Anda di halaman 1dari 51

Tugas Akhir

CAKUPAN ISPA PNEUMONIA DI PUSKESMAS


MERDEKA TAHUN 2016

Disusun oleh:

Neneng Rianawati S.Ked 04054821618019


Eka Satyani Belina S.Ked 04054821618021

Pembimbing:
dr. Alfarobi, M.Kes

DEPARTEMEN ILMU KESEHATAN MASYARAKAT DAN


ILMU KEDOKTERAN KOMUNITAS
FAKULTAS KEDOKTERAN UNIVERSITAS SRIWIJAYA
PERIODE 06 MARET 15 MEI 2017
KATA PENGANTAR

Puji dan syukur penulis haturkan kehadirat Allah SWT atas berkah dan
rahmat-Nya sehingga penulis dapat menyelesaikan tugas ilmiah dengan judul
Cakupan Ispa Pneumonia di Puskesmas Merdeka Tahun 2016 yang merupakan
bagian dari sistem pembelajaran kepaniteraan klinik, khususnya di Departemen
Ilmu Kesehatan Masyarakat dan Ilmu Kedokteran Komunitas Fakultas
Kedokteran Universitas Sriwijaya.
Pada kesempatan ini, penulis ingin mengucapkan terima kasih kepada
dr.Alfarobi, M.Kes selaku pembimbing yang telah membantu memberikan ajaran
dan masukan sehingga laporan ini dapat selesai.
Penulis menyadari bahwa dalam penulisan laporan kasus ini masih banyak
terdapat kesalahan dan kekurangan. Oleh karena itu, segala saran dan kritik yang
bersifat membangun sangat penulis harapkan. Demikianlah penulisan laporan ini,
semoga bermanfaat.

Palembang, Mei 2017

Penulis

ii
DAFTAR ISI

Sampul .................................................................................................................. i
Kata Pengantar ..................................................................................................... ii
Daftar isi.............................................................................................................. iii
BAB I Pendahuluan ............................................................................................. 1
BAB II Tinjauan Pustaka ..................................................................................... 5
BAB III Profil Puskesmas Merdeka................................................................... 24
BAB IV Pembahasan ......................................................................................... 36
BAB V Penutup ................................................................................................. 44
Daftar Pustaka .................................................................................................... 46
Lampiran ............................................................................................................ 47

iii
BAB I
PENDAHULUAN
1.1. LatarBelakang
Infeksi Saluran Pernafasan Akut (ISPA) merupakan penyakit yang sering
terjadi pada anak. World Health Organization (WHO) memperkirakan
menurut kelompok umur balita terjadi pneumonia 0,29 kasus per anak/tahun
di negara berkembang dan 0,05 kasus per anak/tahun di negara maju. Ini
menunjukan bahwa terdapat 156 juta kasus baru di dunia per tahun dimana
151 juta kasus (96,7%) terjadi di negara berkembang dan 8,7% atau 13,1
juta diantaranya adalah pneumonia berat. Kasus terbanyak terjadi di India
(43 juta), China (21 juta) dan Pakistan (10 juta) sedangkan di Indonesia
terjadi 6 juta kasus. Dari semua kasus yang terjadi di masyarakat, 7-13%
kasus berat dan memerlukan perawatan rumah sakit. Episode batuk-pilek
pada Balita di Indonesia diperkirakan 2-3 kali per tahun. Infeksi saluran
pernafasan akut merupakan salah satu penyebab utama kunjungan
pasien di Puskesmas (40%-60%) dan rumah sakit (15%-30%)12
Pneumonia adalahpembunuhutamabalita di dunia, lebihbanyak
disbanding dengangabunganpenyakit AIDS, malaria dancampak. Di
duniasetiaptahundiperkirakanlebihdari 2 jutabalitameninggalkarena
Pneumonia (1 Balita/20 detik) dari 9 juta total kematianBalita. Diantara
5kematianBalita, 1 di antaranyadisebabkanoleh pneumonia.
Bahkankarenabesarnyakematian pneumoniaini, pneumonia
disebutsebagaipandemi yang terlupakan (the forgotten pandemic).
Namun, tidakbanyakperhatianterhadappenyakitini, sehingga pneumonia
disebut juga pembunuhBalita yang terlupakan (the forgotten killer of
children). Di Negara berkembang 60% kasus pneumonia
disebabkanolehbakteri,.MenuruthasilRiskesdas
2007proporsikematianBalitakarenapneumonia menempatiurutankedua
(13,2%) setelahdiare. Sedangkanmenurut Survei Kesehatan Rumah Tangga
1
2

(SKRT) 2004 proporsikematianBalitakarena


pneumoniamenempatiurutanpertama.12
Menurut profil kesehatan Indonesia tahun 2015, perkiraan presentase
kasus penemuan pneumonia pada Provinsi Sumatera Selatan sebesar 3,61%,
cakupan penemuan pneumoni pada balita di indonesia adalah 63,45%. Salah
satu penyebab peningkatan penemuan pneumonia yaitu menurunnya sasaran
penemuan pneumonia yang sebelumnya sama untuk semua provinsi.4
Angka kematian akibat pneumonia pada balita sebesar 0,16% , lebih
tinggi dibandingkan dengan tahun 2014 yaitu sebesar 0,08%. sedangkan
pada kelompok bayi angka kematian lebih tinggi yaitu 0,17% dibandingkan
pada kelompok umur 1-4 tahun yang sebesar 0,15%. Pneumonia juga selalu
berada pada daftar 10 penyakit terbesar setiap tahunnya di fasilitas
kesehatan. Hal ini menunjukkan bahwa pneumonia merupakan penyakit
yang menjadi masalah kesehatan masyarakat utama dan berkontribusi tinggi
terhadap angka kematian balita di Indonesia.2
Target yang ingindicapaipemerintah Indonesia padatahun 2015
adalahAngkaKematianBalita (AKBAL) sebanyak 32/1000
kelahiranhidupatau 2/3 dari AKBAL tahun 1990 dengan AKBAL 1990 yaitu
91/1000 kelahiran hidup.4 Berdasarkan data Riskesdas 2007, insidens
pneumonia di Sumatera Selatan tahun 2008 adalah 23,63%, tahun 2010
adalah 40,63%, tahun 2011adalah 25,5%.4
Upaya pemerintah dalam menekan angka kematian akibat pneumonia
diantaranya melalui penemuan kasus pneumonia Balita sedini mungkin di
pelayanan kesehatan dasar, penatalaksanaan kasus dan rujukan. Adanya
keterpaduan dengan lintas program melalui pendekatan MTBS di Puskesmas
serta penyediaan obat dan peralatan untuk Puskesmas Perawatan dan di
daerah terpencil.2
Salah satu upaya penurunan angka kesakitan dan kematian yang
berhubungan dengan pneumonia pada balita ditentukan oleh keberhasilan
upaya penemuan dan tatalaksana penderita, pada tahun 2014 cakupan
nasional yang telah ditetapkan Kemenkes adalah 100%. Setiap wilayah
3

mempunyai perkiraan kasus pneumonia pada balita sebesar 3,61% dari


jumlah balita di wilayah. Untuk menjalankan upaya tersebut
diperlukankerjasamadankinerja yang baikantara unit-unit
fungsionalkesehatanmulaidari yang cakupanwilayahkerjanyadari yang
kecilsampaibesar.5
Puskesmasmerupakan unit fungsional yang
cakupanwilayahkerjanyakecildanmerupakanujungtombakdalampembanguna
nkesehatan di Indonesia karenaPuskesmasadalahfasilitaspelayanankesehatan
yang
menyelenggarakanupayakesehatanmasyarakatdanupayakesehatanperseorang
antingkatpertama, denganlebihmengutamakanupayapromotifdanpreventif,
untukmencapaiderajatkesehatanmasyarakat yang setinggi-tingginyadi
wilayahkerjanya.Puskesmasmenyelenggarakanpelayanankesehatanterdepand
anterdekatdenganmasyarakatdalambentukkegiatanpokokmenyeluruhdanterp
adu.OlehkarenaitukinerjaPuskesmasharuslah baik.1
Di PuskesmasMerdeka, berdasarkanperhitunganStandarPelayanan
Minimal, cakupanbalitadengan pneumonia yang ditanganipadatahun
2016yaitu48,6%.Berdasarkanpencapaianjumlah Program Manajemen
Terpadu Balita Sakit (MTBS)dengan pneumonia yang ditemukan di
PuskesmasMerdeka Palembang tahun 2016belummemenuhi target di
wilayahkerjaPuskesmasMerdeka Palembang,
penulistertarikmengangkattopikinisebagaitugasakhirKepaniteraanKlinikBagi
anIlmuKesehatanMasyarakatdanKedokteranKomunitas di
PuskesmasMerdeka Palembang.

1.2. RumusanMasalah
1. Apa yang menyebabkan program MTBS dengan pneumonia yang
ditemukan di Puskesmas Merdeka Palembangtahun 2016belummencapai
target.
2. Bagaimanaperencanaan program untukmengurangikasus ISPA di
Puskesmas Merdeka?
4

1.3. TujuanPenulisan
1.3.1 TujuanUmum
Mengetahui, mengidentifikasi,
danmenganalisispenyebabsertamenyusunrencanatindaklanjutpemecah
anmasalahbelumtercapainya target cakupan program MTBS dengan
pneumonia yang ditemukan di Puskesmas Merdeka.
1.3.2 TujuanKhusus
1. Megetahui cakupan penemuan penderita pneumonia di Puskesmas
Merdeka Palembang tahun 2016.
2. Mengidentifikasipenyebabbelumtercapainya target MTBS dengan
pneumonia yang ditemukan di PuskesmasMerdeka Palembang
tahun 2016.
3. Memberikanpemecahanmasalahterpilih yang ditemukan.

