Anda di halaman 1dari 39

AlAhdaAdawiyah

04011381419153
GAMMA

SindromaAspirasiMekonium

1.DefinisidanInsidensiSindromaAspirasiMekonium
Sindroma aspirasi mekonium (SAM) merupakan sekumpulan gejala yangdiakibatkan
olehterhisapnyacairanamnionmekonialkedalamsaluranpernafasanbayi.Sindromaaspirasi
mekonium (SAM) adalah salah satu penyebab yang paling sering menyebabkan kegagalan
pernapasanpadabayibarulahiratermmaupunpostterm.Kandunganmekoniumantaralain
adalahsekresigastrointestinal,hepar,danpancreasjanin,debrisseluler,cairanamnion,serta
lanugo.Cairanamnionmekonialterdapatsekitar1015%darisemuajumlahkelahirancukup
bulan (aterm), tetapi SAM terjadi pada 410% dari bayibayi ini, dan sepertiga diantara
membutuhkanbantuanventilator.Adanyamekoniumpadacairanamnionjarangdijumpaipada
kelahiran preterm. Resiko SAM dan kegagalan pernapasan yang terkait, meningkat ketika
mekoniumnya kental dan apabila diikuti dengan asfiksia perinatal. Beberapa bayi yang
dilahirkandengancairanamnionyang mekonial memperlihatkandistrespernapasanwalaupun
tidakadamekoniumyangterlihatdibawahkordavokalissetelahkelahiran.Padabeberapabayi,
aspirasimungkinterjadiintrauterine,sebelumdilahirkan.1,3

2.EtiologiSindromaAspirasiMekonium
Etiologiterjadinyasindromaaspirasimekoniumadalahcairanamnionyangmengandung
mekonium terinhalasi oleh bayi. Mekonium dapat keluar (intrauterin) bila terjadi stres /
kegawatanintrauterin.Mekoniumyangterhirupbisamenyebabkanpenyumbatanparsialataupun
totalpadasaluranpernafasan,sehinggaterjadigangguanpernafasandangangguanpertukaran
udaradiparuparu.Selainitu,mekoniumjugaberakibatpadairitasidanperadanganpadasaluran
udara,menyebabkansuatupneumoniakimiawi.3
efek
inflamasi mediator
(sitokin,
dan edema disfungsi
eikosanoid)
alveolar surfaktan
dan
parenkimal
perubahan
daya elastis kebocoran
paru
protein ke
(peningkatan
dalam jalan
resisten,
nafas
penurunan
kompli ens)
SA
M toksisitas
sumbatan langsung
jalan nafas oleh unsur
mekonium

efek hipoksemia vasokonstriksi


dalam intra uterin pulmoner
(perubahan oleh karena
bentuk vaskuler perubahan komponen
pulmonal, reaktivitas mekonium
perubahan pembuluh
parenkimal paru) darah paru

Bagan2.1EtiologiSindromaAspirasiMekonium(Clark,2010)

3.FaktorResiko
FaktorresikoyangterkaitkejadianSAMantaralainadalahkehamilanpostterm,pre
eklampsia,eklampsia,hipertensipadaibu,diabetesmellituspadaibu,bayikecilmasakehamilan
(KMK),ibuyangperokokberat,penderitapenyakitparukronik,ataupenyakitkardiovaskular.3

4.PatofisiologiSindromaAspirasiMekonium
Keluarnyamekoniumintrauterineterjadiakibatdaristimulasisarafsaluranpencernaan
yangsudahmaturdanbiasanyaakibatdaristreshipoksiapadafetus.Fetusyangmencapaimasa
matur, saluran gastrointestinalnya juga matur, sehingga stimulasi vagal dari kepala atau
penekanan pusat menyebabkan peristalsis dan relaksasi sfingter ani, sehingga menyebabkan
keluarnya mekonium. Mekonium secara langsung mengubah cairan amniotik, menurunkan
aktivitasantibakterialdansetelahitumeningkatkanresikoinfeksibakteriperinatal.Selainitu,
mekonium dapat mengiritasi kulit fetus, kemudian meningkatkan insiden eritema toksikum.
Bagaimanapun, komplikasi yang paling berat dari keluarnya mekonium dalam uterus adalah
aspirasicairanamnionyangtercemarmekoniumsebelum,selama,maupunsetelahkelahiran.
Aspirasicairanamnionmekonialiniakanmenyebabkanhipoksiamelalui4efekutamapada
paru,yaitu:obstruksijalannafas(totalmaupunparsial),disfungsisurfaktan,pneumonitiskimia
danhipertensipulmonal.3

