Anda di halaman 1dari 30

4/28/2017 belajarsinematografi|JustanotherWordPress.

comsite

belajarsinematografi

JUSTANOTHERWORDPRESS.COMSITE

IstilahistilahdalamProduksiFilmdanAcara
TV(Glossary)

15JUN

IstilahistilahdalamProduksiFilmdanAcara
TV(Glossary)

Acting:
Sebuahprosespemahamandanpenciptaantentangperilakudankarakterpribadidariseseorangyang
diperankan

AddesScenes:
Adeganyangditambahkankedalamkonsepasli,biasanyadiambilsetelahlmdiselesaikan

Agent(AgentModel):
Seseorangyangdipekerjakanolehsatuataulebihtalentagencyatauserikatpekerjauntukmewakili
keanggotaanmerekadalamberbegosiasikontrakindividualyangtermasukgaji,kondisikerja,dan
keuntungankhususyangtidaktermasukdalamstandardguildsataukontrakserikatkerja.Orangini
diharapkanolehparaaktor/aktrisuntukmencarikanmerekapekerjaandanmembangunkarirmereka

Anamorphic:
Lensayangdigunakandalamfotograuntukmemperkecilgambarwidescreenkeukuran35mm.
Prosesinidibalikketikamemproyeksikanhasilakhirlm,memunculkangambarkembalikeukuran
normalpadalayarlebar.

AnswerPrint:
MarriedPrintpertamadarilmyangdibuatolehlabpemroseslm,dankemudianakandigunakan
untukmenetapkanstandarkualitaslmyangakandiedarkankepadapublik.

AppleBox:
Digunakanuntukmeninggikanseorangaktor/aktrissertasuatuobyeksesuaidenganketinggianyang
tepatuntukpengambilangambar.

ArtDepartement:
Bagianartistik.Bertanggungjawabterhadapperancangsetlm.Seringkalibertanggungjawabuntuk
keseluruhandesainpriduksi.Tugasnyabiasanyadilaksanakandengankerjasamayangeratdengan
sutradara.
https://belajarsinematografi.wordpress.com/ 1/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

sutradara.

AscpectRatio:
Perbandinganantaralebardantinggibingkaigambar(frame)
Rasiountuktayangantelevisiadalah1,33:1yangartinyalebarframeyangmunculditelevisiadalah
1,33kalidaritinggi.

ArtDirector:
Seorangasistensutradaralmyangmemperhatikanadministrasi,halyangpentingsehingga
departemenproduksiselalumengetahuiperkembanganterbaruprosespengambilanlm.Ia
bertanggungjawabakankehadiranaktor/aktrispadasaatdantempatyangtepat,danjugauntuk
melaksanakaninstruksisutradara.

AvailableLighting:
Pengambilangambartanpatambahancahayabuatanmanusia

AudioVisual:
Sebutanuntukperangkatyangmenggunakanunsursuaradangambar

ArtDirector:
Pengarahartistikdarisebuahproduksi

AsistenProduser:
Seorangyangmembantuproduserdalammenjalankantugasnya

AudioMixing:
Prosespenyatuandanpenyelarasansuaradariberbagaimacamjenisdanbentuksuara.

Angle:
Sudutpengambilangambar

Animator:
Sebutanbagiseorangyangberprofesisebagaipembuatanimasi

AudioEect:
Efeksuara

Ambience:
Suaranaturaldariobyekgambar

Broadcaster:
Sebutanuntukseseorangyangbekerjadalamindustripenyiaran

Background:
Latarbelakang

BarnDoors:
Pintuberengselyangdipasangkandidepanlampustudioyangdapatdibukaatauditutupuntuk
memunculkancahayapadaareatertentudiset.

Barney:
Bungkuskainpadapelindungyangdapatdipakaikanpadakameralmataublimpedkameralm,
untukmengurangisiaramekanisme.Adajugaheatedbarneyyangdigunakandalamsuhudingin.

BestBoy:
AsistenGaeratauasistenKeyGrip.
Blank:
https://belajarsinematografi.wordpress.com/ 2/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Blank:
Selongsongsenapanataupistolyangberisipelurubuatanuntukmenggantikanpeluruyang
sesungguhnya.Blankdipergunakandalamlmuntukmencegahterjadinyakecelakaan,walaupun
sesungguhnyapelurukosongitusendirimasihberbahayajikaditembakandanmengenaiorangdalam
jarakdekat.

Blimp:
Ruangankedapsuarayangmengelilingikameralmuntukmencekahikutnterekamnyabunyi
mekanismekamerakedalamalatperekamsuara.

BlowUp:
Perbesaranukuranlmdari16mmke35mmyangdilakukandilaboratoriumuntukdiputardi
bioskop.Istilahinijugadipergunakandalamfotograuntukmemperbesarfotogunakeperluan
displayataupromosi.

BodyFrame,BodyPod:
Digunakanuntukmenunjanghandheldcameradilapangan.

BoomMan:
Individuyangmengoperasikanmikrofonboom.

BoothMan:
Operatorproyektorlm.Orangyangbekerjadalamruangproyeksi.

Breakaway:
Sebuahsetatauhandproperty,misalnyabotolataukursiyangdirancanguntukrusakdengancara
caratertentusesuaiabaaba.

Breakdown:
Biasanyamerujukpadajumlahspesikrincianpengeluarandalamsebuahproduksilm.Dapatjuga
berartipengaturanatauperencanaanberbagaiadeganbesertaurutanpengambilannya.

Budget:
Pengeluarankeseluruhandariproduksilm.

Blocking:
Penempatanobyekyangsesuaidengankebutuhangambar

BridgingScene:
Adeganperantaradiantaraadeganadeganlainnya

BackLight:
Penempatanlampudasardarisudutbelakangobyek

BreakdownShot:
Penentuangambaryangsesuaidengannaskahatauurutanacara

BumperIn:
Penandabahwaprogramacaratvdimulaikembalisetelahiklan

BumperOut:
Penandabahwaprogramacaratvakanberhentisejenakuntukiklan

Call:
Waktuyangdiharapkandariseorangindividuanggotastafperusahaan,pemain,ataukruuntuk
beradadiset.Jadwalbiasanyadidaftarkanpadacallsheetyangmenjaditanggungjawabasisten
sutradaradanmanajerproduksi.
https://belajarsinematografi.wordpress.com/ 3/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

sutradaradanmanajerproduksi.

Camera:
Sistemperangkatmekanikatauelektronikyangmengontrolpergerakandarilmyangbelumdiekspos
dibelakanglensadanshuerdanyangmenentukangambarsertatingkatancahayayangmasuk
kedalamlm.Mekanismeinimungkinmemilikikontrolkecepatan.

CameraBoom:
Tempatkamerayangdapatberpindah,biasanyaberukuranbesar,tempatkameradapatdiproyeksikan
keluarsetdanataudinaikandiatasnya.

CameraDepartement:
Bertanggungjawabuntukmemperolehdanmerawatsemuaperalatankamerayangdibutuhkanuntuk
memlmkansebuahmotionpicture.Jugabertanggungjawabuntukpenangananlm,pengisianlm,
danberhubungandenganlaboratoriumpemrosesan.

Cameraman:
FirstCameramanseringdisebutsebagaiPenataFotogra(DirectorofPhotography)ataukepala
kameramen,bertanggungjawabterhadappergerakandanpenempatankameradanjugapencahayaan
dalamsuatuadegan.Kecualidalamunitproduksiyangkecil,PenataFotogratidakmelakukan
pengoperasiankameraselamasyutingyangsesungguhnya.
SecondCameramanseringdisebutsebagaiasistenkameramenatauoperatorkamera,bertindaksesuai
instruksidarikameramenutamadanmelakukanpenyesuaianpadakameraataumengoperasikan
kameraselamasyuting.
FirstAssistantCameramenseringdisebutKepalaAsistenuntukpadaoperatorkamera.Seringkali
bertanggungjawabuntukmengaturfokuskamera(untukkameralm)
SecondAssistantCameraman,menjadiasistenoperatorkamera.

CameraNoise:
BunyiKamera.panggilandaribagiantatasuara(SoundDepartement)disetuntukmereangkanbahwa
iamenerimabunyidarikamerasehinggaharusdigunakankameralain,melakukanperbaikankamera
ataudiperlukanpenghalusantambahanterhadapkameradenganmenggunakanbarneyatauselimut.

CameraReport:
Salinanyangdisimpandalamtiapmagazinelmtempatasistenkameramenmencatatpanjang
pengambilantiapadegan,nomeradegan,danperintahuntukmencetakatautidak.Laporankamera
diberikankelaboratoriumproses,bagiankamera,danbagianproduksi.

CameraRight,CameraLeft:
Petunjukbagiseorangaktor/aktrisuntukberputarataubergerak.Petunjukiniberdasarkansudut
pandangsutradaraataukameradandibaliksesuaidengankeadaanaktor.Ketikamenghadaplensa
makabagiankananaktoradalahbagiankirikameradanjugasebaliknya.

