Anda di halaman 1dari 26

BAB I

LAPORAN KASUS

I. IDENTITAS PASIEN
Nama : Tn. L
Usia : 48 tahun
Alamat : Dusun Manis RT10 RW04
Agama : Islam
Pekerjaan : Swasta
Status : Menikah
Tgl MRS : 16 Januari 2017 pukul 21.00
II. ANAMNESE
Keluhan Utama : Muntah berwarna hitam
Riwayat Penyakit Sekarang :
Muntah hitam sejak 2 hari sebelum MRS
Sehari muntah 5 kali, setiap muntah gelas
Berak berwarna hitam seperti petis sejak 2 hari sebelum MRS
Sehari berak sampai 2 kali, setengah gelas
Setiap sesudah muntah pasien selalu merasa badan lemas.
Disertai, mual, dan pusing
Nyeri perut bagian atas
Nafsu makan menurun
BAK (+) normal
Riwayat Penyakit Dahulu :
Maag : diakui
Alergi : disangkal
Hipertensi : diakui
Penyakit gula : disangkal
Penyakit liver : disangkal
Operasi : disangkal

Riwayat Penyakit Keluarga :


Maag : disangkal
Alergi : disangkal
Hipertensi : diakui
Penyakit gula : disangkal
Penyakit liver : disangkal
Operasi : disangkal

Riwayat Pribadi Sosial Ekonomi


- Kebiasaan merokok : disangkal

1
- Pasien tinggal bersama dengan istri dan anak-anaknya.
- Pasien menggunakan BPJS

III. PEMERIKSAAN FISIK


1. KEADAAN UMUM
Keadaan umum : Tampak sakit sedang
Kesadaran : Compos mentis
2. TANDA VITAL
- Tekanan darah : 160/90 mmHg
- Nadi : 96 kali/menit
- Respiratory rate : 20 kali/menit
- Suhu : 36,7 oC

3. STATUS GENERALIS
a. Kepala
Kesan mesosefal
b. Mata
Sklera ikterus (+/+), Konjungtiva palpebra anemis (+/+), pupil
isokor (3mm/3mm), reflek pupil direk (+/+), reflek pupil indirek
(+/+)
c. Hidung
Napas cuping hidung (-/-), epistaksis (-/-)
d. Mulut
Bibir kering (-), sianosis (-), gusi berdarah (-)
e. Telinga
Darah (-/-), nyeri tekan mastoid (-/-), gangguan fungsi
pendengaran(-/-).
f. Leher
Simetris, trachea di tengah, pembesaran KGB (-), tiroid (Normal),
nyeri tekan (-).
g. Thorax

Pulmo
Dextra Sinistra
Pulmo Depan

Inspeksi Bentuk, Ukuran Normal Bentuk, Ukuran Normal


simetris ,Pergerakan dada simetris ,Pergerakan dada
simetris simetris

Palpasi Stem fremitus normal Stem fremitus normal


kanan sama dengan kiri. kanan sama dengan kiri.

2
Nyeri tekan (-). Nyeri tekan (-).
Pelebaran SIC (-). Pelebaran SIC (-).
Arcus costa normal. Arcus costa normal.
Perkusi Sonor seluruh lapang Sonor seluruh lapang
paru paru
Auskultasi Suara dasar paru Suara dasar paru
vesikuler (+), wheezing vesikuler (+), wheezing
(-), ronki (-) (-), ronki (-)
Pulmo Belakang

Palpasi Stem fremitus normal Stem fremitus normal


kanan sama dengan kiri. kanan sama dengan kiri.
Hemithorax simetris. Hemithorax simetris.
Nyeri tekan (-). Nyeri tekan (-).
Pelebaran SIC (-). Pelebaran SIC (-).
Perkusi Sonor seluruh lapang Sonor seluruh lapang
paru paru
Auskultasi Suara dasar paru Suara dasar paru
vesikuler (+), wheezing vesikuler (+), wheezing
(-), ronki (-) (-), ronki (-)

Jantung
Inspeksi : Ictus cordis tidak tampak
Palpasi : Ictus cordis teraba pada
ICS V midclavicula sinistra
Pulsus parasternal (-)
Sternal lift (-)
Pulsus epigastrium (-)
Thrill (-)
Perkusi:
Batas atas jantung : ICS II linea parasternal sinistra
Pinggang jantung : ICS III linea parasternal sinistra
Batas kiri bawah jantung: ICS V linea mid clavicula sinistra
Batas kanan bawah jantung: ICS IV linea sternalis dextra
Kesan batas jantung: dalam batas normal

Auskultasi : Bunyi jantung I & II murni, bising jantung (-),


gallop (-), pericardial friction rub (-).

h. Abdomen
Inspeksi : warna sama seperti kulit di
sekitar, caput medusa (-), venectasi (-)

3
Auskultasi : Bising usus (-) N, bruit hepar (-),
Perkusi : Timpani (+), pekak sisi (-), pekak alih (-),
nyeri ketok CVA (-),
Palpasi : Undulasi (-), Nyeri tekan (+ epigastrium),
Hepatomegali (-) Splenomegali (-)
Nama Hasil Nilai Normal
Pemeriksaan
Darah Lengkap