1.4. Manfaat
1.4.1 BagiMasyarakatSetempat
Masyarakatkhususnya yang
mempunyaibalitadiharapkandapatlebihmengetahuitentangpenyakit
pneumonia danbahayapenyakittersebutbilatidakditanganisecarabaik.
1.4.2 BagiPuskesmas
Dapatmenjadiacuandanevaluasidalammengatasipermasalahan program
penderita pneumonia sehinggapelaksanaan program
kesehatanmenjadiefektif.
1.4.3BagiMahasiswa
1. Adanyapengalamandalammencaripenyebabdancarapencapaian
target cakupanpenumonia
2. Melatih kemampuan analisis dan pemecahan terhadap masalah
yang ada
3. Meningkatkan pengetahuan tentang penyakit pneumonia khususnya
pada balita
BAB II
TINJAUAN PUSTAKA

2.1. Pneumonia
2.1.1 Definisi Pneumonia
Pneumonia adalah infeksi akut yang mengenai jaringan paru-paru
(alveoli) yang ditandai dengan batuk disertai nafas cepat dan atau
kesukaran bernafas, disebabkan terutama oleh bakteri dan merupakan
penyakit saluran pernafasan akut yang sering menyebabkan kematian.
Walaupun banyak pihak yang sependapat bahwa pneumonia merupakan
suatu keadaan inflamasi, namun sangat sulit untuk membuat suatu definisi
tunggal yang universal. Pneumonia didefinisikan berdasarkan gejala dan
tanda klinis, serta perjalanan penyakitnya. World Health Organization
(WHO) mendefinisikan pneumonia hanya berdasarkan penemuan klinis
yang didapatkan pada pemeriksaan inspeksi dan frekuensi pernapasan. 3
Pada penderita pneumonia, alveoli terisi nanah dan cairan
menyebabkan kesulitan penyerapan oksigen terjadi kesulitan bernapas.
Anak dengan pneumonia menyebabkan kemampuan paru mengembang
berkurang sehingga tubuh bereaksi dengan bernapas cepat agar tidak terjadi
hipoksia. Apabila pneumonia bertambah parah, paru akan menjadi kaku
dan timbul tarikan dinding bawah ke dalam. Akibatnya kemampuan paru
untuk menyerap oksigen menjadi berkurang sehingga sel-sel tidak dapat
bekerja.10,12,3

2.1.2 Klasifikasi ISPA dan Pneumonia


Kejadian pneumonia pada balita ditandai dengan adanya gejala
batuk, pilek, kesukaran bernafas seperti nafas cepat dan tarikan dinding
dada bagian bawah ke dalam (TDDK), serta sianosis pada infeksi yang
berat. Gambaran radiologi foto thoraks/dada menunjukan infiltrat paru
akut. Demam bukan merupakan gejala yang spesifik pada balita. Tarikan
dinding dada bagian bawah ke dalam terjadi karena gerakan paru yang
5
6

mengurang atau decreased lung compliance akibat infeksi pneumonia yang


berat. Pada usia di bawah 3 bulan, kejadian pneumonia diikuti dengan
penyakit pendahulu seperti otitis media, conjuctivitis, laryngitis dan
pharyngitis. 10,12,3
Program Pemberantasan Penyakit ISPA (P2ISPA)
mengkalsifikasikan penyakit pneumonia menjadi dua golongan, yakni
golongan umur 2 bulan - <5 tahun dan golongan umur < 2 bulan. Untuk
anak berumur 2 bulan - <5 tahun, klasifikasi dibagi atas batuk bukan
pneumonia, pneumonia, dan pneumonia berat sedangkan untuk anak
berumur kurang dari 2 bulan, maka diklasifikasikan atas bukan pneumonia
dan pneumonia berat. Dalam pendekatan manajemen terpadu balita sakit
(MTBS) klasifikasi pada kelompok umur < 2 bulan adalah infeksi bakteri
sistemik dan infeksi bakteri lokal.10,3,5
Pneumonia berat pada anak umur 2 bulan - <5 tahun dilihat dari
adanya batuk dan atau kesulitan bernapas dan disertai tarikan dinding dada
bagian bawah ke dalam (TDDK), sedangkan pada anak umur <2 bulan
diikuti dengan adanya napas cepat lebih atau sama dengan 60 kali/menit
atau tarikan dinding dada bagian bawah ke dalam (TDDK) yang kuat.
Klasifikasi pneumonia didasarkan pada adanya batuk dan atau kesukaran
bernafas disertai adanya nafas cepat. Batas nafas cepat pada anak usia 2
bulan - < 1 tahun adalah 50 kali/menit dan 40 kali/menit untuk anak usia 1 -
< 5 tahun. Klasifikasi batuk bukan pneumonia mencakup kelompok
penderita balita dengan batuk yang tidak menunjukan gejala peningkatan
frekuensi nafas dan tidak menunjukan TDDK. Dengan demikian klasifikasi
ini mencakup penyakit ISPA lain diluar pneumonia.10,12,3
7

Tabel 2.1. Klasifikasi ISPA menurut kelompok umur2,3


Kelompok Umur Kriteria Gejala Klinis

Batuk bukan pneumonia Tidak ada napas cepat dan tidak ada
tarikan dinding dada bagian bawah

2 bulan - <5 tahun Pneumonia Adanya napas cepat dan tidak ada
tarikan dinding dada bagian bawah
ke dalam

Pneumonia berat Adanya tarikan dinding dada bagian


bawah ke dalam

Bukan Pneumonia Tidak ada napas cepat dan tidak ada


tarikan dinding dada bagian bawah
ke dalam yang kuat

< 2 bulan Penumonia Berat Adanya napas cepat dan tarikan


dinding dada bagian bawah ke
dalam yang kuat

2.1.3 Penyebab Terjadinya Pneumonia


Penyebab pneumonia dibedakan berdasarkan agen penyebab infeksi,
baik itu bakteri, virus, maupun parasit. Pada umumnya terjadi akibat
adanya infeksi bakteri pneumokokus (Streptococcus pneumoniae).
Beberapa penelitian menemukan bahwa kuman ini menyebabkan
pneumonia hampir pada semua kelompok umur dan paling banyak terjadi
di negara-negara berkembang. Bakteri-bakteri lain seperti Staphylococcus,
Pneumococcus, dan Haemophylus influenzae, serta virus dan jamur juga
sering menyebabkan pneumonia. Salah satu penelitian yang dilakukan pada
2000 anak di Bandung tahun 2000 ditemukan adanya 30% positif
pneumonia berdasarkan hasil pemeriksaan sediaan apus tenggorokan
dengan 65% di antaranya adalah kuman pneumokokus. 10
8

Tabel 2.2 Etiologi pneumonia menurut umur


Usia Etiologi yang sering Etiologi yang jarang
Lahir 20 hari Bakteri Bakteri
E. colli Bakteri an aerob
Streptococcus grup B Haemophillus influenza
Listeria monocytogenes Streptococcus pneumonia
Ureaplasma urealyctims

Virus
3 minggu -3 bulan Bakteri Bakteri
Chalmydia trachomatis Bordetella pertussis
Streptococcus pneumonia Haemophilus influenza tipe B
Virus Moraxella cathralis
Virus adeno Staphylococcus aureus
Virus influenza Ureaplasma urealyctims
Respiratory syncytial virus Virus
Virus parainfluenza 1,2,3 Virus sitomegalo
4 bulan 5 tahun Bakteri Bakteri
Chalmydia trachomatis Haemophilus influenza tipe B
Streptococcus pneumonia Moraxella cathralis
Mycoplasma pneumoniae Staphylococcus aureus
Virus Neisseria meningitidis
Virus adeno Virus
Virus influenza Virus varisela-Zoster
Respiratory syncytial virus
Virus rinovirus parainfluenza
5 tahun- remaja Bakteri Bakteri
Chalmydia trachomatis Haemophilus influenza tipe B
Streptococcus pneumonia Legionella
Mycoplasma pneumoniae Staphylococcus aureus
Virus
Virus adeno
Virus influenza
Respiratory syncytial virus
Virus rinovirus parainfluenza
Virus Epstein-Barr
Virus Varisela Zoster
Penyebab pneumonia adalah sebagai berikut:4
1. Mikroorganisme
Mikroorganisme yang paling sering sebagai penyebab pneumonia adalah
virus, terutama Respiratory Synsial Virus (RSV) yang mencapai 40%.
Golongan bakteri yang ikut berperan terutama Streptococcus Pneumonis
dan Haemofillus Influenza type B (HIB). Awalnya mikroorganisme
masuk ke dalam percikan ludah (droplet) kemudian terjadi penyebaran
mikroorganisme dari saluran napas bagian atas ke jaringan (parenkim
paru) dan sebagian lagi karena penyebaran melalui aliran darah.
2. Faktor Intrinsik
Faktor intrinsik yang dapat meningkatkan risiko kejadian dan risiko
kematian akibat pneumonia pada balita adalah:
9

a. Umur
Umur mempengaruhi mekanisme pertahanan tubuh seseorang. Bayi
dan balita mempunyai mekanisme pertahanan tubuh yang masih
lemah dibandingkan dengan orang dewasa sehingga balita masuk
dalam kelompok yang rawan terkena infeksi, misalnya diare, ISPA
dan pneumonia.
b. Status Gizi
Status gizi sangat berpengaruh terhadap daya tahan tubuh. Balita yang
mempunyai status gizi baik maka akan mempunyai daya tahan tubuh
yang baik dibandingkan dengan balita status gizi kurang maupun
buruk. Keadaan gizi yang buruk muncul sebagai bagian dari faktor
risiko kejadian pneumonia.
c. Status Imunisasi
Cakupan imunisasi akan berperan besar dalam upaya pemberantasan
pneumonia. Cara yang paling efektif saat ini adalah dengan pemberian
imunisasi DPT dan campak. Pemberian imunisasi campak dapat
mencegah kematian pneumonia sekitar 11%, sedangkan imunisasi
DPT dapat mencegah kematian pneumonia sekitar 6%.
d. Jenis Kelamin
Di dalam buku pedoman P2 ISPA, disebutkan bahwa anak laki-laki
adalah faktor risiko mempengaruhi kesakitan pneumonia. Menurut
penelitian yang dilakukan oleh Koblinski (1997) bahwa anak
perempuan mempunyai kebutuhan biologis dan pada lingkungan yang
optimal mempunyai keuntungan yang diperkirakan sebesar 0,15-1 kali
lebih diatas anak laki-laki dalam hal tingkat kematian.
e. ASI Ekslusif
Kolustrum mengandung zat kekebalan 10-17 kali lebih banyak dari
susu buatan. Zat kekebalan pada ASI melindungi bayi dari diare,
alergi dan infeksi saluran napas terutama pneumonia. Bayi yang diberi
ASI eksklusif akan lebih sehat dan jarang sakit dibandingkan bayi
yang tidak menapatkan asupan ASI eksklusif.
10