CameraTracks:
LintasanKamerayangterbuatdarimetalataulembarankayulapisukuran4x8yangdiletakkan
dilantaiuntukmembawadollyataucameraboom.Lintasandigunakanuntukmenjaminkehalusan
gerakankamera.

Can:
Tempat/wadahuntuklm.

CannedMusic:
Musikyangbelumditulisuntuklmtertentunamuntelahdirekamdandikatalogkanmenurut
gayanyadalamperpustakaansehinggadapatdibelidandipergunakan.

CastingDirector:
https://belajarsinematografi.wordpress.com/ 4/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

CastingDirector:
Orangyangmemimpinpemilihandanpengontrakanaktor/aktrisuntukmemenuhibagianyang
dibutuhkandalamsebuahnaskah.

CenturyStand:
Digunakanuntukmenahanberbagaijenisbenderayangdiperlukanuntukmengurangiintensitas
cahayaatauuntukmenghalangisejumlahcahayatertentu.Jugadigunakanuntukmenahanatau
mendukungrantingdaunatauefeklainyangberhubungandenganpencahayaan.

ChangingBag:
Taskedapcahayadenganritsletinggandatempatmagazineslmdapatdiletakkanuntuk
memindahkanlmyangtelahdieksposedanmengisiulangmagazine.Jugadibuatsehingga
memungkinkanasistenkameramemasukkantangandanlengannyatanpamembiarkanlmterkena
cahaya.Biasanyadigunakanjauhdaristudiokaernadistudio,magazinediisiulangdiruanggelapdi
bagiankamera.

CharacterManorWoman:
Padasaatsaattertentuseorangaktor/aktrisbermainkarakter,biasanyaistilahinimerujukpada
aktor/aktrisyangpalingsesuaisecarasikuntukperanperanselainpemainutamaromantis,peran
remajaatauperansederhana.

Cinema:
MerujukpadaMotionPicture.BerasaldarikataYunaniKinemayangberartigambar.

CinemaScope:
Namadaganguntuktujuanpemrosesanfotogradanproyeksiyangmengikutsertakankamera
denganlensaanamorkatauproyektordanayarberlekukekstrapanjang.Memungkinkanproyeksi
darigambaryangjauhlebihbesardariukuranbiasanya.BanyaklmepicdibuatdalamCinemaScope
karenapengaruhdariukuranterhadappenonton.

Cinematographer(Sinematografer):
PenataFotogra.Orangyangmelaksanakanaspekteknisdaripencahayaandanfotograadegan.
Sinematograferyangkreatifjugaakanmembantusutradaradalammemilihsudut,penyusunan,dan
rasadaripencahayaandankamera.

Cinemobile:
Namadaganguntukunitlokasipembuatanlmyanglengkapdandaptberpindahpindah,membawa
peralatandanpetugasnyadanmemilikibanyakukuranmulaidarivanperalatankecilsampaidengan
busbesar.

ClapperBoards:
Sepasangpapanberengselyangdiketukkansaatsyutingdialogketikakameragambardanalatrekam
suaraberputardalamkecepatanyangsinkron.framepertamaketikapapanbersentuhankemudian
disinkronkandalamruangpemotongandenganbunyibang,memantapkansyncantaraalursuara
danalurgambar.Padabanyaktipesistempenandaelektronikdipasangkansisikamera.

Commercial:
Iklan.Filmpendekyangumumnyaberdurasi60,30,atau15detikyangdibuatkhususuntukmenjual
suatuproduk.

CompositePrint:
Filmyangtelahdiedittermasuksemuagambar,suara,danmusikyangtelahdicetakkedalamsebuah
lm.

ContactGlass:
https://belajarsinematografi.wordpress.com/ 5/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

ContactGlass:
Alatbantupenglihatanterbuatdarikacaberwarnagelapberbentuksepertimonacleyangdipakaikanke
salahsatumataPenataFotograselamapencahayaansetuntukmemeriksatingkatankontrasdari
pencahayaantersebut.

Cook,Cookie:
Dapatberupakaindenganbingkaikawatataulembarankayulapisatauplastikyangdiberipoladaun
rantingataubungauntukmemunculkanbayanganpadapermukaandatar.kadangburamatautembus
cahayaseperisebuahscrim.berasaldaribahasaYunanikukalorisyangberartimemecahcahaya.

CopterMount:
Copterkamerauntukpenggunaandalampengambilangambaraerialhelikopteryangberfungsi
menjagakameradarivibrasihelikopter.NamadagangnyaadalahTylerMount.

CostumeDesigner:
Orangyangmerancangdanmemastikanproduksikostumsecarasementaramaupunpermanenuntuk
sebuahlm.

Coverage:
Keseluruhankoleksihasilpengambilangambarindividual,sudut,dansetyangterdiridarisegala
kebutuhanlmuntukmembuatsebuahceritalengkap.

CoverSet:
Setyangdigunakanuntuksyutingbilaadeganeksterioryangdiusahakanternyatatergangguoleh
kondisicuacayangtidakmendukung.

CoverShot:
Bagiandaripengambilanlmuntukmenyediakanmateritransisidarisatubagianadegankebagian
adeganlaindalamsebuahadeganyangsama.Bisajugadigunakansebagaigamabrtambahanatau
cadangankalauperekamanpertamatidakberhasil.Jugadisebutsebagaiinsurance.

Cue:
Tandabagiaktor/aktrisdalamlmuntukmemunculkanbagiannyadalamdialogatautindakan.
Isyaratinidapatberupatindakanaktor/aktrislainnya,bagianakhirdarisebuahdialog,tandadari
sutradaraatauisyaratcahaya.

CueLight:
Bolalampukecilyangdapatdinyalakanataudimatikanolehsutradaraatauasistensutradaradan
diletakkandiluarjangkauanpandangkameratetapidalamjangkauanpandangaktoruntukmemberi
isyarat.Isyaratcahayainimenghindariisyaratsecaraverbalyangdimunculkanolehaktor.

CutandHold:
Perintahdarisutadaraagaradegandiberhentikannamunaktor/aktristetapberadadalamposisinya.
Sutradaramungkininginmemeriksapencahayaan,posisi,ataumengaturadeganlainyangsaling
bersinggungan.

CutBack:
Mengubahgambardalamlmsecaracepatdariadegansaatinikeadeganlainyangtelahdilihat
sebelumnya.PemotonganiniDilakukantanpaadatransisi.

CuingonTheAction:
Menggunakansebuahtindakanbesardariseorangaktor/aktrissebagaititikuntukmasuklebihdekat
ataulebihjauhdariorangtersebut.

CuingRoom:
https://belajarsinematografi.wordpress.com/ 6/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

CuingRoom:
Tempatperalatanseorangeditorlmberada,misalnyamovioladanlainsebagainyadantempatlm
akandigabungkansesuaiceritayangberkesinambungan.Ruanginibiasanyaadadalamsebuahstudio
namundapatsajaberadapadalokasitersendiridanterpisahdaridaerahstudio.

Cutto:
Secaracepatmengubahgambardalamlmdariadeganmasakinikeadeganlainnyatanpaadanya
transisi.

CreditTitle:
Urutannamanamatimproduksidanpendukungacara

ChromaKey:
Sebuahmetodeelektronisyangmelakukanpenggabunganantara
gambarvideoyangsatudengangambarvideolainnyadimanadalam
prosesnyadigunakanteknikKeyColouryangdapatdiubahsesuai
kebutuhanforegrounddanbackground

CuingonBeat:
Teknikpemotongangambarberdasarkantempo

ClipHanger:
Sebutanbagiadeganataugambaryangakanmengundangrasaingin
tahupenontontentangkelanjutanacara,namunharusditundakarena
adajedaiklankomersial

Cut:
Pemotongangambar

Cuing:
Prosespemotongangambar

CameraBlocking:
Penempatanposisikamerayangsesuaidengankebutuhangambar

ClearCom:
Sebutanbagipenggunaanheadsetaudioyangdihubungkandengan
MasterControl

Channel:
Saluran

CrazyShot:
Gambaryangdirekammelaluikamerayangtidakberaturan

Composition:
Komposisi

Continuity:
Kesinambungan

CrossBlocking:
Penempatanposisiobyeksecarasilangsesuaidengankebutuhan

Crane:
https://belajarsinematografi.wordpress.com/ 7/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Crane:
Alatkhusus/katroluntukkameradanpenatakamerayangdapat
bergerakkeatasdankebawah

ClipOn:
Mikrofonkhususyangdipasangpadaobyektanpaterlihat

Casting:
Prosespemilihanpemainsesuaidengankarakterdanperanyang
akandiberikan

CloseUp:
Pengambilangambardarijarakdekat

Dailies:
Hasilcetakanpositif,dikirimkansetiapharidarilaboratoriumberasaldarinegatiflmyang
dipergunakandiharisebelumnya.

DepthofFocus:
Areatempatberbagaibendayangdiletakkandenganberbagaiukuranjarakdidepanlensaakantetap
memperolehfokusyangtajam.