HB 10,0 L : 13.0-17 g%
P : 11.4-15.1 g%
Leukosit 7.200 4.500 11.000
Laju Endap 10-22 L : 0-15 ; P : 0-20
Darah
Hitung Jenis 0/0/0/62/27/11 1-2/0-1/3-4/40-50/20-40/4-
8
PCV 30 L : 40-50% ; P : 37-47%
Trombosit 218.000 150.000-350.000/L
MCV 70 80-94
MCH 22 26-32
MCHC 33 32-36

i. Ekstremitas

Superior Inferior
Akral dingin -/- -/-
Pitting Oedem -/- -/-
Sianosis -/- -/-
Capillary Refill < 2 detik/<2 detik <2 detik/2 detik
Palmar eritem -/- -/-

IV. PEMERIKSAAN PENUNJANG

4
Nama Pemeriksaan Hasil Nilai Normal

SGOT 18,1 0-31 L

SGPT 15,2 0-32 /L

BUN 25,0 4.8 23 mg/dl

Serum creatinin 0,98 0.5 1.2 mg/dl

GDA 106 <200 mg/dl

Golongan darah O

TPL PPL INITIAL ASS PLANNING


1. Pria 48 tahun -Hematemesis Hematemesis Planning Dx
-Hematemesis -Melena Melena et causa -Endoskopi
-Melena -S.Gastritis erosiva -USG abdomen
-Nyeri epigastrium -S.Ulcus peptikum -LFT
-Anoreksia Planing Tx
-Pasang NGT
Riwayat Kebiasaan -IV line
-Sering minum jamu (+) -Inj Pantoprazole 2x1
-Inj Ranitidin 2x1 amp

5
Lab: -Inj Ondansenton
-HB : 10,0 g% 8mg/4ml 1 amp
-PCV : 30% -Inpepsa syr 3x1 c
-Inj antrain 1g/2ml 1 amp
-Inj vit K
Planing Monitoring
-Klinis
2. Malaise, -Anemia -Anemia et causa Planning Dx
Vertigo defisiensi FE -HDL
Conjungtiva Planing Tx
anemis(+/+), -Perbaiki KU
Hb 10,0 Planing Monitoring
MCV 70 -Klinis
MCH 22 -Cek DL ulang

3. TD; 160/90 -Hipertensi -Hipertensi stage II Planning Dx


stage II -EKG
-Foto Ro thorax
Planing Tx
-Inj Furosemid 1-0-0
-Captopril 3x 12,5 mg
Planing Monitoring
-Klinis
-Cek tekanan darah

BAB II

TINJAUAN PUSTAKA

I. Definisi
Perdarahan saluran cerna bagian atas (SCBA) didefinisikan sebagai
perdarahan yang terjadi di sebelah proksimal ligamentum Treitz pada
duodenum distal. Sebagian besar perdarahan saluran cerna bagian atas
terjadi sebagai akibat penyakit ulkus peptikum (PUD, peptic ulcer disease)
yang disebabkan oleh H. Pylori atau penggunaan obat-obat anti-inflamasi

6
non-steroid (OAINS) atau alkohol). Robekan Mallory-Weiss, varises
esofagus, dan gastritis merupakan penyebab perdarahan saluran cerna
bagian atas yang jarang. (Dubey, S., 2008)

Gambaran Umum
Perdarahan saluran cerna bagian atas dapat bermanifestasi klinis
mulai dari yang seolah ringan, misalnya perdarahan tersamar sampai pada
keadaan yang mengancam hidup. Hematemesis adalah muntah darah segar
(merah segar) atau hematin (hitam seperti kopi) yang merupakan indikasi
adanya perdarahan saluran cerna bagian atas atau proksimal ligamentum
Treitz. SCBA, terutama dari duodenum dapat pula bermanifestasi dalam
bentuk melena. Hematokezia (darah segar keluar per anum) biasanya
berasal dari perdarahan saluran cerna bagian bawah (kolon). Maroon
stools (feses berwarna merah hati) dapat berasal dari perdarahan kolon
bagian proksimal (ileo-caecal). (Djojoningrat, D., 2006)

Upper gastrointestinal tract bleeding (UGI bleeding) atau lebih dikenal


perdarahan saluran cerna bagian atas memiliki prevalensi sekitar 75 %
hingga 80 % dari seluruh kasus perdarahan akut saluran cerna.
Insidensinya telah menurun, tetapi angka kematian dari perdarahan akut
saluran cerna, masih berkisar 3 % hingga 10 %, dan belum ada perubahan
selam 50 tahun terakhir.