Obstruksijalannafas

Obstruksi total jalan nafas oleh mekonium menyebabkan atelektasis. Obstruksi parsial
menyebabkanudaraterperangkap danhiperdistensialveoli,biasanyatermasukefekfenomena
ballvalve.Hiperdistensialveolimenyebabkanekspansijalannafasselamainhalasidankolaps
jalan nafas di sekitar mekonium yang terinspirasi di jalan nafas, menyebabkan peningkatan
resistensi selama ekshalasi. Udara yang terperangkap (hiperinflasi paru) dapat menyebabkan
ruptur pleura (pneumotoraks), mediastinum (pneumomediastinum), dan perikardium
(pneumoperikardium).3
Disfungsisurfaktan

Mekoniummenonaktifkansurfaktandanjugamenghambatsintesissurfaktan.Beberapaunsur
mekonium,terutamaasamlemakbebas(sepertiasampalmitat,asamoleat),memilikitekanan
permukaanminimalyanglebihtinggidaripadasurfaktandanmelepaskannyadaripermukaan
alveolar,menyebabkanatelektasisyangluas.3

Pneumonitiskimia

Mekoniummengandungenzim,garamempedu,danlemakyangdapatmengiritasijalannafas
dan parenkim, mengakibatkan pelepasan sitokin (termasuk tumor necrosis factor (TNF),
interleukin(IL)1,IL6,IL8,IL13)danmenyebabkanpneumonitisluasyangdimulaidalam
beberapajamsetelahaspirasi.Semuaefekpulmonalinidapatmenimbulkan grossventilation
perfusion(V/Q)mismatch.3

Hipertensipulmonalpersistenpadabayibarulahir

Beberapabayidengansindroma aspirasimekoniummengalamihipertensipulmonalpersisten
padabayibarulahir(persistentpulmonaryhypertensionofthenewborn
[PPHN]) primeratau
sekundersebagaiakibatdaristresintrauterinyangkronikdanpenebalanpembuluhpulmonal.
PPHNlebihlanjutberperandalamterjadinyahipoksemiaakibatsindromaspirasimekonium.3
Bagan2.2PatofisiologiSindromaAspirasiMekonium(Clark,2010)

5.GambaranKlinis
Didalamuterus,atau lebihsering, padapernapasan pertama,mekonium yangkental
teraspirasikedalamparu,mengakibatkanobstruksijalannapaskecilyangdapatmenimbulkan
kegawatanpernapasandalambeberapajampertamasetelahkelahirandengangejalatakipnea,
retraksi,stridor,dansianosispadabayidengankasusberat.Obstruksiparsialpadabeberapajalan
napasdapatmenimbulkanpneumothoraksataupneumomediastinum,ataukeduanya.Pengobatan
tepatdapatmencegahkegawatanpernapasan,yangdapathanyaditandaiolehtakikardiatanpa
retraksi.Padakondisigawatnafas,dapatterjadidistensidadayangberatyangmembaikdalam
72 jam. Akan tetapi bila dalam perjalanan penyakitnya bayi memerlukan bantuan ventilasi,
keadaaninidapatmenjadiberatdankemungkinanmortalitasnyatinggi.
Takipnea dapat menetap selama beberapa hari atau bahkan beberapa minggu. Foto
radiografidadabersifatkhasditandaidenganbercakbercakinfiltrat,corakankedualapangan
paru kasar, diameter anteroposterior bertambah, dan diafragma mendatar. Foto xray dada
normalpada bayidengan hipoksiaberatdantidakadanyamalformasi jantung mengesankan
diagnosissirkulasijantungpersisten.PO2arteridapatrendahpadapenyakitlain,danjikaterjadi
hipoksia,biasanyaadaasidosismetabolik.1

