffectandanchoringadjustmentinearningsannouncement.
UnpublisherdArticle.
Vol. 72 | No. 10 | Oct 2016 International Scientific Researches Journal

166