Tidak berubahnya angka kematian ini kemungkinan besar berhubungan


dengan bertambahnya usia pasien yang menderita perdarahan saluran
cerna serta dengan meningkatnya kondisi comorbid. Peptic ulcers adalah
penyebab terbanyak pada pasien perdarahan saluran cerna, terhitung
sekitar 40 % dari seluruh kasus. Penyebab lainnya seperti erosi gastric (15
% - 25 % dari kasus), perdarahan varises (5 % - 25 % dari kasus), dan
Mallory-Weiss Tear (5 % - 15 % dari kasus). Penggunaan aspirin ataupun
NSAIDs memiliki prevalensi sekitar 45 % hingga 60 % dari keseluruhan
kasus perdarahan akut. (Alexander, J.A., 2008)

7
II. Etiologi
Banyak kemungkinan penyebab perdarahan saluran cerna bahagian
atas pada buku The Merck Manual of Patient Symptoms (Porter, R.S., et
al., 2008):
1. Duodenal ulcer (20 30 %)
2. Gastric atau duodenal erosions (20 30 %)
3. Varices (15 20 %)
4. Gastric ulcer (10 20 %)
5. Mallory Weiss tear (5 10 %)
6. Erosive esophagitis (5 10 %)
7. Angioma (5 10 %)
8. Arteriovenous malformation (< 5 %)
9. Gastrointestinal stromal tumors
Dalam buku Current Diagnosis and Treatment in Gastroenterology
ada beberapa etiologi yang dapat menimbulkan perdarahan saluran cerna
bahagian atas beserta tabel hasil penelitian dari Center for Ulcer Research
and Education (CURE) (Jutabha, R., et al. 2003)

Penyakit-Penyakit Ulcerativa atau Erosive


1.Penyakit Peptic Ulcer
Di Amerika Serikat, PUD (Peptic Ulcer Disease) dijumpai pada
sekitar 4,5 juta orang pada tahun 2011. Kira-kira 10 % dari populasi di
Amerika Serikat memiliki PUD. Dari sebahagian besar yang terinfeksi H
pylori, prevalensinya pada orang usia tua 20%. Hanya sekitar 10% dari
orang muda memiliki infeksi H pylori; proporsi orang-orang yang
terinfeksi meningkat secara konstan dengan bertambahnya usia. (Anand,
B.S., 2011). Secara keseluruhan, insidensi dari duodenal ulcers telah

8
menurun pada 3-4 dekade terkahir. Walaupun jumlah daripada simple
gastric ulcer mengalami penurunan, insidensi daripada complicated gastric
ulcer dan opname tetap stabil, sebagian dikarenakan penggunaan aspirin
pada populasi usia tua. Jumlah pasien opname karena PUD berkisar 30
pasien per 100,000 kasus. (Anand, B.S., 2011)
Prevalensi kemunculan PUD berpindah dari yang predominant
pada pria ke frekuensi yang sama pada kedua jenis kelamin. Prevalensi
berkisar 11-14 % pada pria dan 8-11 % pada wanita. Sedangkan kaitan
dengan usia, jumlah kemunculan ulcer mengalami penurunan pada pria
usia muda, khususnya untuk duodenal ulcer, dan jumlah meningkat pada
wanita usia tua. (Anand, B.S., 2011)

2.Stress Ulcer
Dari buku Current Diagnosis and Treatment in Gastroenterology
dikatakan bahwa hingga saat ini masih belum dipahami bagaimana
terjadinya stress ulcer, tetapi banyak dikaitkan dengan hipersekresi
daripada asam pada beberapa pasien, mucosal ischemia, dan alterasi pada
mucus gastric. (Jutabha, R., et al. 2003)

3.Medication-Induced Ulcer
Berbagai macam pengobatan berperan penting dalam
perkembangan daripada penyakit peptic ulcer dan perdarahan saluran
cerna bahagian atas akut. Paling sering, aspirin dan NSAIDs dapat
menyebabkan erosi gastroduodenal atau ulcers, khususnya pada pasien
lanjut usia. (Jutabha, R., et al. 2003)

4.Mallory-Weiss Tear

9
Mallory- Weiss Tear muncul pada bagian distal esophagus di
bagian gastroesophageal junction. Perdarahan muncul ketika luka sobekan
telah melibatkan esophageal venous atau arterial plexus. Pasien dengan
hipertensi portal dapat meningkatkan resiko daripada perdarahan oleh
Mallory-Weiss Tear dibandingkan dengan pasien hipertensi non-portal.
Sekitar 1000 pasien di University of California Los Angeles datang
ke ICU dengan perdarahan saluran cerna bahagian atas yang berat,
Mallory-Weiss Tear adalah diagnosis keempat yang menyebabkan
perdarahan saluran cerna bahagian atas, terhitung sekitar 5 % dari seluruh
kasus. (Jutabha, R., et al. 2003)

5.Gastroesophageal Varices
Esophageal varices dan gastric varices adalah vena collateral yang
berkembang sebagai hasil dari hipertensi sistemik ataupun hipertensi
segmental portal. Beberapa penyebab dari hipertensi portal termasuk
prehepatic thrombosis, penyakit hati, dan penyakit postsinusoidal.
Hepatitis B dan C serta penyakit alkoholic liver adalah penyakit yang
paling sering menimbulkan penyakit hipertensi portal intrahepatic di
Amerika Serikat. (Jutabha, R., et al. 2003)