DialogueCoachorDialogueDirector:
Orangdalamsetyangbertanggungjawabmembantuparaaktor/aktrisdalammempelajarikalimat
merekaselamapembuatanlm.Mungkinjugamembantupengaturandialogsaatpresyuting.

Diusers:
Potonganmateridifusidiletakkandidepanlampustudiountukmemperhalus.

Director:
Orangyangmengontroltindakandandialogdidepankameradanbertanggungjawabuntuk
merealisasikanapayangdimaksudolehnaskahdanproduser.

Documentary:
Filmyangmenyajikanceritanyata,dilakukanpadalokasiyangsesungguhnya.Jugasebuahgaya
dalammemlmkandenganefekrealitasyangdiciptakandengancarapenggunaankamera,sound,dan
lokasi.

Dolly:
Kendaraan/alatberodauntukmembawakameradanoperatorkameraselamapengambilangambar.
DollybiasanyadapatdidorongdandiarahkanolehsatuorangyangdisebutDollyGrip.

Dollying:
Pergerakankameraselamapengambilangambardenganmenggunakankendaraan/alatberodayang
mengakomodasikankameradanoperatorkamera.Kadangdisebutjugatrackingatautrucking.

Double:
Bisadiartikanpemaintambahanyangmenggantikanaktor/aktrisselamapengaturancahayaatau
dapatberartistuntyangmenggantikanaktor/aktrisdalamadeganberbahaya.

DressTheSet:
Perintahuntukmenempatkanbanyakbenda(misallampu,asbak,bunga,ataulukisan)disetuntuk
memunculkanrealitas.

Drift:
https://belajarsinematografi.wordpress.com/ 8/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Drift:
Ketikaseorangaktor/aktrishampirtidakdisadaribergerakkeluardariposisinya.Dapatjugaberupa
petunjukuntukmenghilangdengansuatucaratertentu,denganartimelakukanperlahandan
bertahap.

DualRole:
Pemutaranlebihdarisatubagianperanseorangaktor/aktrisdalamsebuahlmyangsama.

Dubbing:
Perekamansuaramanusiasecarasinkrondengangambarlm.Suaranyamungkinataumungkintidak
berasaldariaktor/aktrisyangsesungguhnyasertabisajugabahasayangdigunakanketikalm
tersebutdibuat.
DubbingbiasanyadiselesaikandenganmenggunakanFilmLoopsbagianpendekdarisebuahgambar
besertadialognyadalambentukmarriedprint.Aktor/aktrismenggunakangambardansoundtrack
playbacksebagaipanduanuntukmensinkronkangerakanbibirdalamgambardenganperekaman
suaraterbaru.Umumnyadigunakanuntukmemperbaikiperekamanasliyangburuk.,performa
artistikyangtidakdapatditerimaataukemungkinankesalahandalamdialognya.Jugadigunakan
untukperekamanlagudanversibahasalainsetelahprosespemlman.

DullingSpray:
Sebuahpenyemprotaerosolyangmenyisakanlapisanyangtidakmengkilatpadapermukaanapapun
dantidakmengakibatkanpenyilauanpadalensakamera.

Durasi:
Waktuyangdiberikanataudijalankan

Dimmer:
Digunakanuntukmengontrolnaikturunnyaintensitascahaya

Dissolve:
Teknikpenumpukangambarpadaeditingmaupunsyutingmultikamera

DepthofField:
Areadimanaseluruhobyekyangduterimaolehlensadankamera
munculdenganfokusyangtepat.Biasanyahalinidipengaruhioleh
jarakantaraobyekdankamera,focallengthdarilensadanfstop

DramaticEmotion:
Emosigambarsecaradramatis

Editing:
Prosespemotongangambar

Editor:
Sebutanbagiseseorangyangberprofesisebagaiahlipemotongan
gambarvideodanaudio.

EditorialDepartement:
Divisidimanasemuapotonganlmyangtelahdihasilkandigabungkansehinggamembentukurutan
yangkoheren,kadangdenganbantuanasistensutradaraatauproduser.

ElectricDepartement:
Bertanggungjawabterhadappenjagaandanpenyediaansegalaalatelektrik.(misalnya:lampu,kabel,
danlainsebagainya)untukkebutuhanlm.

Electrician:
https://belajarsinematografi.wordpress.com/ 9/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Electrician:
Orangyangbertanggungjawabterhadappenempatandanpenyesuaiancahayasertamenyediakan
listriksesuaikebutuhantiapalat.

ExclusiveContract:
Kontrakyangmenyatakanbahwaseseorangdapatbekerjahanyauntukorangatauperusahaan
tertentuyangmengontraknya.

Exhibitor:
Orangatauperusahaanyangmemilikibioskopataudriveinataurantailainyangmemungkinkan
ditontonnyasebuahlm.
Teaterataudriveinyangmempertunjukkansebuahlm.

Exposed:
Bahanbakulmyangtelahdipakaiuntukmerekamgambar.Kataexposedwajibdicantumkanpada
setiapcanlmyangtelahdipakai.

Ext.:
Eksterior.Bagianmanapundarilmyangdirekamdiluarruangan;jalanankota,stadium,gurun,
hutan,ataupuncakgunung,beberapalokasidapatdibuatulangdisounstagestudionamuntetap
dinamakaneksteriordalamnaskah.

Extra:
Orangyangdipekerjakansebagaipemainlatar,misalnyasebagaisalahsatuorangdalamkerumunan
dalamadegandijalan.

Engineering:
Sebutandalampengerjaandanpembagiankerjadalammasalah
teknispenyiaran

EstablishShot:
Gambaryangnaturaldanwajar

ExtremeCloseUp:
Pengambilangambardarijarakdekat

FadeOut,FadeIn:
Efekberupagamabryangperlahanhilangdanmenjadigelap(fadeout)ataugambaryangmunculdari
kegelapan(fadein).Digunakanuntukmenekankanberlalunyawaktuatauakhirdariadeganatau
cerita.

FalseMove:
Gerakanyangtidakterencanaolehaktor/aktrissebelummelakukangerakanyangtelahdirencanakan.
FalseMoveyangdilakukanaktordapatmemunculkanmasalahdenganmengaturDollyGripuntuk
bergerakbersamadollydankamerakarenaiaberpikirbahwagerakanaktoradalahisyaratuntuk
menggerakankamera.

FastMotion:
Melakukanpemlmandengankecepatandibawahstandarkemudianmemproyeksikandengan
kecepatanstandaruntukmembuattindakanterlihatlebihcepatdarinormal.Jugamenciptakanefek
masalaludanlmbisu.

FeaturePart:
Peranyangtidakterlalupentinguntukseorangbintang,tapicukupbesaruntukmemunculkan
perhatiankhusus.Biasanyadilakukanolehaktor/aktrisyangtelahdikenalbaikolehpenonton.Saatini
lebihdikenaldenganCameo.
https://belajarsinematografi.wordpress.com/ 10/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

lebihdikenaldenganCameo.

Fiftyfty:
Biasanyasudutkameraataupengambilangamabrketikaduaorangaktor/aktrissalingberhadapan,
berbagilensadenganadil.Jugadisebutsebagaiatwoshotatauatwo.

FillLight:
Setpencahayaanumumyangdigunakanuntukmemperhaluskontrasdarikeylighting.

Film:
Mediauntukmerekamgambaryangmenggunakanselluloidsebagaibahandasarnya.Memiliki
berbagaimacamukuranlebarpitaseperti16mmdan35mm.

FilmClip:
Bagianpendekdarisebuahlm.

FilmLoader:
PengisiFilm.Anggotatimkamerakadangadalahasistenkameramenyangmengisilmyangbelum
dieksposekedalammagazinedanmengeluarkanlmyangtelahdieksposekedalamcan.

FirstRun:
Pertamakalisebuahlmdilepaskebioskopuntukditonton.Saatinilebihdikenaldenganpremiere.

FishpoleBoom:
Sebuahtiangringanyangdapatdigenggamdandapatdipindahkanuntukdigunakanmeletakkan
mikrofondilokasiyangsulitselamapemlman.

Flag:
MiniaturGobodarikayulapisataukainpadabingkaimetalyangdiletakkanpadacenturystand.

Flare:
Ketikasuatuobyekataucahayadarisetmemantulkancahayayangtidakdiinginkanscaralangsung
padalensa.

Flashback:
Bagiandariceritalmyangmengisahkanwaktuperiodeawal,tergantungdaricerita.

Flub:
Ketikaaktor/aktrismelakukankesalahandalampengucapandialogubbedhisline

FluidHead:
Landasanpadatripodkamerayangmemberikangerakanhalusuntukkameramelaluipenggunaan
ywheelyangdiletakkandalamwadahberisiminyakdalamlandasanitusendiri.

Focus:
Penyelarasangambarsecaradetail,tajam,danjernihhinggamendekati
obyekaslinya

FogMaker:
Menggunakancairankhusussehinggafogmakerdapatmemunculkanefekkabut,asap,efekkabur
(blur),dankelembaban.Denganmenggunakancairanjenislainmakadapatdigunakanuntuk
menghilangkankaburyangtidakdiinginkan.Alatinidapatberukurankecil,mesinyangdapat
digenggamataumesinbesaryangdiletakkandikereta.