f. Defisiensi Vitamin A
Pada kasus kekurangan vitamin A, fungsi kekebalan tubuh menurun
sehingga mudah terserang infeksi. Lapisan sel yang menutupi trakea
dan paru mengalami kreatinisasi sehingga mudah dimasuki oleh
kuman dan virus yang menyebabkan infeksi saluran napas terutama
pneumonia.
g. Berat Badan Lahir Rendah (BBLR)
BBLR menentukan pertumbuhan dan perkembangan fisik dan mental
pada masa balita. Bayi dengan BBLR mempunyai risiko kematian
yang lebih besar dibandingkan dengan bayi dengan berat lahir normal
terutama pada bulan-bulan pertama kelahiran karena pembentukan zat
kekebalan kurang sempurna sehingga lebih mudah terkena penyakit
infeksi terutama penumonia dan infeksi saluran pernapasan lainnya.6
3. Faktor Ektrinsik
Faktor ektrinsik yang dapat meningkatkan risiko kejadian dan risiko
kematian akibat pneumonia pada balita, kondisi fisik rumah yang
berhubungan dengan kejadian pneumonia antara lain adalah mengenai
kelembaban udara, ventilasi atau proses penyediaan udara segar dan
pengeluaran udara kotor secara alamiah. Berdasarkan Keputusan Menteri
Kesehatan No. 829/Menkes/SK/VII/1999 tentang persyaratan kesehatan
perumahan, luas penghawaan atau ventilasi yang permanen minimal 10%
dari luas lantai. Kepadatan hunian, berdasarkan Keputusan Menteri
Kesehatan tentang persyaratan kesehatan perumahan, luas ruang tidur
minimal (panjang x lebar) 8 meter2, dan tidak dianjurkan digunakan lebih
dari 2 orang tidur dalam satu ruangan tidur kecuali anak umur dibawah 5
tahun. Polusi udara didalam rumah juga dapat disebabkan oleh karena
asap rokok, kompor gas, alat pemanas ruangan dan juga akibat
pembakaran yang tidak sempurna dari kendaraan bermotor. Pendidikan
ibu mempunyai pengaruh besar dalam tumbuh kembang bayi dan balita,
karena pada umumnya pola asuh anak ditentukan oleh ibu. Tingginya
mortalitas dan morbiditas pneumonia lenih disebabkan oleh kurangnya
11

informasi dan pemahaman yang diperoleh dari seorang ibu. Tingkat


jangkauan pelayanan kesehatan yang rendah sangat mempengaruhi
risiko morbiditas dan mortalitas pneumonia karean akan terlambat
memperoleh diagnosa sehingga mempengaruhi upaya pertolongan yang
dibutuhkan.8

2.1.4 Cara Penularan Pneumonia


Pneumonia termasuk kedalam penyakit menular yang ditularkan
melalui udara. Sumber penularan adalah penderita pneumonia yang
menyebarkan kuman ke udara pada saat batuk atau bersin dalam bentuk
droplet. Inhalasi merupakan cara terpenting masuknya kuman penyebab
pneumonia kedalam saluran pernapasan yaitu bersama udara yang dihirup,
disamping itu terdapat juga cara penularan langsung yaitu melalui percikan
droplet yang dikeluarkan oleh penderita saat batuk, bersin dan berbicara
kepada orang disekitar penderita, transmisi langsung dapat juga melalui
ciuman, memegang dan menggunakan benda yang telah terkena sekresi
saluran pernapasan penderita.4

2.1.5 Gambaran Klinis Pneumonia


Sebagian besar gambaran klinis pneumonia balita berkisar antara
ringan sampai sedang hingga dapat berobat jalan. Hanya sebagian kecil
berupa penyakit berat mengancam kehidupan dan perlu rawat inap. Secara
umum gambaran klinis pneumonia dibedakan menjadi dua kelompok yaitu
gejala umum dan gejala respiratorik. Gejala umum pada pneumonia
biasanya didahului oleh infeksi saluran napas bagian atas selama beberapa
hari. Suhu dapat naik secara mendadak sampai 39-400 Celcius dan mungkin
disertai kejang demam yang tinggi, sakit kepala, malaise, nafsu makan
kurang, adanya gejala gastrointestinal seperti mual, muntah dan diare, anak
tampak gelisah. Gejala respiratorik berupa batuk, dispnu, pernapasan cepat
dan dangkal disertai pernapasan cuping hidung dan sianosis di sekitar
hidung dan mulut. Hipoksia merupakan tanda klinis dari pneumonia berat.
12

Anak pneumonia dengan hipoksemia berisiko lima kali lebih sering


meninggal dibandingkan anak pneumonia tanpa hipoksemia. Pada
pemeriksaan foto thoraks menunjukkan infiltrasi melebar.8

2.2 Pengendalian Pneumonia di Indonesia


2.2.1 Pencegahan dan Penanggulangan Pneumonia10
1. Pencegahan penyakit menular Pneumonia
Upaya pencegahan penyakit pneumonia meliputi kelengkapan imunisasi,
perbaikan gizi anak termasuk promosi ASI, peningkatan kesehatan ibu
hamil untuk mencegah BBLR, mengurangi kepadatan hunian rumah, dan
memperbaiki ventilasi rumah.
2. Penanggulangan penyakit menular pneumonia
Suatu upaya untuk menekan penyakit menular di masyarakat serendah
mungkin sehingga tidak menjadi gangguan kesehatan bagi masyarakat. Ada
tiga kelompok sasaran yaitu:
a. Kelompok sasaran langsung pada sumber penularan pejamu
Sumber penularan pneumonia adalah manusia maka cara paling efektif
adalah dengan memberikan pengobatan.
b. Sasaran ditujukan pada cara penularan
Penularan penyakit pneumonia dapat berlangsung melalui perantara udara
maupun kontak langsung. Upaya pencegahan melalui kontak langsung
bisasanya dititik beratkan ada penyuluhan kesehatan. Pencegahan penularan
melalui udara dapat dilakukan dengan perbaikan sistem ventilasi serta aliran
udara dalam potensial.
c. Sasaran ditujukan pada pejamu potensial
Peningkatan kekebalan khusus dapat dilakukan dengan pemberian imunisasi
dasar sebagai bagian dari program pembangunan kesehatan yang ternyata
cukup berhasil dalam usaha meningkatkan derajat kesehatan serta
menurunkan angka kematian bayi dan balita. Saat ini vaksinasi yang dapat
mencegah pneumonia pada bayi dan balita yang diterapkan Indonesia
sebagai program imunisasi dasar baru DPT dan Campak saja.
13

Penanggulangan penyakit pneumonia menjadi fokus kegiatan utama


program P2 ISPA. Program ini mengupayakan agar istilah pneumonia lebih
dikenal di masyarakat sehingga memudahkan kegiatan penyuluhan dan
penyebaran informasi tentang penanggulangan pneumonia.

2.2.2 Program Pemberantasan Penyakit ISPA di MTBS10


Program P2 ISPA adalah suatu program pemberantasan penyakit
menular yang ditujukan untuk menurunkan angka kesakitan dan angka
kematian akibat infeksi saluran pernapasan akut, terutama pneumonia pada
usia di bawah lima tahun. Program P2 ISPA dikembangkan dengan
mengacu pada konsep manajemen terpadu pemberantasan penyakit menular
dan penyehatan lingkungan berbasis wilayah. Konsep terpadu meliputi
penanganan pada sumber penyakit, faktor risiko lingkungan, faktor risiko
perilaku, faktor risiko perilaku dan kejadian penyakit dengan
memperhatikan kondisi lokal. Tugas pemberantasan penyakit ISPA
merupakan tanggung jawab bersama. Kepala Puskesmas bertanggung
jawab bagi keberhasilan pemberantasan di wilayah kerjanya.
Dokter puskesmas mempunyai tugas sebagai berikut:
a. Membuat rencana aktifitas pemberantasan ISPA sesuai dengan dana
atau sarana dan tenaga yang tersedia.
b. Melakukan supervisi dan memberikan bimbingan penatalaksanaan
standar kasus-kasus ISPA kepada perawat atau paramedis.
c. Melakukan pemeriksaan pengobatan kasus-kasus pneumonia berat
ataupun penyakit dengan tanda-tanda bahaya yang dirujuk oleh
perawat atau paramedis dan merujuknya ke rumah sakit bila dianggap
perlu.
d. Memberikan pengobatan kasus penumonia berat yang tidak bisa
dirujuk ke rumah sakit.
e. Bersama dengan staf puskesmas memberikan penyuluhan kepada ibu-
ibu yang mempunyai anak balita perihal pengenalan tanda-tanda
penyakit pneumonia serta tindakan penunjang di rumah.
14

f. Melatih semua petugas kesehatan di wilayah puskesmas yang diberi


wewenang mengobati penderita penyakit ISPA.
g. Melatih kader untuk bisa mengenal kasus pneumonia serta dapat
memberikan penyuluhan terhadap ibu-ibu tentang penyakit ISPA.
h. Memantau aktifitas pemberantasan dan melakukan evaluasi
keberhasilan pemberantasan penyakit ISPA.
i. Mendeteksi hambatan yang ada serta menanggulanginya termasuk
aktifitas pencatatan dan pelaporan serta pencapaian target.