6.Pengaruh Obat NSAIDs


Penggunaan NSAIDs merupakan penyebab umum terjadi tukak
gaster. Penggunaan obat ini dapat mengganggu proses peresapan mukosa,
proses penghancuran mukosa, dan dapat menyebabkan cedera. Sebanyak
30% orang dewasa yang menggunakan NSAIDs mempunyai GI yang
kurang baik. Faktor yang menyebabkan peningkatan penyakit tukak gaster
dari penggunaan NSAIDs adalah usia, jenis kelamin, pengambilan dosis
yang tinggi atau kombinasi dari NSAIDs, penggunaan NSAIDs dalam

10
jangka waktu yang lama, penggunaan disertai antikoagulan, dan severe
comorbid illness. (Anand, B.S., 2011B.S. Anand, 2011)
Sebuah studi prospektif jangka panjang didapatkan pasien dengan
arthritis dengan usia diatas 65 tahun, yang secara teratur menggunakan
aspirin pada dosis rendah beresiko menderita dyspepsia apabila berhenti
menggunakan NSAIDs. Hal ini menunjukkan bahwa penggunaan NSAIDs
harus dikurangi. (Anand, B.S., 2011)
Walaupun prevalensi penggunaan NSAIDs pada anak tidak
diketahui, tetapi sudah tampak adanya peningkatan, terutama pada anak
dengan arthritis kronik yang dirawat dengan NSAIDs. Laporan
menunjukkan terjadinya ulserasi pada penggunaan ibuprofen dosis rendah,
walau hanya 1 atau 2 dosis. (Anand, B.S., 2011)
Penggunaan kortikosteroid saja tidak meningkatkan terjadinya
tukak gaster, tetapi penggunaan bersama NSAIDs mempunyai potensi
untuk menimbulkan tukak gaster. (Anand, B.S., 2011)
Resiko perdarahan saluran cerna bahagian atas dapat terjadi dengan
penggunaan spironolactone diuretic atau serotonin reuptake inhibitor.
(Anand, B.S., 2011)
The American Society for Gastrointestinal Endoscopy (ASGE)
mengelompokkan pasien dengan perdarahan saluran cerna bahagian atas
berdasarkan usia dan kaitan antara kelompok usia dengan resiko kematian.
ASGE menemukan angka mortalitas untuk 3.3% pada pasien usia 21-31
tahun, untuk 10.1% pada pasien berusia 41-50 tahun, dan untuk 14.4%
untuk pasien berusia 71-80 tahun . (Caestecker, J.d., 2011)
Menurut organisasi tersebut, ada beberapa faktor resiko yang
menyebabkan kematian, perdarahan berulang, kebutuhan akan endoskopi
hemostasis ataupun operasi, yaitu: usia lebih dari 60 tahun, comorbidity
berat, perdarahan aktif (contoh, hematemesis, darah merah per nasogastric
tube, darah segar per rectum), hipotensi, dan coagulopathy berat
Pasien dengan hemorrhagic shock memiliki angka kematian yang
mencapai 30 %. (Caestecker, J.d., 2011)

11
III. Patofisiologi
1. Patofisiologi Gastritis secara Umum

Terjadinya gastritis secara umum karena ketidakseimbangan faktor


agresif dan defensif, di mana faktor agresif lebih dominan daripada faktor
defensif. Yang termasuk faktor agresif antara lain asam lambung, pepsin,
refluks bilier, nikotin, alkohol, NSAID, kortikosteroid, H.pylori, dan
adanya radikal bebas. Yang termasuk faktor defensif antara lain
mikrosirkulasi mukosa, sel epitel permukaan, prostaglandin, fosfolipid,
mukus, bikarbonat, dan motilitas saluran pencernaan. (Dubey, S., 2008)

Gambar 2.3. Patofisiologi gastritis 31 Keterangan : (A) mukosa gaster normal


akibat adanya keseimbangan antara faktor agresif dan pertahanan mukosa. (B)
pembentukan ulkus gaster karena ketidakseimbangan faktor agresif dan faktor
pertahanan mukosa.