FollowFocus:
https://belajarsinematografi.wordpress.com/ 11/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

FollowFocus:
Perubahanfokuskameraselamaadeganuntukmempertahankanfokuspadaaktor/aktrisyang
bergerakmendekatiataumenjahuikamera.Biasanyamenjaditugasrstassistantcameraman.

FollowShots:
Pengambilangambardengankamerabergerakmemutaruntukmengikutipergerakanpemerandalam
adegan.

FinalEditing:
Prosespemotongangambarsecaramenyeluruh

FloorDirector:
Seseorangyangbertanggungjawabmembantumengkomunikasikan
keinginansutradaradarimastercontrolkestudioproduksi

Footage:
Gambargambaryangtersediadandapatdigunakan

FootageCounter:
Alatpenghitungyangberadapadakamerauntuktetapdapatmengikutijumlahlmyangtelah
diekspose.

FourWalledSet:
Sebuahsetyangmemiliki4dindingbukan3sepertibiasanya.Keempatdindingmenutupareaaksi
secarasempurnanamunmungkindapatdipindahkanuntukmemungkinkanpergerakancahayadan
kameraselamamelakukanpengambilangambar.

Frame:
Suatugambardaribanyakgambarpadagulunganlmyangtelahdiekspose,ukuranframe
bervariasisesuaiformatyangakandiambilgambarnya.
Menyesuaikankameradanlensasehinggagambaryangakandiambilmemilikibatasanyang
diinginkan.

FrameperSecond(fps):
Sebuahlm35mmberputardalamkameradengankecepatannormalmenghasilkan24frame
perdetiknyasehinggabilabanyakframeyangdiputartiapdetiknyaaksidarisubyekakandiperlambat
ketikadiproyeksikandalamkecepatannormal.Bilalebihsedikitdari24frameyangdiputarmakaaksi
tampatdipercepatbiladiproyeksikandengankecepatannormal.

Freelancer:
Orangyangtidakterikatkontrakdenganproduseratauperusahaanmanapun.

Freeze:
Perintahbagiaktor/aktrisuntukmenghentikanaksinamunmempertahankanposisinya.Dalamlm
yangaktor/aktrisatauobyeklainmunculdengantibatibamisalnyapopinpadalayarmaka
aktor/aktrisdalamadeganakandimintauntukdiam.Orangatauobyekkemudianditempatkandi
posisinyakemudianperintahuntukactiondiberikandanadegandilanjutkan.Dalampemotongan
lmdibagiantengahdarimasuknyaaktor/aktrisataupenempatanobyekakandihilangkan.

Gaer:
PemimpinelectricianyangbertanggungjawabdibawahDirectorofPhotographymengenaipencahayaan
set.

GearedHead:
https://belajarsinematografi.wordpress.com/ 12/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

GearedHead:
Unitdimanakameradipasangkanyangdapatdihubungkanpadadollyataucranedanpanned
(gerakansecarahorisontal)atautilted(gerakansecaravertikal)memungkinkankamerauntuk
mengikutigerakan.

Gen:
Trukgeneratoryangdigunakanuntukmenyediakantenagalistrikketikaunitlmberadadilokasi
atautambahanpenyediaantenagadistudio.Jugadisebutsebagaigenset.

Gobo:
Layarkayuyangdicathitam.Digunakanuntukmenghalangicahayadarisatiataulebihpencahayaan
lampustudio,suatusetperalatanyangdigunakanuntukmecegahjatuhnyacahayayangtidak
diinginkankelensakameraatauareaset.Biasanyadiletakkanpadasanggahanyangdapat
disesuaikan.Gobotersediadalamberbagaibentukdanukuran.

GreenDepartement:
Bertanggungjawabuntukmenyediakanpepohonan,semak,bunga,rumput,danbendabendahidup
lainnyabaikyangaslimaupunbuatan.

Grip:
Orangyangberwenangmemindahkandanmengaturtrekataujalannyakameraapapunyang
membutuhkancengkeramanyangkuatdiset.

GripChain:
Rantairinganyangdigunakanuntukberbagaikeperluanyangdilakukanolehbagiangrip.padaset
biasanyadigunakanpadasekitarkakikursiatausofayangditempatipemainuntukmencegahnya
bergerak.

Hairdresser:
Spesialispenatarambutuntuklm.Seoranghairdressermungkinbekerjadenganpenatarambutlaki
lakimaupunperempuan.

HairdresserDepartement:
Bertanggungjawabataskebutuhanrambutaslimaupunwiguntukparaaktordanaktris.

HandCue:
biasanyadiberikanolehsutradaraatauasistennyauntukmenunjukanwaktumasukseorang
aktor/aktrisataubagiankhususdarisuatuadegan.

HandHeld:
Mengambilgambardengankameraringansepertihandycam,jenisyangdapatditahanolehoperator
kameradengantangannyaselagimengambilgambar,berlawanandenganmeletakkannyapadagear
headatautripod.Memberikaneksibilitasyanglebih.Teknikpenggunaankameradengantangan
tanpatripod

Headroom:
Ruanganbagianatassuatuobyekdalamgambardenganbagianatasframe.

HighHead:
Tripodlogamkecildenganketinggiantertentuyangdapatdipasangkankelantaiuntuk
mempertahankanposisinya.Digunakanuntukmenahankamerasaatpengambilangambardengan
sudutrendah.

HotSet:
Suatusetyangtelahdiisibarangdandekoruntuksyuting.Penggambaraninibiasanya
mengindikasikanbahwasettersebuttidakbolehdimasukiataudigunakan.
https://belajarsinematografi.wordpress.com/ 13/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

mengindikasikanbahwasettersebuttidakbolehdimasukiataudigunakan.

HotSpot:
Areadalamsetyangmemilikipencahayaanyangsangatterang.

HuntingLocation:
Prosespencariandanpenggunaanlokasiyangtepatdanterbaik
untuksyuting.

IdiotCards:
Kartubesartempatdialogdituliskanuntukaktoryangtidakdapatmengingatkalimatnya.Dapatjuga
berartisebuahbagianmesinelektronikyangmahaldisebutTelePrompter,dimanasebuahgulungan
kertasditempatkandidepanataudekatdengankameradandituliskandialognyadenganhurufyang
besarsehinggamudahuntukdibaca.BisajugadisebutdenganCuecards.

Independent:
Seseorangyangmembuatlmtanpadipekerjakanolehsebuahstudiobesar.

InsertShot:
Suatuobyekbiasanyayangdicetaksepertisuratkabaratausebuahjam,dandimasukkankedalam
rangkaianuntukmenjelaskantindakan.

Int.:
Interior.Bagiandarilmyangdiambildidalamruangan.Interiordapatberupasetyangdibentukdi
studioataudiluarstudio.Lebihdikenalsekaranginisebagailocationinteriors.

Intercut:
Mengubahurutantindakandaribelakangkedepandarisebuahadegankeadeganlain,biasanya
dilakukandengankecepatancukuptinggi.

Iris:
bagianyangterbukadarisebuahlensaataubagianbelakangyangmengaturmasuknyacahayakdalam
lm.ukuranIrisdapatdikontrololehoperatorkamera.

Jell:
Gelatinataumateriplastikberwarnayangdigunakandidepansebuahlampuuntukmengubahwarna
cahayadarilamputersebut.BisajugadisebutdenganGel.

JumpingShot:
Prosespengambilangambarsecaratidakberurutan

JimmyJib:
Katrolkameraotomatisyangdigerakandenganremote

KeyGrip:
Orangyangmemimpinparapekerjagrip.

KeyLight:
Cahayautamayangdigunakanuntukmenerangisubyektertentu.

Lab:
Secaraumumdisebutsebagaisuatutempatuntukmemprosesexposedlmpadatahapakhir.

Lens(Lensa):
https://belajarsinematografi.wordpress.com/ 14/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Lens(Lensa):
Konstruksidariberbagaimacampotongankacayangdipasangsesuaikebutuhandandimasukkan
kedalamtubemetal.Beberapajenislensabersifattetapdalamartitidakdapatdiubahubah
panjangnya.

LightMeter:
Instrumenkecildandapatdipegangdengantanganyangdigunakanuntukmengukurintensitas
cahaya.

LiningUp:
Membatasiadegan.Operatorkameraatausutradaramengaturpenempatankamerasehingga
mencakupruangpengelihatanyangdiinginkan.Dapatjugaberartiframing.

Limbo:
Melakukanpengambilangambarpadaareaatausetyangtidakdapatdijelaskansebagaisuatulokasi
khusus.Dapatdigunakanuntukadegancloseup,insert,danlainsebagainya.

LipSync:
Sesiperekamansaatseoarangaktor/aktrismenyesuaikansuaranyadengangerakanbibirdarigambar.