Paramedis Puskesmas mempunyai tugas sebagai berikut:


a. Melakukan penatalaksanaan standar kasus-kasus ISPA sesuai petunjuk
yang ada.
b. Melakukan konsultasi kepada dokter puskesmas untuk kasus-kasus
ISPA tertentu seperti pneumonia berat, penderita dengan wheezing dan
stridor.
c. Bersama dokter atau dibawah petunjuk dokter melatih kader.
d. Memberikan penyuluhan terutama kepada ibu-ibu.
e. Melakukan tugas-tugas lain yang diberika oleh pimpinan Puskesmas
sehubungan dengan pelaksanaan program pemberantasan penyakit
ISPA

Kader Kesehatan mempunyai tugas sebagai berikut:


a. Dilatih untuk bisa membedakan kasus pneumonia (penumonia berat dan
pneumonia tidak berat) dari kasus-kasus bukan pneumonia.
b. Memberikan penjelasan dan komunikasi perihal penyakit batuk pilek
biasa (bukan pneumonia) serta penyakit pneumonia kepada ibu-ibu
serta perihal tindakan yang perlu dilakukan oleh ibu yang anaknya
menderita penyakit.
c. Merujuk kasus penumonia berat ke Puskesmas atau rumah sakit
terdekat.
d. Mencatat kasus yang ditolong dan dirujuk.
15

2.2.3 Tahap Penyusunan Perencanaan Tingkat Puskesmas7


Penyusunan Perencanaan Tingkat Puskesmas (PTP) dilakukan melalui 4
(empat) tahap sebagai berikut :
1. Tahap Persiapan
Tahap ini mempersiapkan staf Puskesmas yang terlibat dalam proses
penyusunan PTP agar memperoleh persamaan pandangan dan pengetahuan
tentang tahap perencanaan. Tahap ini dilakukan dengan cara :
1) Kepala Puskesmas membentuk Tim penyusun PTP yang
anggotanya staf puskesmas
2) Kepala puskesmas menjelaskan pedoman PTP kepada tim
3) Puskesmas mempelajari kebijakan dan pengarahan yang telah
ditetapkan oleh Dinas Kesehatan Kota/Kabupaten, Dinas Kesehatan
Provinsi dan Departemen Kesehatan
2. Tahap Analisis Situasi
Tahap ini dimaksudkan untuk memperoleh informasi mengenai keadaan
dan permasalahan yang dihadapi Puskesmas melalui proses analisis
terhadap data yang dikumpulkan. Tim yang telah disusun oleh Kepala
Puskesmas melakukan pengumpulan data. Ada 2 (dua) kelompok data yang
perlu dikumpulkan yaitu data umum yang terdiri dari peta wilayah kerja
serta fasilitas kesehatan, data sumber daya, data peran serta masyarakat,
data penduduk dan sasaran program, data sekolah dan data kesehatan
lingkungan serta ada pula data khusus yang terdiri dari status kesehatan,
kejadian luar biasa, cakupan program pelayanan kesehatan 1 (satu) tahun
terakhir di tiap desa/kelurahan dan hasil survey (bila ada).
3. Tahap Penyusunan Rencana Usulan Kegiatan (RUK)
Penyusunan RUK ini terdiri dari 2(dua) langkah, yaitu Analisa Masalah
dan Rencana Usulan Kegiatan
1) Analisa Masalah
16

Analisa masalah dapat dilakukan melalui kesepakatan kelompok tim


penyusun PTP dan konsil kesehatan kecamatan/Badan Penyantun
Puskesmas melalui tahap :
a) Identifikasi Masalah
Masalah adalah kesenjangan antara harapan dan kenyataan.
Identifikasi masalah dilaksanakan dengan membuat daftar
masalah yang dikelompokkan menurut jenis program, cakupan,
mutu, ketersediaan sumber daya.
Contoh tabel Identifikasi Masalah
No. Program Target Pencapaian Masalah
1
2
3
dst

b) Menetapkan Urutan Prioritas Masalah


Mengingat adanya keterbatasan kemampuan mengatasi
masalah secara sekaligus, maka perlu dipilih prioritas masalah
dengan jalan kesepakatan tim. Dalam penetapan urutan
prioritas masalah dapat menggunakan berbagai macam metode
seperti kriteria matriks, MCUA, Hanlon, CARL dsb.
Contoh kriteria matriks : masing-masing kriteria ditetapkan
dengan nilai 1-5. Nilai semakin besar jika tingkat urgensinya
sangat mendesak, atau tingkat perkembangannya dan tingkat
keseriusan semakin memprihatinkan bila tidak diatasi.
Kemudian kalikan tingkat urgensi (U) dengan tingkat
perkembangan (G), dan tingkat keseriusan (S). Prioritas
masalah diurutkan berdasarkan hasil perkalian yang besar dan
disusun dalam matriks.
17

Masalah Masalah 1 Masalah 2 Masalah 3


Kriteria
Tingkat Urgensi (U)
Tingkat Keseriusan (S)
Tingkat Perkembangan (G)
UxSxG

c) Merumuskan Masalah
Hal ini mencakup apa masalahnya, siapa yang terkena
masalahnya, berapa besar masalahnya, dimana masalah itu terjadi
dan bilamana masalah itu terjadi (what, who, when, where, how)

d) Mencari Akar Penyebab Masalah


Mencari akar penyebab masalah dapat dilakukan dengan
menggunakan metode diagram sebab akibat dari Ishikawa
(disebut juga diagram tulang ikan karena digambarkan
membentuk tulang ikan). Kemungkinan penyebab masalah dapat
berasal dari :
- Input (sumber daya) : Jenis dan jumlah alat, obat, tenaga serta
prosedur kerja manajemen alat, obat dan dana
- Proses (Pelaksanaan kegiatan) : frekuensi, kepatuhan
pelayanan medis dan non medis
- Lingkungan
Kategori yang dapat digunakan antara lain adalah man,
money, material dan methode.
18

Gambar 2.1. Diagram Sebab Akibat dari Ishikawa (Fishbone)

MANUSIA METODE

Masalah

SARANA DANA LINGKUNGAN

e) Menetapkan Cara-Cara Pemecahan Masalah


Untuk menetapkan cara pemecahan masalah dapat dilakukan dengan
kesepakatan diantara anggota tim. Bila tidak terjadi kesepakatan dapat
digunakan kriteria matriks. Untuk itu harus dicari alternatif pemecahan
masalahnya.
Contoh tabel Cara Pemecahan Masalah
No. Prioritas Penyebab Alternatif Pemecahan Ket
Masalah Masalah Pemecahan Masalah
Masalah Terpilih
1.
2.
3.
dst

2.2.4 Klinik Pelayanan Kesehatan Anak (Klinik MTBS)2,12


MTBS singkatan dari Manajemen Terpadu Balita Sakit atau
Integrated Management of Childhood Illness (IMCI) suatu pendekatan
yang terintegrasi/terpadu dalam tatalaksana balita sakit dengan fokus
kepada kesehatan anak usia 0-5 tahun (balita) secara menyeluruh. MTBS
bukan merupakan suatu program kesehatan tetapi suatu pendekatan/cara
menatalaksana balita sakit. Kegiatan MTBS merupakan upaya yang
19

ditujukan untuk menurunkan kesakitan dan kematian sekaligus


meningkatkan kualitas pelayanan kesehatan anak balita di unit rawat jalan
kesehatan dasar seperti Puskesmas, Pustu, Polindes, Poskesdes, dll. Klinik
MTBS ini melayani pasien anak, yaitu usia 0-5 tahun. Pada pelaksanaannya
klinik ini dilayani oleh perawat terlatih. Pada klinik ini mulai
dikembangkan Manajemen Terpadu Balita Sakit (MTBS) untuk anak usia 2
bulan sampai 5 tahun dan Manajemen Terpadu Bayi Muda (MTBM) untuk
anak usia 0-2 bulan. Dengan sistem MTBS dan MTBM ini,
penatalaksanaan terhadap anak sakit dilakukan secara komprehensif, tidak
hanya terfokus pada keluhan sakit anak, namum juga dilakukan terhadap
pemantauan terhadap status gizi, riwayat kelahiran, riwayat atau pola
makan dan riwayat imunisasinya. Dengan demikian, apabila pada anak
sakit ini terdapat permasalahan gizi atau imunisasi, atau penyakitnya
berbasis lingkungan, maka akan dilakukan rujukan ke klinik gilinganmas,
disamping pengobatan (kuratif). Disamping itu, pada klinik MTBS ini juga
akan senantiasa dilakukan penyuluhan sesuai dengan permasalahan anak.
Ada 3 komponen dalam penerapan strategi MTBS yaitu:
1. Komponen I : meningkatkan ketrampilan petugas kesehatan dalam
tatalaksana kasus balita sakit (dokter, perawat, bidan, petugas
kesehatan)
2. Komponen II : memperbaiki sistem kesehatan agar penanganan
penyakit pada balita lebih efektif
3. Komponen III : Memperbaiki praktek keluarga dan masyarakat
dalam perawatan di rumah dan upaya pencarian pertolongan kasus
balita sakit (meningkatkan pemberdayaan keluarga dan
masyarakat, yang dikenal sebagai Manajemen Terpadu Balita
Sakit berbasis masyarakat).
Seorang balita sakit dapat ditangani dengan pendekatan MTBS oleh
Petugas kesehatan yang telah dilatih. Petugas memakai tool yang disebut
Algoritma MTBS. Untuk melakukan penilaian/pemeriksaan dengan cara
menanyakan kepada orang tua/wali, apa saja keluhan-keluhan/masalah
20

anak kemudian memeriksa dengan cara 'lihat dan dengar' atau 'lihat dan
raba'. Setelah itu petugas akan mengklasifikasikan semua gejala
berdasarkan hasil tanya-jawab dan pemeriksaan. Berdasarkan hasil
klasifikasi penyakit, petugas akan menentukan tindakan/pengobatan,
misalnya anak dengan klasifikasi Pneumonia Berat atau Penyakit Sangat
Berat akan dirujuk ke dokter Puskesmas.