2. Patofisologi Gastritis H.Pylori

12
H.pylori memiliki efek stimulasi terhadap respon non spesifik dan
spesifik. Kolonisasi H.pylori pada mukosa gaster akan merangsang sistem
imun non spesifik berupa aktivasi proinflamasi dan faktor antibakterial
dari sel epitel gaster. H.pylori juga menstimulasi sistem imun spesifik yaitu
selluler dan humoral. Meskipun demikian sangat sulit untuk
mengeliminasi H.pylori dari mukosa gaster dan biasanya infeksi H.pylori
menetap (persisten). Hal ini disebabkan H.pylori memiliki kemampuan
untuk mempengaruhi respon imun untuk menghindari eliminasi serta
menurunkan regulasi kerusakan jaringan. Respon H.pylori terhadap sistem
imun humoral yaitu menstimulasi terbentuknya antibodi yaitu IgA dan
IgG. Namun efek antibodi ini masih kontroversi yaitu melindungi
sedangkan dari laporan lainnya menyebakan persistensi kolonisasi dan
menghambat efek perlindungan. Sel T memiliki efek dominan dalam
sistem imun H.pylori. Sel Th1 memproduksi IFN- dan akan menyebabkan
munculnya proinflamasi lain seperti : TNF-, IL-12 dan IL-18.31.
(Caestecker, J.d., 2011)
H.pylori tinggal di lapisan mukus yang melapisi epitel gaster.
H.pylori mensekresikan faktor-faktor, peptida, dan lipopolisakarida yang
bersifat kemotaktik terhadap neutrofil dan monosit. In vivo, infeksi
H.pylori di mukosa gaster menginduksi produksi sitokin-sitokin IL-1, IL-
6, IL-8 dan TNF-. IL-1 atau TNF- saja, maupun TNF- bersinergis
dengan IFN- menginduksi produksi IL-8 di sel gaster. Peningkatan
produksi IL-8 bisa disebabkan infeksi H.pylori maupun sekunder dari
peningkatan kadar IL-1 atau TNF-. Produksi IL-8 oleh sel epitel gaster
berkepanjangan dapat menyebabkan rekruitmen neutrofil dan limfosit ke
jaringan yang terinfeksi.

13
Gambar 2.4. Imunopatogenesis infeksi H.pylori 24 H.pylori menginduksi sitokin-
sitokin proinflamasi seperti IL-1, IL-6, TNF-, IL-8 melalui aktivasi NF-B.

Respons inflamasi yang terjadi menyebabkan Treg mensekresikan


sitokin imunosupresif, yang mempertahankan kadar H.pylori dalam mukosa
gaster. Peran Treg dalam memodulasi respon imun pejamu selama infeksi
H.pylori telah beberapa kali dipikirkan. Treg adalah subset dari sel T yang
mensupresi respon imun pejamu dan berhubungan dengan kanker. Sel T
khusus tersebut mengekspresikan marker seperti CD4, CD25, dan FoxP3.
Treg meningkatkan toleransi terhadap antigen diri sendiri dan pada saat
bersamaan memfasilitasi pertumbuhan tumor melalui imunosupresi.
Beberapa studi menyebutkan peningkatan dari TH1, TH2, Treg,
mengindikasikan keseimbangan imunomodulasi pejamu untuk inflamasi.
Infeksi H.pylori memiliki respon TH1 yang kuat yang \ dimediasi oleh
sitokin TH1 termasuk IFN-, IL-12, TNF-, dll. Kondisi inflamasi ini
diseimbangkan dengan IL-10 dari Treg untuk menyebabkan infeksi kronik
dengan imunosupresi parsial. (Alexander, J.A., 2008)

3. Sitokin Inflamasi terhadap Gastritis non H .pylori

14
Kadar serum sitokin seperti IL-6, TNF-, IL-1, dan IFN- pada
pasien yang mengalami inflamasi lebih tinggi daripada individu normal.
Penurunan kadar IL-6 dan TNF- merupakan petunjuk terjadinya perbaikan
inflamasi. IL-6 disekresikan oleh sel T dan makrofag untuk menstimulasi
respons imun terutama selama ada kerusakan jaringan yang menyebabkan
terjadinya inflamasi. IL-6 juga berperan dalam melawan infeksi. TNF-
merupakan sitokin yang terlibat dalam inflamasi sistemik dan termasuk
kelompok sitokin yang menstimulasi reaksi akut. TNF- menginduksi
apoptosis dan inflamasi. IL-6 dan TNF- berperan dalam lesi di lambung.
(Anand, B.S., 2011)
Injuri gaster akibat kimiawi seperti NSAID bisa menyebabkan
peningkatan ekspresi mediator inflamasi seperti TNF-, IL-1, maupun
IL-8. Penelitian Lee et al (2012) pada tikus menemukan pemberian
indometasin secara signifikan meningkatkan ekspresi TNF-, IL-1, IL-8
pada sel epitel gaster. Hal ini mengkonfirmasi mediator inflamasi berperan
dalam kerusakan sel epitel gaster akibat indometasin. Menurut Tanigawa et
al (2009), pemberian PPI bisa menurunkan produksi TNF- dan IL-1.
Jadi PPI memiliki efek anti inflamasi dengan menekan secara langsung
induksi TNF- dan IL-1 melalui inhibisi NF-B dan aktivasi ERK pada
sel-sel inflamasi. Penelitian Tanigawa et al (2009) dan Lee et al (2012)
mengkonfirmasi bahwa pada erosi gaster terjadi peningkatan sitokin-
sitokin inflamasi.
Gastritis kimiawi/gastropati seperti NSAID memiliki berbagai
patogenesis/ mekanisme yang menyebabkan cedera seperti inhibisi
prostaglandin, efek toksik langsung dari NSAID, dan stimulasi sitokin
proinflamasi seperti TNF-, IL-1, IL-6, IL-8, IFN- dan infiltrasi sel-sel
inflamasi di lamina propria yang menyebabkan penurunan aliran darah
mukosa, hipoksia, dan penurunan pertahanan mukosa. (Tanigawa et al
2009)
Pada percobaan terhadap model tikus yang terkena gastritis akibat
diinduksi oleh HCl/etanol, terjadi peningkatan kadar serum dari IL-6 dan