LocationDepartement:
Bertanggungjawabuntukmendapatkanlokasikhususyangdibutuhkanuntuksyutinglmserta
membuatpenagturanagarseluruhkrudanperalatandapatmencapailokasitersebut.

LongFocusLens:
Istilahyangrelatifdigunakanuntukmenggambarkanlensayanglebihpanjangdariukuranfokus
normal(telephoto)danmemberikanperbesaranimage.

Looks:
Arahkhususyangdimintapadaaktor/aktrisuntukmenagrahkanmatanyadengantujuanuntuk
menyesuaikantindakanpadagambarsebelumnya.Bisajugauntukmengindikasikanlokasiseseorang
ataubendayangtidakadadalamgambar,misalnyadiluarkamera.

LongShot:
Gambardirekamdarijarakjauh.Biasanyadigunakandengancara
pengambilangambardarisudutpanjangdanlebar.

Magazine:
Wadahlmyangmembentukbagiandarisuatukameraatauproyektor.Magazinebersifattahan
cahayasertatidakmemungkinkancahayauntukmasukkelmyangbelumatausudahexposed
didalammagazine.

MagneticRecorder:
Alatperekampitamagnetik.

MakeUpCall:
Waktuuntukaktor/aktrisberadapadabagianmakeupatauruangriassebelumdimulainyasyuting.

MakeUpDepartement:
bagianyangbertanggungjawabterhadappenampilanaktor/aktrisagarsesuaidengankebutuhan
skenariopadasaatsyuting.

MarkIt:
Perintahterhadapasistenkamerauntukmelepaskanclapperstickpadaslateboarduntukmemberikan
tandasuarapadaadeganketikakamerasedangberjalanpadakecepatanfotogra.
Marks:
https://belajarsinematografi.wordpress.com/ 15/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Marks:
Digunakanuntukmemberikanreferensipadaaktor/aktrisataudollymengenaiposisitertentudalam
suatuadegan.Tandainidapatdibuatditanahataulantaidenganmenggunakankapur,kertasperekat,
teesatausegitigadarikayusertametal.

MarriedPrint:
Gabunganantaratrackgambardansuarasetelahlmtersebutselesaidiedit.Istilahinitidakdikenal
dalamproduksidenganmenggunakanformatvideo.

Match:
Menghasilkanulangsuatutindakanyangdilakukandalamadeganlainsehinggakeduanyadapat
dipotongsehinggamenghasilkanposisiygdapatdisesuaikan.

MatchingDirections:
Penyesuaianadegandalamlmseperimasukdarikirikekanansehinggaorangataualattransportasi
dalamlmtidakmemilikiarahyangterbalikketikapengambilangambarlaindimasukkan.

Mae:
Sebuahcutoutataupenutupsebagianyangdiletakkandidepanlensauntukmencegaheksposedari
bagianlm.Misalnyasepasangkembaridentiksedangberbicara,padahalhanyasatuaktor/aktrisyang
memerankanperantersebut.

MaeBox:
Sebuahframeyangdipasangdidepanlensakameradandidesainuntukmenahanmaekamerayang
digunakanpadasuatuefekkhusus.MaeBoxbiasanyadikombinasikandengansunshade.

MeasuringTape:
Alatukuryangdigunakanuntukmengukurjarakdarilensakesubyekdengantujuanuntuk
menentukanfokussecaratepat.

MicrophoneShadow:
Munculnyabayangandarimikrofonpadabagiansetyangmasukpadaareapandangkamera.Bila
munculpadagambarmakaitsanono(gambartidakterpakai)

MockUp:
Tiruansuatubendayangdibuatsepertiaslitapihanyaberupabagiantertentusajamenurut
kebutuhan.

Montage:
Urutangambaryangmengalir,menyatu,ataukadangdipotongdariyangsatukeyanglainnya.
Digunakanuntukmemperlihatkanpeningkatanataupembalikanwaktuterhadapperubahanlokasi.

M.O.S.:
Porsigamabrdarisebuahadeganyangdiambiltanpamerekamsuaranya.Inisialiniawalnyamuncul
darisutradaraEropayangtidakdapatmengucapkanWSdanmengatakanMitOutSound.

MovingShot:
Teknikpengambilangambardariobyekyangbergerak.

MusicDepartement:
Bertanggungjawabdalampengaturanataumenyediakanmusikyangakandigunakandalamlm.

MasterControl:
Perangkatteknisutamapenyiaranuntukmengontrolprosesdistribusiaudiodanvideodariberbagai
inputpadasuatuproduksiacara
MediumCloseUp:
https://belajarsinematografi.wordpress.com/ 16/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

MediumCloseUp:
Pengambilangambardarijarakyangcukupdekat

MediumShot:
Gambardiambildarijarakdekat

MediumLongShot:
Gambardiambildarijarakyangpanjangdanjauh

MiddleCloseUp:
Pengambilangambardarijaraksedang

MasterShot:
Gambarpilihanutamadarisebuahadeganyangkemudiandijadikanreferensiataurujukanpadasaat
melakukanprosesediting.

N.G.:
NoGood(tidakbaik)Istilahinidipakaisebagaikomentarterhadappengambilangambaryangtidak
baikpadalaporankameradansuara,misalnyaN.G.Sound,N.G.Action

NTSC(NationalTelevisionStandardsCommiee)
SistemwarnatelevisiyangdipergunakandinegaraAmerikaSerikatdanbeberapanegaralainnya,
NTSCterdiridari525garispemindaianyangberadapadarate30frameperdetiknya.

NonExclusiveContract:
Kesepakatandimanasesorangdijaminuntukikutdalamsejumlahproduksinamundiperbolehkan
untukbekerjapadaproduksilainnya.

NonTheatricalFilm:
Filmyangtidakdipertontonkandibioskopmelainkanuntuklmpelatihan.

O.S.:
OScreen(tidaktampakpadalayar)

Outs,OutTakes:
Bagiangambaryangtidakmasukpadaversilengkapdarisebuahlm.

Overlap:
Perintahuntukaktor/aktrisagarmemulaidialogtanpaharusmenunggupemeranlainnya
menyelesaikandialognya.

OpeningScene:
Adeganyangdirancangkhususuntukmembukaacaraataucerita.
Biasanyaadeganinidikemassecarakreatifdanmenarikuntuk
mendapatkanperhatiandaripenonton

PAL(PhaseAlternationbyLine):
SistemwarnatelevisiyangpertamakalidibuatdiJerman,dandigunakandiEropadanbeberapa
negaralaintermasukIndonesia.PALterdiridari625garispemindaianberadapadarate25frame
perdetiknya.

Plot:
Alurceritadarisebuahnaskah.

P.O.V.:
PointofView(SudutPandang).
Practical:
https://belajarsinematografi.wordpress.com/ 17/30
PointofView(SudutPandang).
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Practical:
Deskripsidarisesuatudalamsebuahsetlmsepertipadakehidupannyata.Misalnyakomporgas,bak
cuci,pintuterbuka,pencahayaanlampu.

Print:
Perintahketikapengambilangambartelahlengkapdandikirimkelaboratoriumuntukdikembangkan.

Producer:
Sebutaniniuntukorangyangmemproduksisebuahlmtetapibukandalamartimembiayaiatau
menanamkaninvestasidalamsebuahproduksi.Tugasseorangproduseradalahmemimpinseluruh
timproduksiagarsesuaidengantujuanyangtelahditetapkanbersama,baikdalamaspekkreatif
maupunmanajemenproduksidengananggaranyangtelahdisetujuiolehexecutiveproducer.

ProductionDepartement:
Bagianyangmenentukanbatasanbiayadanmenanganipersiapandanpelaksanaanatassegala
keperluandalamsebuahproduksi.

ProductionAssistant:
Bertanggungjawabatassegalahalyangterjadidilapanganselamaprosesproduksi.

ProductionManager:
Orangyangbertanggungjawabatasdetailproduksidariawalsampaiproduksiituselesai.

ProductionUnit:
Terdiridarisutradara,krukamera,krutatasuara,bagianlistrikdansemuaorangyangdiperlukan
dalamsuatuproduksi.

PropBox(KotakProperti):
Tersediadalamberbagaibentukdanukuransertamemilikirodayanggunanyasebagaitempat
penyimpananbarangbarangkebutuhansuatuproduksi.

PropMan:
Bertugasuntukmemastikanbahwapropertiadaditempatyangseharusnyapadasaatdibutuhkan
untuksuatuproduksi.

PowerPack:
Tempatkhususuntukpembagianaruslistrik

Panning:
Pergerakanhorisontalkameradarikirikekananmaupunsebaliknya

RainCluster:
Sebuahperangkatsprinkleryangdapatdigantungdiataskepalauntukmemberikansimulasiefekdari
hujan.Disiniseringmemakaisemburandarimobilpemadamkebakaran.

RawStock:
Filmyangbelumdiekspose.

ReactionShot:
Pengambilangambaryangdimasukkandalamsebuahadeganuntukmenunjukkanefekkalimatatau
tindakanterhadappartisipanlaindalamadegantersebut.