6.PemeriksaanPenunjang
6.1PemeriksaanLaboratorium

EvaluasiLaboratoriumuntukDistresPernafasanpadaBayiBaruLahir
Tes Indikasi
Kulturdarah Dapat menunjukan adanya bakteremia, tetapi hasil baru dapat
diperolehsetelah48jam
Gasdarah Digunakan untuk menilai derajat hipoksemia (jika sampel
diambildaridaraharteri)ataukondisiasambasa(jikasampel
diambildarikapiler)
Glukosadarah Hipoglikemiadapatmenyebabkanataumemicutakipnea
Radiografidada Digunakanuntukmembedakanberbagaijenisdistrespernapasan
Hitung darah Leukositosis atau bandemia yang menunjukkan stress atau
lengkap dan infeksi
hitungjenis Neutropeniayangberhubungandenganinfeksibakteri
Kadarhemoglobinyangrendahmenunjukkananemia
Kadarhemoglobintinggiterjadipadapolisitemia
Kadarplateletyangrendahterjadipadasepsis
Pungsilumbal Jikaterdugameningitis
Pulseoximetry Digunakan untuk mendeteksi hipoksia dan dibutuhkan untuk
oksigentambahan
Tabel2.1EvaluasiLaboratoriumuntukDistresPernafasan(Clark,2010)

Kondisiasambasa:2
VQ mismatch dan stres perinatal sering terjadi dan sangat dibutuhkan pemeriksaan
kondisiasambasa
Asidosismetabolikakibatstresperinataldapatdiperburukolehasidosisrespiratorikoleh
kelainanparenkimdanPPHN.
PenilaiangasdaraharteriuntukmenentukanpH,tekananparsialkarbondioksida(pCO 2),
tekanan parsial oksigen (pO2), dan dan pengukuran tingkat oksigenasi secara terus
menerusmenggunakanpulseoxymetripentingdilakukanuntukpenangananyangtepat
Elektrolitserum:2
Pemeriksaankadarnatrium,kalium,dankalsiumdilakukansetelahbayiyangmengalami
SAMberusia24jamkarenasindromgangguansekresihormonantidiuretikdangagal
ginjalakutmerupakankomplikasiyangseringterjadipadastresperinatal
Hitungdarahlengkap:2
Kehilangandarahintrauterinmaupunperinatal,jugainfeksi,turutmenyebabkanstres
perinatal
Levelhemoglobindanhematokritharuscukupuntukmemastikankapasitaspengantaran
oksigenyangadekuat
Trombositopenimeningkatkanresikoperdarahanpadaneonatus
Neutropeni atau neutrofili dengan adanya left shift dapat mengindikasikan infeksi
bacterialperinatal
Polisitemia dapat terjadi akibat hipoksia fetal yang kronis dan/atau akut. Polisitemia
berkaitan dengan penurunan aliran darah pulmonal dan dapat memicu hipoksia yang
terkaitSAMdanPPHN

6.2PemeriksaanRadiologis4
Radiografidadadiperlukanuntukhalhalberikut:
Memastikancakupankelainanintratorakal
Mengidentifikasiareaatelektasisdansindromablokadeudara
Memastikanposisiyangtepatuntukintubasiendotrakealdankateterumbilikalis
Nantinya, pada kasus SAM, setelah kondisi bayi cukup stabil, pemeriksaan radiologis otak
seperti MRI, CT scan, atau USG cranial, diindikasikan jika pemeriksaan neurologis bayi
menunjukkanadanyakelainan.Ekokardiografiperludilakukanpadakasuskasusberatseperti
distress pernafasan yang berkepanjangan untuk mengevaluasi fungsi jantung pada persistent
pulmonaryhypertensionofthenewborn(PPHN)danmasalahkongenitalkardiovaskular.
Radiografi dada menunjukkan hiperinflasi dengan perselubungan yang merata. Hasil
temuanmenunjukkanareaatelectasisdenganareaudaraterperangkap.Kebocoranudarasering
terjadi menyebabkan terjadinya pneumothoraks, pneumomediastinum, pneumopericardium,
dan/ataupulmonaryinterstitialemphysema.Efusipleurajugabisaterjadi4.
DAFTARPUSTAKA