15
TNF-. Adanya penurunan sitokin proinflamasi ini setelah mendapatkan
gastroprotektor. (Lee et al (2012)
Penelitian Eamlamnam et al pada lesi gaster akut yang diinduksi
asam asetat terjadi peningkatan leukosit, TNF-, dan penurunan IL-10.
Sehingga saat terjadi proses penyembuhan terjadi penurunan TNF- dan
leukosit serta peningkatan kadar IL-10. Pada inflamasi gaster kronik
terjadi peningkatan IL-10 yang secara simultan mengurangi inflamasi
jaringan gaster. Peningkatan IL-10 sebagai sitokin antiinflamasi guna
menekan inflamasi di gaster. (Lee et al (2012)
Naito et al dan Jainu et al melaporkan bahwa inflamasi gaster
mukosa akibat aspirin akibat peningkatan produksi TNF- dan IL-1 yang
berdampak pada akumulasi neutrofil. (Tanigawa et al 2009)
Iskemia pun menginduksi lesi gaster, kemungkinan akibat banyak
pembentukan radikal bebas, tetapi peranan sitokin proinflamasi seperti IL-
1 dan TNF- dalam proses penyembuhan lesi ini belum dipelajari
mendalam. Konturek et al melakukan percobaan pada tikus menemukan
bahwa lesi gaster dimediasi oleh pembentukan radikal bebas,
menyebabkan supresi mikrosirkulasi gaster dan aktivitas sekresi dari
gaster. Serta terjadi peningkatan superoksida dismutase dan pelepasan IL-
1 dan TNF- bisa mengaktivasi ekspresi ICAM-1 dan infiltrasi neutrofil,
yang berperan penting dalam progresivitas iskemia yang menginduksi
erosi gaster akut menjadi ulkus kronis. (Alexander, J.A., 2008)

IV. Gejala Klinis


Gejala klinis perdarahan saluran cerna:
Ada 3 gejala khas, yaitu:
1. Hematemesis

16
Muntah darah dan mengindikasikan adanya perdarahan saluran
cerna atas, yang berwarna coklat merah atau coffee ground. (Porter,
R.S., et al., 2008)
2. Hematochezia
Keluarnya darah dari rectum yang diakibatkan perdarahan saluran
cerna bahagian bawah, tetapi dapat juga dikarenakan perdarahan saluran
cerna bahagian atas yang sudah berat. (Porter, R.S., et al., 2008)
3. Melena
Kotoran (feses) yang berwarna gelap yang dikarenakan kotoran
bercampur asam lambung; biasanya mengindikasikan perdarahan saluran
cerna bahagian atas, atau perdarahan daripada usus-usus ataupun colon
bahagian kanan dapat juga menjadi sumber lainnya. (Porter, R.S., et al.,
2008)
Disertai gejala anemia, yaitu: pusing, syncope, angina atau
dyspnea. (Laine, L., 2008)
Studi meta-analysis mendokumentasikan insidensi dari gejala
klinis UGIB akut sebagai berikut: Hematemesis - 40-50%, Melena - 70-
80%, Hematochezia - 15-20%, Hematochezia disertai melena - 90-98%,
Syncope - 14.4%, Presyncope - 43.2%, Dyspepsia - 18%, Nyeri epigastric
- 41%, Heartburn - 21%, Diffuse nyeri abdominal - 10%, Dysphagia - 5%,
Berat badan turun - 12%, dan Jaundice - 5.2% (Caestecker, J.d., 2011)

V. Diagnosis
Diagnosis dapat dibuat berdasarkan inspeksi muntahan pasien atau
pemasangan selang nasogastric (NGT, nasogastric tube) dan deteksi darah
yang jelas terlihat; cairan bercampur darah, atau ampas kopi Namun,
aspirat perdarahan telah berhenti, intermiten, atau tidak dapat dideteksi
akibat spasme pilorik. (Dubey S., 2008)
Pada semua pasien dengan perdarahan saluran gastrointestinal
(GIT) perlu dimasukkan pipa nasogastrik dengan melakukan aspirasi isi