ReelofFilm:
Jumlahlmyangakandiproyeksikandalamwaktu10menit.900feetuntukukuran35mmatau360
feetuntukukuran16mm.Gulunganstandardapatmenampunglmsepanjang1000feetuntuk35mm
dan400feetuntuk16mm.
https://belajarsinematografi.wordpress.com/ 18/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

dan400feetuntuk16mm.

Reector:
Pemantulyangpermukaannyaberlapisperakdigunakanuntukmemantulkancahaya.Untuk
pengambilanlmeksteriorreektorseringdigunakanuntukmengarahkansinarmataharikebagian
dalamsuatuadegan.

ReleasePrint:
MarriedPrintyangdibuatuntukdidistribusikankebioskopsetelahanswerprint(telahdisetujui)

ReLoad:
Penandadaridepartemenkameraatautatasuaraketikamerekatelahkehabisanpersediaanuntuk
merekam.

Remake:
Produksisuatulmyangsebelumnyatelahdiproduksi.

ReRun:
Memutarulangsuatulmatauacaratelevisi.

ResearchDepartement:
bagianrisetyangterdiridariorangorangyangmenilaiotentisitasartikel,benda,kostum,dan
peristiwadalamsebuahlmsebelumproduksilmtersebutdijalankan.

Resolution,ResolvingPower:
Kemampuanlensaataulmuntukmenangkapsertamenunjukkandetailyanghalus.

ReTake:
Pengulangansebuahadegandalamsyuting.

Reverse,ReverseAngle:
Lawandarisudutkameradariadeganyangbarusajadiselsaikanuntukmemperlihatkansisilaindari
gambar.

Rigging:
Sebuahrangkapondasiuntukpenyanggalampupeneranganpadasuatuset.Seringdisebutjuga
denganScaolding.

Roll,Roolem:
Perintahyangbiasanyadiberikanolehasistensutradaraketikasutradaramerasaadegantelahsiap
untukpengambilangambardenganmemfungsikankameralmdanperalatanrekamlainnya.

RoughCut:
Penggabungandariberbagaiadeganlmmenurutsuatuceritayangkomprehensip,biasanyasudah
dengandialogdansoundtrack.

RunningShot:
Menggerakkankamerauntukmenyesuaikandenganaktor/aktrisketikamerekamenyeberangisetatau
lokasi.

Rushes:
Cetakandarihasilpengambilangambarhariituyangdiprosespadahariyangsamasehinggadapat
dilihatpadabesoknya.

Rundown:
https://belajarsinematografi.wordpress.com/ 19/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Rundown:
Susunanisidanalurceritadariprogramacarayangdibatasioleh
durasi,segmentasi,danbahasanaskah

RunThrough:
Latihanakhirbagiseluruhpendukungacarayangdisesuaikandengan
urutanacaradalamrundown

Retake:
Pengambilanulangsuatugambar/adegan

Sandbag:
Tas/bungkusanberisipasiruntukpemberat.

Scouting:
Mencarilokasiuntukproduksiataubisajugamencariorangyangberbakat.

ScreenPlay:
Naskahlengkapyangmenjadibahanuntukmelakukanproduksilm.

ScreenTest:
Sebuahadeganyangmemberikankesempatanbagiaktor/aktrisuntukmemperlihatkan
kemampuannya.Adeganinibiasanyadiambildarilmuntukmempertimbangkanseorang
aktor/aktrisdiambillengkapdenganmenggunakankostum,set,danriasan.

Scrim:
Sebuahbenderayangdibuatdarimateritembuscahaya.Kegunaannyaadalahsebagianuntuk
mengurangidanmendifusikansumbercahaya.Beradaditengahantarasebuahgobodansebuah
diuser.

ScriptSupervisor,ScriptClerk:
Bertanggungjawabuntukmencatatseluruhadegandanpengambilangambaryangdiproduksi.
termasuksemuainformasiyangdiperlukansepertidurasi,arahgerakan,penagrahanmimikwajah,
penempatanaktor/aktrisdanproperti,sertagerakansikyangharusdisesuaikanaktor/aktrisdalam
semuacakupanyangberurutanuntukkemungkinanpengambilangamabrulang.Semuainformasiini
dimasukkandalamsalinannaskahmiliksupervisinaskahdandigunakanoleheditorketikatahap
editing.Dalamsalinaninijugadimasukkancatatandarisutradarauntukeditor.

Sequence:
Sebuahrangkaianadegan.

Shuer:
Mekanismekamerayangmencegahcahayamasukkelmdiantarapengukuranframeseginggaserial
fotoyangterpisahmemilikijarakwalaupungulunganlmtetapdiputardalamkamera.

Sneak,SneakPreview:
Pemutaranlmdibioskoptanpapemberitahuansehinggapembuatlmdapatmemperolehtanggapan
daripenontonsebelumdidistribusikansecaraumum.Seringkalitanggapandaripenontonuntuk
membuatperubahandalamlmyangmenurutproduserakanmembuatlmtersebutlebihberhasil
dipasaran.

SoftFocus:
pengambilangambardenganlensayangdiatursedikitoutoffocussehinggasubyektampakagak
buram.seringkalidigunakanketikamemfotoseorangaktor.aktrisyangmulaiterlihatberkerut.

SoftLight:
https://belajarsinematografi.wordpress.com/ 20/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

SoftLight:
Pencahayaanlampuyangmemungkinkantidakmenghasilkanbayangandanberpendarsecara
keseluruhan.

SoundCamera:
Kamerayangberoperasidengantenanselamaperekamangambarsehinggasuaradapatdirekamtanpa
adanyabunyidarikamera.

Splice,Splicing:
Penggabunganakhirdari2buahlmsehinggaterbentuksebuahkesatuanyangberkesinambungan.
Prosesinidisebutsplicing,hubungannyadisebutsplice.

Sprocket:
Rodadengangerigiteraturyangmencengkerambagianpinggirlmuntukmenggerakkannyadidalam
kamera.

Stillman,Photographer:
Bertanggungjawabataspubliitasdanpembuatanfotosetsertalokasi.Dapatjugadigunakanpada
kesempatantertentu.

StopFrame:
Pengulangansebuahframelmuntukmemberikanefekdiampadaaksi.Jugadisebutdenganfreeze
frame.

StoryBoard:
Sketsayangmenggambarkanadegandalamlm.Digunakanuntukmempemudahpengambilan
gambar.

Sunshade(LensShade):
Kotakpersegipanjanguntukmeningkatkanukuranlensakeluar,dipasangkanpadakameradiabgian
lensadepanuntukmencegahmasuknyacahayakedalamlensa.

Super,Superimposure:
Penempatansebuahgambardiatasgambarlainnya,misalnyatitleatausubtitleterjemahanbahasa.

SwishPan:
Gerakanpanningketikakameradigerakkansecaracepatdarisebuahsisikesisilainnya,menyebabkan
gambarmenjadikaburuntukmemunculkankesangerakanmatasecaracepat.

SimplyShot:
Gambaryangdiambildarisudutyangmudah

ScriptFormat:
Formatpenulisannaskahacara

ScriptMarking:
Penandaanpadanaskahuntukmenjadicatatanbagisutradaramaupun
pendukungproduksilainnya

StockShot:
Berbagaibentukgambaryangdiciptakanuntukmenjadipilihanpada
saatgambargambartersebutmemasukiprosesediting

Suspense:
https://belajarsinematografi.wordpress.com/ 21/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

Suspense:
Istilahyangdigunakanuntukmenunjukkanadeganyangmenegangkan
danmengundangrasawaswasbagipenonton

SteadyShot:
Gambarsempurnadantidakterlalubanyakbergerakdandapatdinikmati
denganposisidiam

SlowMotion:
Pergerakangambaryangdiperlambatsesuaidengankebutuhancerita

Tag,TagLine:
Kalimatatautindakandalamsebuahadeganterakhirdarisebuahlmyangdiharapkandapatmenjadi
puncakdariapayangtelahdisuguhkansebelumnya.

Teaser:
Adeganpertamadarikeseluruhangambardaricerita.Biasanyaadeganyangmenarik,digunakandi
televisi.

TelePhotoLens:
Lensadenganpanjangfokuslebihbesardarinormalyangdigunakanuntukmembuatobyekjauh
menjadidekat.

ThatsaHold:
Perintahdarisutradarapadascriptsupervidordanasistenkamerabahwapengambilangambaryang
barusajaselesaitidakakandikirimkelabuntukdicetaktapidiberilabelholdsampaipengambilan
gambarlainnyatelahselesaidansutradaramemutuskangambarmanayangakandicetak.

Tilt:
Menggerakankamerasecaravertikal(naikturun)

ToneTrack:
Soundtrackyangmemunculkanbunyilataryangdiasosiasikandenganlokasiinterorataueksterior.
Suarainibiasanyatidakdisadarinamunmemberikansentuhanrealitasyangdibutuhkanolehsebuah
lm.

TopLighting:
Cahayadarisumberyangdiletakkandiatassubyeksehinggaturunmenyinari.