Penemuan Penderita Pneumonia


Penemuan dan tatalaksana pneumonia merupakan kegiatan inti
dalam pengendalian pneumonia balita. Penemuan penderita pneumonia
dapat dilakukan secara pasif yaitu penderita datang ke fasilitas kesehatan
seperti Puskesmas, puskesmas pembantu dan rumah sakit atau dapat pula
secara aktif yaitu petugas kesehatan bersama dengan kader secara aktif
menemukan penderita baru dan penderita pneumonia yang seharusnya
datang untuk kunjungan ulang 2 hari setelah berobat.10

2.3.1 Definisi Operasional


Presentase balita dengan Pneumonia yang ditemukan dan diberikan
tatalaksana sesuai standar di Sarana Kesehatan di satu wilayah dalam
waktu satu tahun.4

2.3.2 Cara Perhitungan atau Rumus4


a. Rumus

b. Pembilang
Jumlah penderita pneumonia balita yang ditangani di suatu
wilayah tertentu dalam waktu satu bulan.
21

c. Penyebut
Jumlah perkiraan pneumonia balita ada suatu wilayah tertentu
dalam waktu yang sama

d. Ukuran atau konstanta


Persentase (%)

e. Contoh Perhitungan
Apabila jumlah penduduk suatu wilayah 30.000 jiwa,
jumlah balita Puskesmas A adalah 3000 balita, maka perkiraan
jumlah penderita pneumonia balita tahun 2013 di puskesmas A
adalah 10% dari jumlah balita, maka :
Jumlah perkiraan penderita pneumonia balita = 10% x
3000 balita = 300 balita. Jumlah penderita pneumonia yang
ditangani di Puskesmas A tahun 2013 adalah 250 balita.
Cakupan balita dengan pneumonia balita yag ditangani =
250/300x100% = 83%

2.3.3 Sumber Data


Kartu penderita atau register harian, dan laporan bulanan
puskesmas atau Medical Record rumah sakit. 4

2.3.4 Rujukan
Keputusan Menteri Kesehatan RI nomor :
1537/MENKES/SK/XII/2002 tentang Pedoman Pemberantasan
Penyakit Infeksi Saluran Pernapasan Akut untuk
Penanggulangan Pneumonia Pada Balita, Buku Tatalaksana
Pneumonia Balita, Pedoman MTBS. 13

2.3.5 Langkah Kegiatan4


a. Pelayanan Penderita
- Deteksi dini penderita pneumonia balita sesuai klasifikasi
22

- Pengobatan
- Fasilitasi penderita pneumonia berat yang memerlukan rujukan
- Pembinaan care seeking
b. Penyediaan alat
c. Pelatihan petugas
d. Penyuluhan ke masyarakat
e. Jejaring kerja dan kemitraan
f. Pengumpulan, pengolahan, dan analisis data
g. Monitoring atau supervise ke sarana kesehatan
h. Pertemuan evaluasi
i. Pencatatan dan pelaporan

2.3.6 Sumber Daya Manusia4


a. Dokter Spesialis anak
b. Dokter umum
c. Bidan
d. Perawat
5
BAB III
PROFIL UMUM PUSKESMAS

2.1 Visi, Misi, Motto, dan Nilai Puskesmas Merdeka


2.1.1 Visi
Tercapainya Kecamatan Bukit Kecil Sehat dengan bertumpu pada
pelayanan prima dan pemberdayaan masyarakat.
2.1.2 Misi
1. Meningkatkan kemitraan pada semua pihak.
2. Meningkatkan profesionalitas provider dan pemberdayaan
masyarakat.
3. Meningkatkan sarana dan prasarana kesehatan yang bermutu
prima.
4. Mengikuti standar yang telah ditetapkan.
2.1.3 Motto
Kesehatan anda adalah kebahagiaan kami.
2.1.4 Kebijakan Mutu
Puskesmas Merdeka bertekad meningkatkan kualitas pelayanan secara
berkesinambungan berdasarkan standar yang ditetapkan demi tercapainya
kepuasan masyarakat.
2.1.5 Budaya Kerja
Melayani dengan sepenuh hati dan mengutamakan kepuasan
pelanggan
Elok hati, senyum, sapa, dan salam
Rasa kekeluargaan, kebersamaan, dan kekompakkan
Disiplin kerja selalu diutamakan
Etika dijaga, ikhlas, jujur, dan penuh tanggung jawab
Kebersihan dan kerapian diri dan lingkungan kerja
Apapun yang dikerjakan sesuai dengan protap

24
25

Letak Geografis Puskesmas Merdeka Palembang


2.1.6 Letak dan Wilayah Kerja
Puskesmas Merdeka terletak di Jalan Merdeka No. 66 Kelurahan
Talang Semut Kecamatan Bukit Kecil. Puskesmas ini tepat di pinggir jalan
raya yang cukup strategis dan mudah dijangkau oleh masyarakat. Selain itu
juga banyak dilalui oleh kendaraan umum dan pejalan kaki.
Tabel 1. Luas Wilayah Kerja Puskesmas Merdeka
No. Kelurahan Luas Wilayah

1. 19 Ilir 35,5 km2

2. 22 Ilir 9 km2

3. 26 Ilir 31,5 km2

4. Talang Semut 47 km2

Total 1232

Wilayah kerja Puskesmas Merdeka ini berbatasan dengan:


Sebelah Utara : Kelurahan 23 ilir, 24 ilir (wilayah kerja
Puskesmas 23 ilir)
Sebelah Timur : Kelurahan 28 ilir, 29 ilir, dan 30 ilir (Kecamatan
IB I)
Sebelah Selatan : Kelurahan 16 ilir (Kecamatan IT I)
Sebelah Barat : Kelurahan 26 ilir D I (Kecamatan IB I)

2.1.7 Demografi
Wilayah kerja Puskesmas Merdeka meliputi 4 (empat) kelurahan
dengan jumlah penduduk 29.801 jiwa.
26

Berdasarkan keadaan sosial ekonominya, mata pencaharian pada


empat kelurahan hampir sama, yaitu diantaranya:
Buruh kasar
Pegawai negeri
Pedagang
Pensiunan
Petani
27

Tabel 2. Peta Demografi di Wilayah Kerja Puskesmas Merdeka Tahun 2016


Kelurahan

No Deskripsi Talang Jumlah


19 Ilir 22 Ilir 26 Ilir
Semut

1 Jumlah Penduduk 3211 3899 14858 7833 29801

2 Jumlah Kepala Keluarga (KK)

a. KK Gakin 431 577 1760 776 3544

b. KK NoGakin 320 237 1684 878 3119

3 Jumlah Ibu Bersalin (Bulin) 70 85 325 172 652

4 Jumlah Ibu Meneteki (Buteki) 66 78 4078 158 600

5 Jumlah Ibu Nifas (Bufas) 70 85 2303 337 817

6 Jumlah Wanita Usia Subur


882 1070 298 2150 8180
(WUS)

7 Jumlah Wanita Peserta KB


551 604 1228 1188 4646
Aktif

8 Jumlah Bayi 66 78 298 158 600

9 Jumlah Anak Balita 264 322 1228 644 2458

10 Jumlah Anak Batita 176 219 846 439 1680

11 Jumlah Anak Baduta 121 164 584 341 1210

12 Jumlah Remaja 750 901 3388 1801 6840

13 Jumlah Usila 482 1126 1447 1286 4341

14 Jumlah Taman Kanak-Kanak


2 1 6 6 15
(TK)
28

15 Jumlah SD/Madrasah
Ibtidaiyah

a. Negeri 0 0 2 0 2

b. Swasta 0 0 3 3 6

16 Jumlah SMP/Sederajatnya

a. Negeri 0 0 0 1 1

b. Swasta 0 0 2 1 3

17 Jumlah SMA/Madrasah Aliyah

a. Negeri 0 0 0 0 0

b. Swasta 0 0 0 4 4

18 Jumlah Akademi

a. Negeri 0 0 0 1 1

b. Swasta 0 0 0 0 1

19 Jumlah Perguruan Tinggi

a. Negeri 0 0 0 0 0

b. Swasta 0 1 0 0 1

20 Jumlah Rumah 469 312 1296 1169 3246

21 Jumlah Rumah Sehat 375 249 1036 1023 2683

2.2 Fasilitas Pelayanan Kesehatan


Dalam rangka memenuhi kebutuhan masyarakat, Puskesmas Merdeka
memenuhi kebutuhan tersebut melalui 6 (enam) program pokok Puskesmas
beserta program spesifik yang ditentukan berdasarkan banyaknya permasalahan
kesehatan masyarakat setempat serta tuntutan dan kebutuhan masyarakat.
29

Enam program pokok Puskesmas tersebut adalah:


1. Promosi Kesehatan (Promkes)
2. Sanitasi (Kesehatan Lingkungan)
3. KIA/KB
4. Perbaikan Gizi Masyarakat
5. Pencegahan dan Pemberantasan Penyakit (P2P)
6. Pengobatan
Program spesifik yang dilaksanakan di Puskesmas Merdeka:
1. Klinik Kesehatan Reproduksi (Kespro)
2. Klinik Gilingan Mas
3. Klinik Gawat Darurat
4. Klinik PTM (Penyakit Tidak Menular)
5. Klinik Kesehatan Remaja
6. Klinik Santun Lansia
7. Klinik Haji
8. Klinik Berhenti Merokok
Seluruh program kegiatan tersebut di dalam gedung di fasilitasi dengan adanya
ruang dan peralatan yang memadai, program kerja, sumber daya manusia yang
selalu ditingkatkan kemampuannya dan protap-protap sebagai standar
pelayanannya.

Fasilitas yang disediakan di Puskesmas Merdeka sebagai berikut:


1. Poli Pelayanan Kesehatan Ibu (Poli KIA/KB)
Kegiatan yang dilakukan di klinik ini meliputi pelayanan kebidanan
terhadap Ibu hamil (Bumil), Ibu bersalin (Bulin), Ibu yang telah bersalin
(Bufas), dan Ibu menyusui (Busui).
Untuk kegiatan KB, PuskesmasMerdeja melayani kebutuhan masyarakat
dalam hal KB berupa IUD, Implant, Pil, Suntikan, dan Kondom.
Poli ini dalam pelaksanaannya dilayani oleh pada bidan terlatih dan dokter
spesialis Kandungan, yang dilengkapi dengan pemeriksaan USG.
2. Poli Pelayanan Kesehatan Umum (Poli Umum)
30

