Anda di halaman 1dari 3

EDH (Epidural Hematom)

epidural hematoma

Epidural hematom adalah Perdarahan yang terletak antara durameter dan tulang,
biasanya sumber pendarahannya adalah robeknya Arteri meningica media (paling
sering),Venadiploica(olehkarenaadanyafrakturkalvaria),Venaemmisaria,Sinus
venosusduralis.

Padakeadaanyangnormal,sebenarnyatidakadaruangepidural

Perdarahan biasanya terjadi dengan fraktur tengkorak bagian temporal


parietalyangmanaterjadilaserasipadaarteriatauvenameningeamedia.

Pada kasus yang jarang, pembuluh darah ini dapat robek tanpa adanya fraktur.

Keadaan ini mengakibatkan terpisahnya perlekatan antara dura dengan kranium dan
menimbulkan ruang epidural.

Perdarahan yang berlanjut akan memaksa dura untuk terpisah lebih lanjut, dan

menyebabkan hematoma menjadi massa yang mengisi ruang


Gejala klinis yang khas adalah : Lucid Interval (adanya fase sadar diantara 2 fase tidak sadar
karena bertambahnya volume darah)
Gelaja paling menonjol yaitu penurunan kesadaran secara progresif
Gejala lain yang sering tampak :
q Bingung
q Penglihatan kabur
q Susah bicara
q Nyeri kepala yang hebat
q Keluar cairan darah dari hidung atau telinga
q Nampak luka yang dalam atau goresan pada kulit kepala
q Mual
q Pusing
q Berkeringat
q Pucat
qPupilanisokor,yaitupupilipsilateralmenjadimelebar

Pemeriksaanpenunjang
Fotopolos:sulituntukmenentukan
CTScan
MRI
Penatalaksanaan
Penatalaksaan epidural hematoma dapat dilakukan segera dengan cara trepanasi dengan
tujuanmelakukanevakuasihematomadanmenghentikanperdarahan
Prognosis
Prognosistergantungpada:
Lokasinya(infratentoriallebihjelek)
Besarnya
Kesadaransaatmasukkamaroperasi.
Jikaditanganidengancepat,prognosishematomaepiduralbiasanyabaik,karenakerusakan
otaksecaramenyeluruhdapatdibatasi.Prognosissangatburukpadapasienyangmengalami
komasebelumoperasi.

SDH(SUBDURALHEMATOMA)

subdural hematoma
Subduralhematomaadalahhematomyangterletakdiantaralapisanduramaterdanarhacnoid
dengan sumber perdarahan dapat berasal dari vena jembatan atau bridging vein (paling
sering),A/Vcortical,Sinusvenosusduralis
subduralhematomadibagi3:
1.Subdural hematom akut
2.Subdural hematom subakut
3.Subdural hematom kronis
SUBDURALHEMATOMAAKUT
Gejalayangtimbulsegerahinggaberjamjamsetelahtraumasampaidenganhariketiga.
Biasanya terjadi pada cedera kepala yang cukup berat yang dapat mengakibatkan perburukan
lebih lanjut pada pasien yang biasanya sudah terganggu kesadaran dan tanda vitalnya.
Perdarahan dapat kurang dari 5 mm tebalnya tetapi melebar luas.
Secara klinis subdural hematom akut ditandai dengan penurunan kesadaran, disertai adanya
lateralisasi yang paling sering berupa hemiparese/plegi.
padapemeriksaanradiologis(CTScan)didapatkangambaranhiperdensyangberupabulansabit

SUBDURALHEMATOMASUBAKUT
Berkembangdalambeberapaharibiasanyasekitarharike3mingguke3sesudahtrauma
Perdarahan dapat lebih tebal tetapi belum ada pembentukan kapsula di
sekitarnya

adanyatraumakepalayangmenyebabkanketidaksadaran,selanjutnyadiikutiperbaikan
statusneurologikyangperlahanlahan.
Namunjangkawaktutertentupenderitamemperlihatkantandatandastatusneurologikyang
memburuk.
Tingkatkesadaranmulaimenurunperlahanlahandalambeberapajam.
Dengan meningkatnya tekanan intrakranial seiring pembesaran hematoma, penderita
mengalamikesulitanuntuktetapsadardantidakmemberikanresponterhadaprangsangan
bicaramaupunnyeri.

SUBDURALHEMATOMAKRONIS
Biasanyaterjadisetelahmingguketiga
SDHkronisbiasanyaterjadipadaorangtua
Traumayangmenyebabkanperdarahanyangakanmembentukkapsul,saattersebutgejalayang
terasaCumapusing.
Kapsul yang terbentuk terdiri dari lemak dan protein yang mudah menyerap cairan dan
mempunyaisifatmudahruptur.
Karenapenimbunancairantersebutkapsulterusmembesardanmudahruptur,jikavolumenya
besarlangsungmenyebabkanlesidesakruang.
Jikavolumekecilakanmenyebabkankapsulterbentuklagi>>menimbuncairan>>rupturlagi
>> rebleeding. Begitu seterusnya sampai suatu saat pasien datang dengan penurunan
kesadarantibatibaatauhanyapeloataulumpuhtibatiba.
Terapi:Kraniotomi>>kapsuldipecah,darahdievakuasi
prognosis
PrognosedaripenderitaSDHditentukandari:
qGCSawalsaatoperasi
qlamanyapenderitadatangsampaidilakukanoperasi
qlesipenyertadijaringanotak
qsertausiapenderita
padapenderitadenganGCSkurangdari8prognosenya50%,makinrendahGCS,makinjelek
prognosenyamakintuapasienmakinjelekprognosenyaadanyalesilainakanmemperjelek
prognosenya.

ICH (INTRACEREBRAL HEMATOM)


inracerebral hematoma
perdarahanyangterjadipadajaringanotakbiasanyaakibatrobekanpembuluhdarahyangada
dalamjaringanotak.
Secara klinis ditandai dengan adanya penurunan kesadaran yang kadangkadang disertai
lateralisasi
padapemeriksaanCTScandidapatkanadanyadaerahhiperdensyangindikasidilakukanoperasi
jikaSingle,diameterlebihdari3CM,Perifer,AdanyapergeserangaristengahS
ecaraklinishematomtersebutdapatmenyebabkangangguanneurologis/lateralisasi
Operasi yang dilakukan biasanya adalah evakuasi hematom disertai dekompresi dari tulang
kepala.
Faktorfaktoryangmenentukanprognosenyahampirsamadenganfaktorfaktoryangmenentukan
prognoseperdarahansubdural.