TransportationDepartement:
Bertanggungjawabterhadapsemuakendaraanyangdigunakanolehkrudanpemainselamasyuting
berlangsung.Dalamhalinitermasukantardanjemputkruataupemain.

Treatment:
Presentasidetaildariceritasebuahlmnamunbelumberbentuknaskah.

Triangle:
Alatyangdigunakanuntukmenahankakikakitripodagartidakbergerakjikadiletakkandilantai
yanglicin.

Two/ThreeShot:
Perintahyangseringkalidigunakanolehsutradarauntukmengarahkankamerapadadua/tigaobyek
yangdituju.

UnitManager:
https://belajarsinematografi.wordpress.com/ 22/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

UnitManager:
Bertanggungjawabataskelancaranoperasiperusahaanlmdilokasi.

VariableSpeedMotor:
Variasikecepatanlmdikamerauntukkeperluanefekkhusus.

Viewnder:
Instrumenoptikyangdiletakkansampingkiriblimpyangmemungkinkanoperatorkamerauntuk
mengikutiaksisementarakamerasedangberputar.

VoiceCue:
Sinyalvokaldarisutradaraatauaktor/aktrisdalamadeganbahwasudahwaktunyaaktor/aktrislain
masuk.

VTR:
VideoTapeRecording

VeryLongShot:
Gambaryangdiambildarijarakyangsangatjauh

VoiceOver:
Suaradariannouncerataupenyiaruntukmendukungisicerita(narasi)

WardrobeBox:
Kotakpenyimpanankostum.

WardrobeDepartement:
Bertanggungjawabataspemilihankostumyangakandipergunakanuntukproduksi.

WildLine:
Kalimatyangbiasanyadirekamsetelahpengambilangambarataudiakhirsyutingpadahariitu.
Dipergunakanuntukmengulangkalimatdarisuatuadeganyangtelahdiambilkarenatidakjelas.

WhiteBalance:
Proseduruntukmengoreksiwarnagambardarikameradengan
mengubahsensitivitasCCDkedalamspektrumwarna.
Umumnyaprosedurinimenggunakanwarnaputihsebagaidasar

WildRecording:
Perekamanyangtidakdilakukanselamaprosesfotogra.efeksuaradanbunyiacakbiasanyadirekam
dengancaraini,kadanguntuknarasidanmusikjuga.SeringkalidisebutNonSync.
WindMachine:
Kipasanginbesaryangditutupdengankawatpengaman.Digunakanuntukmenciptakanefekangin.

Wipe:
Efekoptikantara2gambardimanagambarke2mulaidibagianluarlayardanmenghapusgambar
pertamasampaidengangarisyangmasihterlihatdanpadaakhirnyamenutupigambarpertama.

Wrap:
Perintahyangdigunakanuntukmemberitahukanpadasemuaorangbahwasyutingpadahariitu
sudahselesai.

Leaveacomment
Postedbykechenk1903onJune15,2011inUncategorized
https://belajarsinematografi.wordpress.com/ 23/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

ScriptBreakdown

03JUN
Sebelummasukkeprosespengambilangambar,terlebihdahuluharusmempersiapkansegala
sesuatunya.Yangpertamaadalahmembuatscriptbreakdown,yaitumenguraikantiapadegandalam
skenariomenjadidaftaryangberisisejumlahinformasitentangsegalahalyangdibutuhkanuntuk
pengambilangambar.
Prosesinidilakukanagarbisamengetahuirinciankebutuhanshootingtermasukbiayayang
dibutuhkansertapengaturanpadajadwalshooting.

Untukmembuatscriptbreakdownyangdibutuhkanadalahscriptbreakdownsheetyangberisiinformasi
tentangadeganyangadapadalmtersebut.Segalakeperluanshootinguntuktiapadegandiuraikan
dalamsatulembarbreakdownsheet.Lembarantersebutmemuatinformasisebagaiberikut:

https://belajarsinematografi.wordpress.com/ 24/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

(hp://misteridigital.wordpress.com/2007/10/01/201/199/)

ScriptBreakdownSheet

Date:
Bagianinidicantumkantanggalsaatscriptbreakdownsheetdiisi

ScriptVersionDate:
Waktuyangdicantumkanadalahtanggalversiskenarioyangdipakaiuntukmenyiapkanshooting.

ProductionCompany:
Bagianyangmencantumkannamadannomortelepondariproductionhouseyangmemproduksilm
tersebut.

BreakdownPageNo.:
Nomorhalamandarilembarbreakdownyangdibuat.Butirinimembantumengontrolapakahtelah
menyelesaikanpengerjaanadegandemiadegansecaraberurutan.Biasanyanomorhalamaninisama

dengannomoradegan.
https://belajarsinematografi.wordpress.com/ 25/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

dengannomoradegan.
Kecualijikauntuksatuadeganmembutuhkanlebihdarisatulembarbreakdown.

Title/NoofEpisodes:
Padabagianinidituliskanjudullmyangdiproduksi.Jikalmtersebutmerupakansuatuserialperlu
dicantumkanjuganomorepisodenya.

PageCount:
Bagianuraiantentangpanjangatauporsidariadegandalamskenario.Biasakanmembagitiap
halamanskenariomenjadi8bagian.Jikaadeganyangdiuraikanhanyamempunyaipanjang2/8
halamanmakaditulisangka2/8.PageCountsangattergantungdariformatpenulisanskenarioyang
berdasarkantingkatkerumitansebuahadegan.
SebuahskenarioyangditulisdenganformatberbedamenghasilkanPageCountyangberbedapula.
Adegansepanjang2/8halamanmungkinmemerlukanwaktulebihlamadibandingdenganadegan
laindenganPageCountlebihbesarjikamelibatkanbanyakorangatauruanganyangsangatbesar
denganpergerakanorangsertakamerayangrumit.
PageCountbukansebuahukuranmutlakuntukmengetahuiseberapalamasebuahadegandishoot.
NamunPageCountmembantudalammengukurporsidarimasingmasingadegandalamsebuahlm.

LocationorSet:
Dicantumkanlokasisesuaidenganskenario,inidiperlukanuntukmemudahkanidentikasiantara
satuadegandenganadeganlainnya.Yangperludiingatbisasajalokasishootingberubahsamasekali
denganapayangdirencanakandalamskenario.

SceneNo.:
Nomoradegansesuaidenganyangtercantumdalamskenario.

Int/Ext:
Bagianinimenandakandimanasuatuadeganterjadi.Int.adalahuntukinterioryangberartidilakukan
didalamsuaturuangan,sementaraExt.adalahuntukexterioryangartinyaadegandiambildiluar
ruangan.

Day/Night:
Bagianinimenandakanwaktuadeganuntuksianghari(day)danmalamhari(night)

Description:
Penggambarankejadianspesikyangadadalamadeganuntukmempermudahingatan,dengancara
iniakantidakmembuangwaktudenganmembolakbalikskenariountukmengingatapayangterjadi
dalamadegan.

Cast:
Padabagianiniuntukmenuliskansemuapemeranyangmelakukandialog(speakingparts)termasuk
peranpendukung,semuanyadiurutkanberdasarpentingnyaperan.
Nomorinitidakbolehberubahubahdikarenakanagarmasingmasingporsidalamperanberdasar
skenariodapatdiketahuidenganmudah.

Wardrobe:
Bagiankhususuntukmencatatkostumyangakandikenakanolehpemeran.Catataninidiperlukan
apabilaadakostumkhususdipakaiolehpemeranyangpenyediaannyamemerlukanbiayadanwaktu
khusus.

Extras/Atmosphere:
Bagianuntukmencantumkanjumlahorangorang(crowd)yangdibutuhkanuntukmendukung
suasanadalamsebuahadegan.Pencatataninitermasukjugajikacrowdserupaterdapatpadaadegan
lainnyasehinggabisadikelompokkansecaraberkelanjutan(continuity)
MakeUp/HairDo:
https://belajarsinematografi.wordpress.com/ 26/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

MakeUp/HairDo:
Pencatatankhusustentangtatariasdantatarambut(hairdo)untuktiapperandancrowd.

Extras/SilentBits:
Yangtermasukdalampencatataniniadalahparapemerantidakmelakukandialogyangtidak
tergabungdalamcrowd.Misalnyaseorangtukangkoranbersepedayangkemudianmelemparkan
korankerumahpelanggannya.
Yangperludicatatadalahusia,penampilansik,tinggibadan,perawakantubuh,danlainsebagainya.

Stunts/StandIns:
Pencatatanuntukbeberapaadeganyangmemerlukanperanpenggantiadeganberbahaya(stunt)atau
pemeranpenggantidenganmempertahankanwajahpemeranutama(standin).Penggunaanstuntsdan
standinharusdiperhitungkandengancermanagarmempermudahkanpelaksanaanshooting.Tentang
kostumdanaksesorismisalnya,harusditambahkarenastuntsdanstandininimengenakantata
busanayangserupadenganyangdipakaiolehpemeransesungguhnya.