Poli ini melayani pengobatan umum bagi pasien dewasa, yaitu pasien usia
lebih dari 6 tahun. Pengobatan dilakukan terhadap pasien umum, Askes,
maupun pasien gakin (Jamkesmas). Di samping itu, Poli Umum ini juga
melayani tindakan kegawatdaruratan dan rujukan pasien dari unit-unit
fungsional lainnya yang tidak dapat ditangani di Puskesmas maupun
terhadap pasien-pasien dengan kasus penyakit kronik yang sudah berobat
rutin di Rumah Sakit. Namun, sebelum dilakukan rujukan, Poli Umum
juga akan melakukan perbaikan keadaan umum pasien, baik kasus gawat
darurat umum maupun kebidanan. Selayaknya pelayanan
kegawatdaruratan (UGD) dilaksanakan di tempat terpisah dengan
pelayanan Poli Umum. Namun karena keterbatasan ruangan di Puskesmas,
ruang Poli Umum dan UGD dijadikan satu.
Di klinik ini dilayani pula pengobatan terhadap penderita TB Paru dan
Kusta selain penyakit lainnya. Pada prinsipnya, pelayanan kesehatan yang
dilakukan di Poli Umum ini reintegrasi dengan program-program yang ada
di Puskesmas, yaitu program pencegahan, pengobatan, dan pengendalian
penyakit tidak menular (PTM), program P2 kelami, Upaya Kesehatan
Jiwa, Upaya Kesehatan Indera Penglihatan dan Pendengaran.
Pada pelaksanaannya klinik ini dilayani oleh seorang dokter umum yang
dibantu para perawat terlatih.
3. Poli Pelayanan Kesehatan Anak (Poli MTBS)
Poli MTBS ini melayani pasien anak, yaitu usia 0-5 tahun. Pada
pelaksanaannya, poli ini dilayani oleh seorang dokter umum yang dibantu
oleh para perawat terlatih. Pada poli ini mulai dikembangkan sistem
Manajemen Terpadu Balita Sakit (MTBS) untuk anak usia 2 bulan sampat
5 tahun dan Manajemen Terpadu Bayi Muda (MTBM) untuk anak usia 0-2
bulan.
Dengan sistem MTBS dan MTBM ini , penatalaksanaan terhadap anak
sakit dilakukan secara komprehensif, tidak hanya terfokus pada keluhan
sakit anak, namun juga dilakukan pemantauan terhadap status gizi, riwayat
kelahiran, riwayat atau pola makan dan riwayat imunisasinya. Dengan
31

demikian, apabila pada anak sakit ini terdapat permasalahan gizi dan atau
imunisasi, atau penyakitnya berbasis lingkungan, maka akan dilakukan
rujukan ke klinik gilinganmas. Di samping itu, pada Poli MTBS ini juga
akan senantiasa dilakukan penyuluhan sesuai dengan permasalahan anak.
Di samping pengobatan, Poli MTBS juga melakukan pemantauan terhadap
tumbuh kembang anak usia 0-60 bulan melalui upaya Stimulasi,
Intervensi, dan Deteksi Dini Tumbuh Kembang (SIDDTK). Pada kegiatan
ini, dilakukan deteksi dini, stimulasi terhadap kasus dengan gangguan
tumbuh kembang dan rujukan kasus dengan gangguan tumbuh kembang
tersebut.
4. Poli Pelayanan Kesehatan Gigi (Poli Gigi)
Poli ini melayani pengobatan dan perawatan gigi bagi seluruh lapisan
masyarakat yang membutuhkannya terutama pengobatan dasar seperti
pencabutan dan penambalan gigi.
Dalam pelaksanaannya Poli ini dilayani oleh seorang Dokter Gigi dan
dibantu oleh para perawat gigi yang berpengalaman dan terlatih.
Untuk memenuhi kebutuhan masyarakat, Puskesmas Merdeka
melaksanakan kegiatan UKGS bagi anak sekolah di sekolah-sekolah dan
UKGMD bagi masyarakat umum terutama balita dan ibu hamil di
posyandu-posyandu. UKGS dan UKGMD dilaksanakan 3 kali setahun.
5. Klinik Gizi dan Sanitasi
Klinik ini mliputi:
a. Konsultasi Gizi
Melayani konsultasi Gizi Masyarakat dan Gizi Perorangan, baik di
dalam maupun di luar gedung. Dilaksanakan oleh seorang Petugas
Gizi setiap hari.
b. Konsultasi Kesehatan Lingkungan (Sanitasi)
Memberikan konsultasi mengenai kesehatan dan kebersihan
lingkungan Rumah Sehat, Jamban Sehat, Sarana Air Bersih,
Pemberantasan Sarang Nyamuk (PSN). Dilaksanakan oleh
Sanitarian, setiap hari, baik di dalam maupun di luar gedung.
32

6. Laboratorium
Melayani pemeriksaan laboratorium sederhana seperti tes kehamilan, Hb,
golongan darah, kimia darah, urine rutin, darah rutin, dan BTA sputum.
Pelayanan dilakukan setiap hari bagi pasien yang membutuhkan.
7. Penyuluhan Kesehatan
Dilakukan pada perorangan ataupun perkelompok, baik dilaksanakan di
Puskesmas, sekolah ataupun di tempat lain yang membutuhkan.
Pelayanan ini akan dilaksanakan oleh tenaga-tenaga penyuluh yang
menguasai materi yang dibahas. Kegiatan penyuluhan meliputi kegiatan di
dalam gedung dan kegiatan luar gedung.
8. Poli Pelayanan Kesehatan Usia Lanjut (Poli Lansia)
Puskesmas Merdeka khusus melayani pelayanan kesehatan terhadap
pasien lansia, yang terbagi menjadi dua yaitu pralansia 49 sampai 59 tahun
dan lansia lebih dari 60 tahun. Pelayanan kesehatan ini dilakukan dengan
mengutamakan pasien lansia, baik di loket pendaftaran, tempat
pemeriksaan kesehatan yang terpisah, meskipun pelayanna di apotek. Hal
ini bertujuan agar pasien lansia tidak lama menunggu/mengantri,
mengingat keterbatasan fisik dan psikis pasien-pasien tersebut.
Pelayanan kesehatan yang dilakukan terhadap pasien lansia adalah
screening lansia yang meliputi pemeriksaan antropometri (BB, TB, lingkar
pinggang), tekanan darah, Hb, gula darah, reduksi protein, pemeriksaan
intelegensi, dan kelainan vaskuler, di samping pemeriksaan terhadap
keluhannya (penyakit). Setiap pasien akan mendapat Kartu Menuju Sehat
Usia Lanjut (KMS lansia). KMS ini bertujuan untuk memantau kesehatan
pasien lansia secara berkesinambungan. Di samping itu, juga selalu
dilakukan penyuluhan terhadap permasalahan kesehatan lansia maupun
penyakitnya.
Untuk meningkatkan jangkauan pelayanannya, Puskesmas Santun Usia
Lanjut juga melakukan pemeriksaan kesehatan secara berkala terhadap
pasien lansia melalui PosyanduLansia. Pada saat ini Puskesmas Merdeka
33

telah memiliki 10 posyandu lansia, yang terdapat di masing-masing


Kelurahan. Kegiatan PosyanduLansia yang dilaksanakan sebulan sekali ini
meliputi pemeriksaan kesehatan berkala, pengobatan, pengajian,
penyuluhan kesehatan, dan senam lansia. Kegiatan di posyandu lansia ini
dilakukan oleh kader dan petugas dari Puskesmas.
9. Poli Kesehatan Reproduksi (Kespro)
Klinik Kesehatan Reproduksi (Kespro) merupakan salah satu program
Puskesmas Merdeka yang khusus memberikan perhatian terhadap
permasalahan kesehatan reproduksi di wilayah kerja Puskesmas Merdeka.
Kegiatan ini dilaksanakan oleh seorang tenaga dokter umum, perawat, dan
bidan.
Pelayanan kesehatan reproduksi dilaksanakan di dalam maupun di luar
gedung Puskesmas Merdeka. Kegiatan di dalam gedung meliputi
pemeriksaan dan pengobatan terhadap pasien dengan permasalahan
reproduksinya, baik terhadap kespro remaja, wanita usia subur, dan pasien
lansia. Setelah itu, akan dilakukan pencatatan/register secara terpisah
terhadap pasien kespro di setiap kelompok usia. Pelayanan kesehatan
reproduksi di dalam gedung dilakukan di unit Poli Umum dewasa dan
KIA. Di samping itu, juga akan dilakukan penyuluhan terhadap pasien
tersebut. Khusus terhadap pasien kespro WUS (wanita usia subur),
dilakukan konseling/penyuluhan terhadap pasangannya. Sedangkan
kegiatan kespro yang dilakukan di luar gedung meliputi penyuluhan
kesehatan reproduksi remaja di sekolah, yang biasanya bersamaan dengan
penyuluhan napza, dan skrining permasalahan kespro remaja di sekolah.
10. Pelayanan Kesehatan Peduli Remaja (PKPR)/Klinik Remaja
Program PKPR ini ditujukan untuk memberikan pelayanan kesehatan yang
komprehensif terhadap remaja, yaitu masyarakat berusia 10-19 tahun.
Program ini dilaksanakan di dalam maupun di luar gedung. Kegiatan di
dalam gedung meliputi pemeriksaan kesehatan dengan menggunakan
status khusus remaja, yang bertujuan untuk memberikan pelayanan
kesehatan yang komprehensif, bukan hanya terfokus pada penyakitnya,
34

namun juga pada riwayat pubertas, perkembangan mental, riwayat


merokok, memakai napza, dan lain sebagainya. Selain itu, pasien remaja
akan diberikan konseling sesuai dengan penyakit dan permasalahan
kesehatan lain yang ditemui pada saat itu, dan terakhir diberikan obat.
Sedangkan kegiatan PKPR di luar gedung, meliputi penyuluhan tentang
reproduksi, napza, dan merokok. Di samping itu, juga diadakan kegiatan
survei permasalahan perilaku remaja.
Untuk meningkatkan peran serta remaja dalam bidang kesehatan. Maka di
setiap sekolah diadakan pelatihan kader kesehatan remaja (peerconselor).
Peerconselor ini diharapkan akan mampu mempromosikan perilaku hidup
bersih dan sehat di tatanan sekolah dan mampu memberikan pertolongan
pertama terhadap permasalahan kesehatan yang terjadi di sekolahnya.
11. Klinik PTM
Mulai tahun 2013 Puskesmas Merdeka membuka Klinik PTM dimana
pasien dari lumut 16 tahun sampai lansia dimana ada gejala gangguan
sindroma metabolik (berat badan overweight, DM, dislipidemia). Selain
itu juga pasien WUS diperiksa SADARI (Pemeriksaan Payudara Sendiri)
dan pemeriksaan screening berupa pemeriksaan IVA.
12. Pemeriksaan Haji
Puskesmas Merdeka dipercaya dan ditunjuk sebagai Puskesmas pemeriksa
kesehatan calon jemaah haji baik pemeriksaan pertama dan kedua.
13. Lain-lain
Dalam memenuhi kebutuhan masyarakat di wilayah kerjanya, Puskesmas
Merdeka melakukan kegiatan-kegiatan secara jemput bola. Kegiatan-
kegiatan tersebut diantaranya adalah PosyanduBalita di 16 Posyandu,
PosyanduLansia di 10 Posyandu, UKS/UKGS di 7 SDMI, 6 SMP,
UKGMD di 16 Posyandu serta melakuakn kunjungan ke rumah pasien
bagi pasien-pasien yang membutuhkannya.
35