17
lambung. Hal ini terutama penting apabila perdarahan tidak jelas. Tujuan
dari tindakan ini adalah:
1. Menentukan tempat perdarahan.
2. Memperkirakan jumlah perdarahan dan apakah perdarahan telah
berhenti. (Soeprapto, P., et al., 2010)
Angiography dapat digunakan untuk mendiagnosa dan
menatalaksana perdarahan berat, khususnya ketika penyebab perdarahan
tidak dapat ditentukan dengan menggunakan endoskopi atas maupun
bawah. (Savides, T.J., et al., 2010)
Conventional radiographic imaging biasanya tidak terlalu
dibutuhkan pada pasien dengan perdarahan saluran cerna tetapi adakalanya
dapat memberikan beberapa informasi penting. Misalnya pada CT scan;
CT Scan dapat mengidentifikasi adanya lesi massa, seperti tumor intra-
abdominal ataupun abnormalitas pada usus yang mungkin dapat menjadi
sumber perdarahan. (Savides, T.J., et al., 2010)
Mempertahankan saluran nafas paten dan restorasi volume
intravascular adalah tujuan tata laksana awal. Infus kristaloid awal, sampai
30 mL/ kg, dapat diikuti transfusi darah O-negatif atau yang crossmatched
jika diperlukan. Pasien dengan perdarahan aktif memerlukan konsultasi
emergensi untuk esofagogastroduodenoskopi (EGD). Pasien tanpa
perdarahan aktif dapat dipantau, diobservasi, dan mungkin dijadwalkan
untuk EGD. Intervensi selama EGD meliputi injeksi epinefrin submukosa,
skleroterapi, dan ligase pita. Jika tindakan ini gagal menghentikan
perdarahan, angiografi dengan embolisasi atau pembedahan mungkin
diperlukan. Untuk pasien yang diduga mengalami perdarahan varises, tata
laksana medis dapat diberikan sambil menunggu tindakan definitif.
Oktreotid dapat digunakan untuk menurunkan tekanan vena porta, dan
pipa Sengstaken-Blakmore dapat dipasang sebagai tindakan sementara
untuk bertahan. (Dubey S., 2008)

Endoskopi

18
Definisi Endoskopi
Endoskopi adalah suatu alat untuk melihat ke bagian dalam tubuh
dengan menggunakan suatu selang fiberoptik yang disesuaikan dengan
sistem kerja lapangan pandang manusia sehingga memungkinkan kita
untuk melakukan pemeriksaan pada organ-organ bagian dalam tubuh
manusia. (Wong, L.M., et al., 2008)
Prinsip Dasar Endoskopi
Prinsip Kerja Endoskopi Fleksibel meliputi:
1. Control Head.
2. Flexible Shaft yang dilengkapi dengan manoeverable tip.
3. Head sendiri yang dihubungkan dengan sumber cahaya via
umbilical cord dan melalui saluran yang lain akan mengalirkan udara/ air,
suction dan sebagainya saluran suction juga bisa dipakai untuk
memasukkan alat diagnostik seperti forsep biopsy dan alat- alat
perlengkapan terapetik yang lain. (Putra, D.S., 2009)
a. Indikasi
Indikasi endoskopi, yaitu: (SCBA), dyspepsia, disfagia, odinofagia,
nyeri epigastrium kronis, kecurigaan obsruksi outlet, survey endoskopi,
curiga keganasan, dan nyeri dada tidak khas (Putra, D.S., 2009).
b. Kontra Indikasi Absolut
Kontra indikasi endoskopi, yaitu: tidak kooperatif, psikopat, alergi
obat premedikasi, syok, infark miokard akut, respiratori distress, dan
perdarahan masif (Putra, D.S., 2009)
c. Kontra Indikasi Relatif
Kontra indikasi relatif, yaitu: kelainan kolumna vertebralis, gagal
jantung, sesak nafas, gangguan kesadaran, infeksi akut, aneurisma aorta
torakalis, tumor mediastinum, stenosis esofagus, gastritis korosif akut, dan
gastritis flegmonosis (Putra, D.S., 2009).

GambaranEndoskopi
a.PepticUlcer

19
Gambar 2.1. Gambaran endoskopi pada pasien gastric ulcer akibat
penggunaanNSAIDsdantestH.Pylorinegatif(Vakil,N.,2010)

Gambar2.2.Gambaranendoskopipadapasienduodenalulcerdengan
testH.PyloripositiftetapitidakadariwayatpenggunaanNSAIDs (Vakil,N.,
2010).

MalloryWeissTear

20
Gambar 2.3. Gambaran endoskopi pada pasien MalloryWeiss Tear
(Savides,T.J.,etal.,2010).

Gastroesophagealvarices

Gambar2.4. Gambaran endoskopi dari esophageal varices. (Shah,


V.H.,etal.,2010)

21
Gambar2.5.Gambaranendoskopidarigastricvaricesdanesophageal
varicealligationrelatedulcers(Shah,V.H.,etal.,2010).

22
BAB III

PEMBAHASAN

Perdarahan saluran cerna bagian atas dapat bermanifestasi klinis mulai dari
yang seolah ringan, misalnya perdarahan tersamar sampai pada keadaan yang
mengancam hidup. Hematemesis adalah muntah darah segar (merah segar) atau
hematin (hitam seperti kopi) yang merupakan indikasi adanya perdarahan saluran
cerna bagian atas atau proksimal ligamentum Treitz. Perdarahan saluran cerna
bagian atas (SCBA), terutama dari duodenum dapat pula bermanifestasi dalam
bentuk melena.