Vehicles/Animals:
Pencatatanyangdiperlukanapabilaadakendaraanyangnantinyatampakdalamgambar(frame),
catatantersebutmeliputisegalainformasitentangkendaraanyangdupakaitermasuktahun,warna,
jumlah,danposisikendaraan.Apabiladalamlmitumembutuhkanhewanharusdipastikantentang
dibutuhkanatautidakseorangpelatih/pawanghewan.

Props,SetDressing,Greenery:
Ketigahaltersebutmerupakanbagiandaridepartemenartistik.Propsadalahbendabendayang
dipakaiolehcastdanextras,setdressingmerupakantatalokasi(set)yangdiaturdandihiasolehset
dresser,dangreeneryadalahtanamanyangdipinjam,disewa,ataudibelikarenabukanbagiandari
lokasi.

SoundEects/Music:
Pencatatankebutuhanuntukefeksuaratertentusertamusikyangakandipakai.

Security/Teachers:
Terkadangdibutuhkantenagakeamananuntukkelancaranshootingpadaadeganataulokasitertentu.
Teachersperludicatatjugapadabagianinijikadiperlukanpengajaruntukparapemerandiselasela
waktushooting.yangmeliputimelatihdialog(dialogcoaches)ataumelatihpemeranagardapat
melakukanserangkaiangerakanbeladiri(ghtinginstructor)

SpecialEects:
Pencantumansegalakebutuhanefekkhusussepertiledakan,penghancuran,pembakaran,tatarias
khusus,danlainsebagainya.

EstimatedNo.ofSetUps:
Pencatatanuntukmemperkirakansudutpengambilangambarsuatuadegansertamenentukansetup
yangdibutuhkan.

EstimatedProductionTime:
Pencatatantentangperkiraanwaktuyangdiperlukanuntukmenyiapkansetupdanperekaman
gambarpadasetiapsetup.Termasukpencatatantotalwaktuuntuksemuasetup.

SpecialEquipment:
Pencatatankebutuhanperalatankhususuntukshooting,misalnyasteadycam,underwatercamera,car
mounting,ataulensatele.

ProductionNotes:
https://belajarsinematografi.wordpress.com/ 27/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

ProductionNotes:
Pencatatanyangmemuatsemuakeperluanyangbelumdisebutkandibagianbagiansebelumnyayang
membutuhkanwaktu,tenaga,danbiayakhusus.
Misalnyadalamhalmempersiapkanefekledakanyangbutuhwaktusekitar3jam.

(hp://misteridigital.wordpress.com/2007/10/01/201/200/)

ScriptBreakdown

Jikadalamskenariolmyangdibuatmempunyai100scenemakaakanmemiliki100lembarscript
breakdownsheet.Selanjutnyapindahkaninformasiyangtelahdicantumkanpadalembaranlembaran
scriptbreakdownsheetkedalamscriptbreakdown.
Jumlahkolominformasiyangterterapadascriptbreakdowntidaksebanyakyangterdapatpadascript
breakdownsheet,karenaituuntukpencatataninformasilainnyaadapadakolomnotes.

Scriptbreakdowndiperbanyakkemudiandibagikankeseluruhdepartemenagarsemuatimbisa
mengertidenganbaikapayangharusdipersiapkansertadikerjakandalamproduksilmtersebut.
Pembagiankerjadisetiapdepartemenmengacupadasegalahalyangterteradalamscriptbreakdown

Leaveacomment
Postedbykechenk1903onJune3,2011inUncategorized

https://belajarsinematografi.wordpress.com/ 28/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

SejarahSinema

03JUN
SejarahawalsinemadiawalidengandigunakannyaCinematographemilikLumierebersaudarayang
merupakanmodikasidarialatKinetoscopeciptaaanThomasAlfaEdison.
Kalausebelumnyamenontonlmdilakukandengancaramengintipgambarbergerakdarisatu
lobangsecarabergantian,makaCinematographemenandaidimulainyaerapertunjukanlmyangbisa
dilihatuntukorangbanyak.Padatahun1895tepatnyatanggal28Desemberuntukpertamakalinya
puluhanorangberadadidalamsaturuanganmenontonlmyangdiproyeksikankesebuahlayarlebar.
LumierebersaudaramenyewasebuahruangbilyardtuadibawahtanahdiBoulevarddesCapucines
Parisyangkemudiandikenalsebagairuangbioskoppertamadidunia.Tempatitukemudian
dinamakanGrandCafeyangtibatibamenjadibegitupopulerdiEropa.Ribuanorangberbondong
bondonginginmenontonlmbuatanAugustedanLouisLumiere.Saatitupengalamanmenontonlm
dalamsebuahruanganadalahsuatuhalyangsamasekalibarubagiorangorangpadawaktuitu.

ThomasAlfaEdison(18471931)

Setelahituadabanyakupayauntukmembuatlm,tetapimasihkategorilmbisu.Padamasalm
bisu,pertunjukanlmumumnyadiiringidenganmusiksecaralangsungsebagaiilustrasimusiknya.
Kemudianseiringdenganberjalannyawaktu,padatahun1927seorangsutradarabernamaAlan
CroslanduntukpertamakalinyamembuatlmTheJazzSingerdenganmenyajikansecaralengkap
musik,nyanyian,sertadialog.Walaumasihdalamformatwarnahitamputih.

(hps://belajarsinematogra.wordpress.com/?aachment_id=186)

PerkembanganlmdiIndonesiayangmenyajikanunsurgambardansuarayangmenjadisatusendiri
diawalidengandiproduksinyalmberjudulTerpaksaMenika,dengansutradara,PenataFotogra,
danSuaraolehG.Krugerspadatahun1932.
Padawaktuitupromosilmtersebutadalah100%bicara,musik,dannyanyi.Lebihterang,bagus,
kocak,danramaidariNjaiDasima

Tahun1952adalahawalsebuahproduksilmberwarnapertamaIndonesiayangberjudulRodrigode
Villa(sutradaraGregorioFernandez&RempoUrip),DirectorOfPhotographyE.ROSALES,
ComposerQ.VELASCO.
DenganparapemainRDMochtar,NeyHerawati,RendraKarno,Darussalam,Sukarsih,NanaMayo,
Astaman,Awaludin,Djuriah,A.Hadi,H.Asby,danPeteElfonso.
SeluruhproduksilmtersebutdikerjakandiStudioLVNManilaFilipina.

Setelahitumulaidaritahun1968barulahmuncullmlmformatwarnadalamproduksiperlman
Indonesia.

EraVideo
Lebihdariseratustahunkemudianteknologiperlmantelahberkembangpesat.Dengan

ditemukannyaVideoyangungguldarisegikemudahan.Videodapatmerekamsuaradangambar
https://belajarsinematografi.wordpress.com/ 29/30
4/28/2017 belajarsinematografi|JustanotherWordPress.comsite

ditemukannyaVideoyangungguldarisegikemudahan.Videodapatmerekamsuaradangambar
dalamsatumediumpadasaatyangsama.Kelebihanlainnyabobotdarikameravideoitusendirilebih
ringandanmudahdioperasikan.

Jenis
Adabeberapajenislm(genre)yaituksidannonksi.Yangtermasukdalamjenislmnonksi
adalahlmdokumenter.Filmdokumenterbisaberisitentangalamdanmanusiadengancara
hidupnyayangberagam.
Sedangkanuntukjenislmksimencakupdrama,suspenseatauaction,sciencection,horo,danlm
musikal.

Darisegidurasilmbisadikelompokkanmenjadilmpanjangdanpendek.Filmpanjangbiasanya
berdurasi60menitataulebih.Sedangkanlmpendekdurasinyakurangdari60menit.
Bagiparapemuladibidangperlmantentunyaakanlebihmudahuntukberlatihdalammembuat
sebuahlmpendekterlebihdahulu.SebagaicontohRudiSoedjarwodantimnyamengawalidebutnya
denganmembuatlmpendekberjudulBintangJatuhdanTragedi.

Leaveacomment
Postedbykechenk1903onJune3,2011inUncategorized

Helloworld!

03JUN
WelcometoWordPress.com(hp://wordpress.com/).Afteryoureadthis,youshoulddeleteandwrite
yourownpost,withanewtitleabove.OrhitAddNew(/wpadmin/postnew.php)ontheleft(ofthe
admindashboard(/wpadmin))tostartafreshpost.

Here(hp://learn.wordpress.com/)aresomesuggestionsforyourrstpost.

1.YoucanndnewideasforwhattoblogaboutbyreadingtheDailyPost
(hp://dailypost.wordpress.com/).
2.AddPressThis(/wpadmin/tools.php)toyourbrowser.Itcreatesanewblogpostforyouaboutany
interestingpageyoureadontheweb.
3.Makesomechangestothispage(/wpadmin/post.php?post=1&action=edit),andthenhitpreview
ontheright.Youcanalwaypreviewanypostoredityoubeforeyoushareittotheworld.

1Comment
Postedbykechenk1903onJune3,2011inUncategorized

BlogatWordPress.com.

Entries(RSS)andComments(RSS)

https://belajarsinematografi.wordpress.com/ 30/30