1. Arvin,B.K.diterjemahkanolehSamikwahab. Nelson:IlmuKesehatanAnak. Vol.1


Edisi15.ECG:Jakarta.2000.h.600601.
2. Mathur, NC. Meconium Aspiration Syndrome. 2007.
http://pediatricsforyou.in/home/pdf/MECONIUM%20ASPIRATION
%20SYNDROME.pdf.Diaksestanggal6Agustus2015
3. Clark, M.B. Meconium Aspiration Syndrome. 2010. www.medscape.com/ Error!

Hyperlinkreferencenotvalid.Diaksestanggal6Agustus2015
4. Leu M. Meconium Aspiration Imaging, 2011 http://emedicine.medscape.com/
article/410756overview#a22.Diaksestanggal6Agustus2015
5. Hermansen,C.L.,danKevinN.Lorah.RespiratoryDistressintheNewborn.AmFam
Physician.2007Oct1;76(7):987994.http://www.aafp.org/afp/2007/1001/p987.html.
2007.Diaksestanggal6Agustus2015
6. YehTF,HarrisV,SrinivasanG,LilienL,PyatiS.Roentgenographicfindingsininfants
withmeconiumaspirationsyndrome.JAMA.2000.H.603
7. Yeh,TF. CoreConcepts:MeconiumAspirationSyndrome:PathogenesisandCurrent

Management. American Association of Pediatrics. Error! Hyperlink reference not


valid..2010.Diaksestanggal6Agustus2015
8. Gomella. Neonatology:ManagementProceduresCallProblemsSixthEdition.Lange
ClinicalScience:NewYork.2009.
9. Rudolph,CD,etal.Rudolph'sPediatrics,21thEdition.McGrawHillProfessional:New
York.2002.
BRONKOPNEUMONIA

1.1. DEFINISI

Pneumoniaadalahinflamasiyangmengenaiparenkimparu;peradanganpadaparudimana
prosesperadangannyainimenyebarmembentukbercakbercakinfiltratyangberlokasidi
alveoliparudandapatpulamelibatkanbronkiolusterminal.1Walaupunbanyakpihakyang
sependapatbahwapneumoniaadalahsuatukeadaaninflamasi,namunsangatsulituntuk
merumuskan satu definisi tunggal yang universal. Pneumonia adalah sindrom klinis,
sehinggadidefinisikanberdasarkangejaladantandaklinis,danperjalananpenyakitnya.
Salahsatudefinisiklinisklasikmenyatakanpneumoniaadalahpenyakitrespiratorikyang
ditandaidenganbatuk,sesaknapas,demam,ronkibasah,dengangambaraninfiltratpada
fotorontgentoraks.2 Dikenalistilahlainyangmiripyaitupneumonitisyangmaksudnya
lebihkurangsama.Banyakyangmenganutpengertianbahwapneumoniaadalahinflamasi
paru karena proses infeksi sedangkan pneumonitis adalah inflamasi paru noninfeksi.
Namunhalinipuntidaksepenuhnyaditaatiolehparaahli.2

1.2. EPIDEMIOLOGI

Insidenspenyakitsalurannapasmenjadipenyebabangkakematiandankecacatanyang
tinggidiseluruhdunia.Sekitar80%dariseluruhkasusbarupraktekumumberhubungan
dengan infeksi saluran napas yang terjadi di masyarakat (PK) atau di dalam rumah
sakit/pusatperawatan(pneumonianosokomial/PN).4

Infeksi saluran napas bawah masih tetap merupakan masalah utama dalam bidang
kesehatan,baikdinegarayangsedangberkembangmaupunyangsudahmaju.Laporan
WHO1999menyebutkanbahwapenyebabkematiantertinggiakibatpenyakitinfeksidi
dunia adalah infeksi saluran napas akut termasuk pneumonia dan influenza. Insidensi
pneumoniakomunitidiAmerikaadalah12kasusper1000orangpertahundanmerupakan
penyebabkematianakibatinfeksipadaorangdewasadinegaraitu.Angkakematianutama
akibat infeksi pada orang dewasa di negara itu. Angka kematian akibat pneumonia di
Amerikaadalah10%.DiAmerikadengancarainvasifpunpenyebabpneumoniahanya
ditemukan50%.Penyebabpneumoniasulitditemukandanmemerlukanwaktubeberapa
hariuntukmendapatkanhasilnya,sedangkanpneumoniadapatmenyebabkankematianbila
tidaksegeradiobati,makapadapengobatanawalpneumoniadiberikanantibiotiksecara
empiris.1