2.3 Ketenagaan
Untuk kelancaran pelaksanaankegiatan sehari-harinya, Puskesmas Merdeka
dipimpin oleh seorang Pimpinan Puskesmas sejak April 2016 dijabat oleh dr. Hj.
DestyAryani, M.Kes yang dibantu oleh 2 orang dokter umum, 1 orang dokter
spesialis kandungan, 2 orang dokter gigi, 3 orang sarjana kesehatan masyarakat, 6
orang perawat ahli madya, 4 orang perawat, 2 orang perawat gigi, 6 orang bidan, 2
orang asisten apoteker, 1 orang sanitarian, 1 orang petugas gizi, dan 1 orang
analis.
Sesuai dengan komitmen yang telah disepakati bersama antara pimpinan
Ana seluruh staf Puskesmas Merdeka, maka diadakan jadwal pembelajaran dan
pelatihan baik di dalam maupun di luar Puskesmas. Hal ini bertujuan untuk
meningkatkan kualitas dan keterampilan sumber daya manusia yang ada di
Puskesmas Merdeka.
BAB IV
PEMBAHASAN

4.1 Identifikasi Penyebab


Salah satu program manajemen terpadu balita sakit di Puskesmas
Merdeka tahun 2016 yaitu untuk penemuan penderita pneumonia balita,
pencapaiannya masih dibawah target yaitu 48,6 % dari ketetapan
kebijakan 100%.
Rumus:

Perhitungan :
Jumlah penduduk di wilayah Puskesmas Merdeka sebesar 29.801
jiwa, jumlah balita di Puskesmas adalah 2980 balita. Perkiraan jumlah
penderita peneamonia jumlah perkiraan penderita pneumonia belita = 10%
X 2980 balita = 298 balita.
Jumlah penderita pneumonia yang ditangani di Puskesmas
Merdeka tahun 2016 adalah 145 balita. Cakupan balita dengan pneumonia
yang ditangani = 145/298 X 100% = 48,6 %.
Menurut Keputusan Menteri Kesehatan RI Nomor
1457/MenKes/SK/X/2003 tentang Standar Pelayanan Minimal Bidang
Kesehatan di Kabupaten/Kota, target penemuan penderita pneumonia
Balita = 100%. Maka Puskemas Merdeka dengan hasil cakupan balita
dengan pneumonia yang ditangani adalah 48,6 % belum mencapai target.
Oleh karena itu perlu dikaji lebih lanjut penyebab permasalahannya,
sehingga dapat diketahui pemecahan masalah dan perencanan untuk tahun
berikutnya.
Banyak hal yang mempengaruhi tidak tercapainya target penemuan
penderita pneumonia balita di Puskesmas Merdeka Palembang tahun 2016.
36
37

Penyebab masalah bisa berasal dari input, proses, dan lingkungan. Input
terdiri dari 5 komponen, yaitu: Man, Money, Method, Material, dan
Machine. Sedangkan pada proses terdiri dari P1 (perencanaan), P2
(Pergerakan dan pelaksanaan), dan P3 (Pengawasan, pengendalian, dan
penilaian). Disamping itu, lingkungan dapat mempengaruhi input dan
proses.
Program Perencanaan Pengendalian ISPA di Puskesmas Merdeka
dijalankan oleh dokter dan bidan/perawat. Program disusun dan dijalannya
dengan koordinasi antar tenaga medis dan kader di wilayah Kerja
Puskesmas Merdeka. Tersedia 16 Posyandu balita yang termasuk ke dalam
wilayah kerja Puskesmas Merdeka. Puskesmas mempunyai ruangan
khusus MTBS. Terdapat stetoskop, termometer, ARI timer, timbangan
bayi, obat-obatan termasuk antibiotik yang dibutuhkan untuk pengobatan
pneumonia dan buku panduan MTBS. Metode pendataan dimulai dari
pasien balita di bawa ke ruang MTBS dan diperiksa oleh Dokter atau
Bidan/Perawat, jika didiagnosis pneumonia maka akan dilakukan terapi
sesuai dengan algoritma. Selain itu, Pukesmas juga melakukan
penyuluhan mengenai pneumonia baik didalam maupun diluar Puskesmas.
Proses dalam menjalankan program Perencanaan Pengendalian
ISPA di Puskesmas Merdeka, setiap bulan selalu dilakukan penyusunan
rencana kegiatan berikutnya. Pelaksanaan program P2ISPA dipuskesmas
dilakukan setiap hari di MTBS. Petugas program melakukan home visite
pada 2 rumah balita pneumonia setiap bulan. Pengawasan program
dilakukan langsung oleh Kepala puskesmas melalui laporan bulanan yang
diberikan oleh koordinator program. Untuk faktor Lingungan, terdapat
sarana transportasi untuk menjangkau puskesmas dan rumah warga.
38

Tabel 4.1 Kemungkinan Penyebab Masalah Berdasarkan Pendekatan Sistem


INPUT KEKURANGAN
Man 1. Pemeriksaan awal hingga akhir tidak selalu dilakukan oleh
dokter namun oleh bidan/perawat
2. Petugas program ISPA merangkap tugas lain
3. Kurangnya pelatihan dan pembinaan kaderisasi P2ISPA di
Posyandu serta melakukan kunjungan rumah berupa care
seeking untuk mencari penderita pneumonia balita
Money
Method 4. Penemuan kasus hanya dilakukan secara pasif
5. Kurang kerjasama lintas sektoral
6. Pengisian form MTBS belum dilakukan dengan lengkap
Material
Machine 7. Kurangnya media informasi seperti brosur dan leaflet.
PROSES KEKURANGAN
P1 (perencanaan) 8. Belum ada pembinaan masyarakat tentang penyakit
pneumonia
P2 (Pergerakan 9. Dalam pelaksanaan program petugas MTBS kurang
dan Pelaksanaan) maksimal dalam penggunaan algoritma MTBS
P3 (Penilaian, 10. Kurangnya pengawasan secara menyeluruh dari petugas
pengawasan, setelah dilakukan home visite 1 kali, tidak dilakukan follow
pengendalian) up

LINGKUNGAN KEKURANGAN
11. Sosialisasi dan budaya dengan melakukan pendekatan tokoh
masyarakat setempat.
39

Rekapitulasi Penyebab Masalah


Berdasarkan analisis pendekatan sistem, maka didapatkan penyebab
masalah adalah sebagai berikut:
1. Pemeriksaan awal hingga akhir tidak selalu dilakukan oleh dokter namun oleh
bidan/perawat yang kurang kompeten
2. Petugas program ISPA merangkap tugas lain
3. Kurangnya pelatihan dan pembinaan kader P2ISPA di Posyandu
4. Penemuan kasus hanya dilakukan secara pasif yaitu dari kunjungan pasien
5. Kurang kerjasama lintas sektoral
6. Pengisian form MTBS belum dilakukan dengan lengkap
7. Kurangnya media informasi seperti brosur dan leaflet.
8. Belum ada pembinaan masyarakat tentang penyakit pneumonia
9. Dalam pelaksanaan program petugas di MTBS kurang maksimal dalam
penggunaan algoritma MTBS
10. Kurangnya pengawasan secara menyeluruh dari petugas setelah dilakukan
home visite 1 kali, tidak dilakukan follow up
11. Sosialisasi dan budaya dengan melakukan pendekatan tokoh masyarakat
setempat
40

Selain itu untuk mencari akar penyebab masalah dapat menggunakan


fishbone diagram seperti tertera dalam gambar berikut.

Manusia Metode
Penyuluhan kepada
masyarakat kurang
Algoritma MTBS
Kinerja petugas
tidak digunakan
belum maksimal Pencarian kasus
dalam penggunaan maksimal
hanya secara pasif
algroitma MTBS

Peran kader
kurang tidak
Kurang bimbingan dilakukan
dari dokter Kurang dilatih oleh care seeking Pelaksanaan
puskesmas petugas kesehatan program
penemuan
pneumonia
belum
memadai

Kurang kerjasama
Sarana penyuluhan
dengan tokoh
kurang (brosur)
masyarakat

Tidak semua masyarakat


berobat ke puskesmas, ada
juga yang ke pelayanan
kesehatan lain
Sarana Dana Lingkungan

Gambar 4.1 Fishbone Diagram Mencari Akar Penyebab Masalah


41

4.2 Prioritas Masalah


Masalah yang mempunyai total angka tertinggi dari hasil penjumlahan yang
akan menjadi prioritas masalah.
Tabel 4.2 Prioritas Masalah berdasarkan USG
U: urgent Paling Sangat Mendesak Biasa Tidak
(mendesak) mendesak mendesak mendesak
5 4 3 2 1
S: serious Fatal Sangat Gawat Biasa Tidak
(Gawat) gawat Gawat
5 4 3 2 1
G: Growth Sangat Cepat Agak Biasa Lambat
(Perkembangan) cepat Cepat
5 4 3 2 1

Tabel 4.3 Penentuan Prioritas Masalah


No Aspek Masalah Urgensi Seriousness Growth Total

1. Penemuan kasus hanya 5 5 5 125


dilakukan secara pasif
2. Pemeriksaan awal hingga 5 5 4 100
akhir tidak selalu dilakukan
oleh dokter
3. Petugas program ISPA 4 5 4 80
merangkap tugas lain
4. Kurang kerjasama lintas 4 5 4 80
sektoral
5. Pengisian form MTBS 4 5 4 80
belum dilakukan dengan
lengkap

6. Kurangnya pengawasan 5 4 4 80
secara menyeluruh dari
petugas setelah dilakukan
home visite 1 kali, tidak
dilakukan follow up
42