Pada pasien didapatkan BAB hitam sejak 1 minggu yang lalu. Mual (+),
muntah (+). BAK tak ada keluhan. Pada bagian abdomen didapatkan nyeri tekan
(+). Penanganan pasien dengan perdarahan saluran cerna dengan pemberian PPI
untuk mengurangi perdarahan atau bisa diberikan antikoagulan jika perdarahan
masif dan antibiotic untuk mencegah infeksi sekunder.

Keberhasilan pengobatan dapat dievaluasi dalam waktu beberapa hari


dengan melihat gejala klinis seperti hematemesis dan melenanya masih terjadi
atau tidak pada pasien tersebut, dan melihat apakah ada demam atau tidak untuk
menyingkirkan adanya infeksi sekunder yang terjadi.

23
BAB IV

KESIMPULAN

1. Hematemesis adalah muntah darah dan mengindikasikan adanya


perdarahan saluran cerna atas, yang berwarna coklat merah atau coffee
ground.
2. Melena adalah kotoran (feses) yang berwarna gelap yang dikarenakan
kotoran bercampur asam lambung; biasanya mengindikasikan perdarahan
saluran cerna bahagian atas, atau perdarahan daripada usus-usus ataupun
colon bahagian kanan dapat juga menjadi sumber lainnya.
3. Gold standart untuk penegakkan diagnosis menggunakan endoskopi dan
indikasi endoskopi, yaitu: perdarahan saluran cerna bagian atas (SCBA),
dyspepsia, disfagia, odinofagia, nyeri epigastrium kronis, kecurigaan
obsruksi outlet, survey endoskopi, curiga keganasan, dan nyeri dada tidak
khas
4. Komplikasi utama dari Hematemesis melena ini adalah anemia dan dapat
menyebabkan syok hipovolemik.
5. Pasien ini mengalami hematemesis melena yang menunjukkan adanya
perdarahan pada saluran cerna bagian atas. Penanganan pasien dengan
perdarahan saluran cerna dengan pemberian PPI untuk mengurangi
perdarahan atau bisa diberikan antikoagulan jika perdarahan masif dan
antibiotic untuk mencegah infeksi sekunder.
6. Prognosis pasien dengan keadaan umum baik adalah dubia ad bonam.

24
DAFTAR PUSTAKA

1. Siti Nurdjanah. Sirosis Hepatis. In: Sudoyo AW, Setiyohadi B, Alvi I,


Simadibrata MK, Setiati S (eds). Buku Ajar Ilmu Penyakit Dalam, 5th ed.
Jakarta; Departemen Ilmu Penyakit Dalam Fakultas Kedokteran Indonesia.
2009. Page 668-673.

2. Raymon T.Chung, Daniel K.Podolsky. Cirrhosis and its complications. In :


Kasper DL et.al, eds. Harrison's Principles of Internal Medicine. 16 th
Edition. USA : Mc-Graw Hill; 2005. p. 1858-62.
3. Riley TR, Taheri M, Schreibman IR. Does weight history affect fibrosis in
the setting of chronic liver disease?. J Gastrointestin Liver Dis. 2009.
18(3):299-302.

4. Sutadi SM. Sirosis hati. Usu repository. 2003. [cited on 2011 February
23rd]. Available from : URL : http:// repository.usu.ac.id/ bitstream/
123456789 /3386/1/ penydalam-srimaryani5.pdf
5. Hirlan. Ascites. In: Sudoyo AW, Setiyohadi B, Alvi I, Simadibrata MK,
Setiati S (eds). Buku Ajar Ilmu Penyakit Dalam, 5th ed. Jakarta;
Departemen Ilmu Penyakit Dalam Fakultas Kedokteran Indonesia. 2009.
Page 668-673.

6. Rima A.M. Complication of chronic liver disease. PSAP VII.


Gastroenterology and nutrition.

7. Rita sood. Clinical medicine Ascites Diagnosis and management. New


Delhi : Departement of Medicine All India institute of medical Sciences.
110 029

8. Runyon, Bruce, MD. Serum Ascites Albumin Gradient. Diagnosis and


evaluation of patient with ascites. Update v11.2. 2003. internal medicine

9. Don C. Rockey, Scott L. Friedman. 2006. Hepatic Fibrosis And Cirrhosis.


[cited on 2014 June 29rd]. Available from:

25
https://www.us.elsevierhealth.com/media/us/samplechapters/97814160325
88/9781416032588.pdf

10. Setiawan, Poernomo Budi. Sirosis hati. In: Askandar Tjokroprawiro,


Poernomo Boedi Setiawan, et al. Buku Ajar Penyakit Dalam, Fakultas
Kedokteran Universitas Airlangga. 2007. page 129-13

11. Kumar V, Cotran RS, Robbins SL. Hati dan saluran empedu Dalam :
Hartanto H, Darmaniah N, Wulandari N. Robbins Buku Ajar Patologi. 7 th
Edition. Volume 2. Jakarta : Penerbit Buku Kedokteran EGC; 2004.

26