7. Kurangnya pelatihan dan 5 4 4 80


pembinaan kader P2ISPA di
Posyandu

8. Dalam pelaksanaan 5 4 4 80
program, petugas kurang
maksimal dalam
penggunaan algoritma
MTBS
9. Kurangnya media informasi 4 3 3 36
seperti brosur dan leaflet
10. Belum ada pembinaan 4 3 3 36
masyarakat tentang
penyakit pneumonia

11. Sosialisasi dan budaya 3 3 3 27


dengan melakukan
pendekatan tokoh
masyarakat setempat

4.3. Alternatif Penyelesaian Masalah


Dalam menentukan suatu prioritas masalah terdapat beberapa faktor yang
perlu dipertimbangkan. Faktor tersebut meliputi urgensi, keseriusan masalah dan
pertumbuhan dari masalah itu sendiri. Berdasarkan tabel 4.3, ditemukan masalah
mengenai penemuan kasus yang hanya dilakukan secara pasif merupakan masalah
dengan total skor terbesar sehingga masalah ini merupakan masalah terpilih yang
akan dicari alternatif pemecahan masalahnya.
Tabel 4.4 Alternatif Penyelesaian Masalah
Prioritas
Prioritas Masalah penyebab Alternatif Penyelesaian Masalah
masalah
Belum tercapainya Penemuan 1. Mengadakan pelatihan dan
terget cakupan atau kasus hanya pembinaan petugas puskesmas
penemuan serta dilakukan dalam mendeteksi penemuan
penanganan penderita secara pasif kasus pneumonia di Puskesmas
43

pneumonia di Merdeka
Puskesmas Merdeka 2. Mengikutsertakan tokoh
Palembang tahun 2016 masyarakat dan instansi lain
sebagai motivator serta lebih
menggiatkan dan melatih kader
dalam mengelola kegiatan
penemuan kasus pneumonia
3. Melakukan care seeking, pada
balita yang kontak dengan
pernderita pneumonia atau
memiliki resiko.
4. Sosialisasi dan pembinaan
masyarakat tentang gejala dan
bahaya dari pneumonia dengan
pendekatan yang menarik agar
masyarakat lebih peduli terhadap
penyakit pneumonia.

4.4 Penyelesaian Masalah


Penyelesaian Masalah Rendahnya Penemuan penderita ISPA (pneumonia) di
Puskesmas Merdeka Palembang tahun 2016 yaitu melakukan penemuan kasus
secara aktif dengan mengadakan pelatihan dan pembinaan petugas puskesmas
dalam mendeteksi kasus pneumonia serta menggiatkan program kunjungan rumah
(care seeking) agar tidak ada pasien pneumonia yang terabaikan atau yang tidak
terdata, mengikutsertakan tokoh masyarakat dan instansi lain sebagai motivator
serta lebih menggiatkan kader dalam mengelola kegiatan penemuan kasus
pneumonia serta melakukan sosialisasi dan pembinaan masyarakat tentang gejala
dan bahaya dari pneumonia dengan pendekatan yang menarik agar masyarakat
lebih peduli terhadap penyakit pneumonia.
44

Tabel 4.5 Penyelesaian Masalah Terpilih


No Alternatif Penyelesaian Urgensi Seriousness Growth Total
Masalah
1. Mengadakan pelatihan dan 5 5 5 125
pembinaan petugas
puskesmas dalam mendeteksi
penemuan kasus pneumonia
2. Melakukan care seeking, pada 5 5 5 125
balita yang kontak dengan
pernderita pneumonia atau
memiliki resiko.
3. Mengikutsertakan tokoh 4 5 4 80
masyarakat dan instansi lain
sebagai motivator serta lebih
menggiatkan kader dalam
mengelola kegiatan penemuan
kasus pneumonia

4. Sosialisasi dan pembinaan 4 4 4 64


masyarakat tentang gejala dan
bahaya dari pneumonia
dengan pendekatan yang
menarik agar masyarakat
lebih peduli terhadap penyakit
pneumonia

Dari tabel tersebut untuk penyelesaian masalah terpilih bagi program


penemuan kasus pneumonia tidak tercapainya cakupan penemuan kasus
45

pneumonia melalui Program Pemberantasan (P2) ISPA yang ada di Puskesmas


Merdeka Palembang adalah Mengadakan pelatihan dan pembinaan petugas
puskesmas dalam mendeteksi kasus pneumonia serta menggiatkan program
kunjungan rumah (care seeking) agar tidak ada pasien pneumonia yang terabaikan
atau yang tidak terdata dan juga dilakukan follow up agar dapat melihat
perkembangan PHBS dalam keluarga tersebut.
Pemilihan penyelesaian masalah ini diharapkan lebih efektif dalam
penemuan kasus pneumonia. Penyelesaian masalah ini juga diharapkan memiliki
dampak yang lebih baik dibandingkan penyelesaian masalah yang lain sehingga
tercapainya target keberhasilan penemuan kasus pneumonia di wilayah kerja
Puskesmas Merdeka Palembang.
BAB V
PENUTUP

5.1. Kesimpulan
Berdasarkan Evaluasi Program MTBS Puskesmas Merdeka
Palembang dengan cara pendekatan sistem dapat diambil kesimpulan
bahwa Program MTBS di Puskesmas Merdeka Palembang tahun 2016
belum berhasil sepenuhnya.
1. Cakupan penemuan penderita Pneumonia di Puskesmas Merdeka
Palembang tahun 2016 adalah 48,6 %
2. Penyebab tidak tercapainya target program MTBS dengan pneumonia
di Puskesmas Merdeka Palembang dengan prioritas masalah
penemuan kasus hanya dilakukan secara pasif.
3. Penyelesaian masalah untuk tercapainya target program MTBS
dengan pneumonia di Puskesmas Merdeka Palembang yaitu
melakukan penemuan kasus secara aktif dengan mengadakan
pelatihan dan pembinaan petugas puskesmas serta menggiatkan
program kunjungan rumah (care seeking) dan dilakukan follow up,
mengikutsertakan tokoh masyarakat, menggiatkan kader , sosialisasi
dan pembinaan masyarakat.

5.2. Saran
Untuk mencapai tujuan yang diinginkan dalam program pemberantasan
penyakit Pneumonia pada program MTBS di Puskesmas Merdeka
Palembang di tahun yang akan datang, maka yang harus dilakukan adalah
1. Pemeriksaan awal hingga akhir baiknya dilakukan oleh dokter.
2. Pencatatan dan pelaporan mengenai hal ini seharusnya disertakan nama
dan alamat balita yang terkena pneumonia.
3. Dilakukannya pelatihan terhadap petugas kesehatan dan kader
mengenai penggunaan algoritma MTBS agar dapat memudahkan
penegakkan dan pengobatan pneumonia yang sesuai dengan pedoman.

44
DAFTAR PUSTAKA

1. Azwar, A. 2002. Pengantar Epidemiologi. Penerbit Binapura Aksara. Edisi


Revisi. Jakarta Barat.
2. Departemen Kesehatan Republik Indonesia. 2008. Petunjuk Teknis
Standar Pelayanan Minimal Bidang Kesehatan Di Kabupaten / Kota.
Keputusan Menteri Kesehatan RI Nomor 828/MenKes/SK/IX/2008. Biro
Hukum dan Organisasi SetJen DepKes RI.
3. Kementerian Kesehatan RI. 2014. Permenkes RI No 75 Tahun 2014
Tentang Puskesmas. Jakarta: Depkes RI.
4. Feriani. Faktor-Faktor yang Mempengaruhi Pneumonia.
(http://www.lontar.ui.ac.id/file=digital/1256875yang-Literatur, Diakses 4
April 2016)
5. Kementerian Kesehatan RI. 2011. Buku Pemberantasan Penyakit Infeksi
Saluran Pernafasan Akut (ISPA) untuk Kader. Direktorat Jenderal
Pemberantasan Penyakit Menular dan Penyehatan Lingkungan
Pemukiman.
6. Balitbangkes Kementerian Kesehatan RI. 2013. Hasil Riset Kesehatan
Dasar Indonesia tahun 2013. Jakarta : Kemenkes RI
7. Departemen Kesehatan Republik Indonesia. 2016. Standar Pelayanan
Minimal Bidang Kesehatan. Keputusan Menteri Kesehatan RI Nomor 43
Tahun 2016. Biro Hukum dan Organisasi SetJen DepKes RI.
8. Departemen Kesehatan RI. 2007. Pedoman Perencanaan Tingkat
Puskesmas Direktorat Jenderal Bina Kesehatan Masyarakat.
9. Departemen Kesehatan RI. 2004. Keputusan Menteri Kesehatan RI Nomor
128/MENKES/SK/II/2004 ttg Kebijakan Dasar Pusat Kesehatan
Masyarakat. Jakarta
10. Dinas Kesehatan Provinsi Sumatera Selatan. 2015. Profil Kesehatan
Sumatera Selatan tahun 2015.
11. Ikatan Dokter Anak Indonesia (IDAI). 2012. World Pneumonia Day (Hari
Pneumonia Dunia). (www.idai.co.id/kegiatanidai.asp , Diakses pada
tanggal 4 April 2016)
12. Kementerian Kesehatan Republik Indonesia. 2012. Pedoman Pengendalian
Infeksi Saluran Pernafasan Akut. Direktorat Jenderal Pengendalian
Penyakit dan Penyehatan Lingkungan.
13. Kementerian Kesehatan RI. 2012. Modul Tatalaksana Standar Pneumonia.
Direktorat Jenderal Pengendalian Penyakit dan Penyehatan
Lingkungan.1537

46
Lampiran 4. Penemuan Penderita Pneumonia Balita Tahun 2016
No Kel BULAN Jum
Jan Feb Maret April Mei Juni Juli Agustus Sept Okt Nov Des

< 1- < 1- < 1- < 1- < 1- < 1- < 1- < 1- < 1- < 1- < 1- < 1-
1 5 1 5 1 5 1 5 1 5 1 5 1 5 1 5 1 5 1 5 1 5 1 5
th th th th th th th th th th th th th th th th th th th th th th th th
1. JUMLAH 4 16 3 11 5 17 0 4 8 10 0 15 0 8 3 7 5 14 0 1 5 3 3 3 145
(orang)

47