1.3. KLASIFIKASI

Pembagian pneumonia sendiri pada dasarnya tidak ada yang memuaskan, dan pada
umumnyapembagianberdasarkananatomidanetiologi.Beberapaahlitelahmembuktikan
bahwapembagianpneumoniaberdasarkanetiologiterbuktisecaraklinisdanmemberikan
terapiyanglebihrelevan.5

a. Berdasarkanlokasilesidiparu

Pneumonialobaris

Pneumonialobularis

Pneumoniaintersitialis

b. Berdasarkanasalinfeksi

Pneumoniayangdidapatdarimasyarakat(communityacquiredpneumonia)

PneumoniayangdidapatdariRumahSakit(hospitalbasedpneumonia)

c. Berdasarkanmikroorganismepenyebab

Pneumoniabakteri

Pneumoniavirus

Pneumoniamikoplasma
Pneumoniajamur

d. Berdasarkankarakteristikpenyakitpneumonia

Pneumoniatipikal

Pneumoniaatipikal

e. Berdasarkanlamapenyakit

Pneumoniaakut

Pneumoniapersisten

KlasifikasiberdasarkanLingkungandanPejamu

TipeKlinis Epidemiologi

PneumoniaKomunitas Sporadisatauendemis;orangtuaatauorangmuda

PneumoniaNosokomial DidahuluiperawatandiRS

PneumoniaRekurens Terdapatdasarpenyakitparukronik

PneumoniaAspirasi Alkoholik,usiatua

Pneumoniapadagangguanimun Pasientransplantasi,onkologi,AIDS

1.4. ETIOLOGI

Etiologipneumoniasulitdipastikankarenakultursekretbronkusmerupakantindakanyang
sangat invasif sehingga tidak dilakukan. Patogen penyebab pneumonia pada anak
bervariasitergantung:5

a. Usia

b. Statusimunologis
c. Statuslingkungan

d. Kondisilingkungan(epidemiologisetempat,polusiudara)

e. Statusimunisasi

f. Faktorpejamu(penyakitpenyerta,malnutrisi)

Usiapasienmrupakanperananpentingpadaperbedaandankekhasanpneumoniaanak,
terutamadalamsprectrumetiologi,gambaranklinisdanstrategipengobatan.

Berikutdaftaretiologipneumoniapadaanaksesuaidenganusiayangbersumberdaridata
dinegaramaju:5,6

Usia Etiologitersering Etiologiterjarang

Lahir20hari Bakteri:E.colli, Bakteri:Bkaterianaerob,


StreptococcusgrupB,Listeria StreptococcusgrupD,
monocytogenes Haemophilusinfluenza,
Streptococcuspneumoniae

Virus:CMV,HMV

3minggu3bulan Bakteri:Clamydia Bakteri:Bordetellapertusis,


trachomatis,Streptococcus HaemophilusinfluenzatipeB,
pneumoniae Moraxellacatharalis,
Staphylococcusaureus
Virus:Adenovirus,Influenza,
Parainfluenza1,2,3 Virus:CMV

4bulan5tahun Bakteri:Clamydia Bakteri:Haemophilus


pneumoniae,Mycoplasma influenzatipeB,Moraxella
pneumoniae,Streptococcus catharalis,Staphylococcus
pneumoniae aureus,Neisseriameningitidis

Virus:Adenovirus,Rinovirus, Virus:Varicelazoster
Influenza,Parainfluenza
5tahunremaja Bakteri:Clamydia Bakteri:Haemophilus
pneumoniae,Mycoplasma influenza,Legionellasp.
pneumoniae

1.5. PATOGENESIS

Istilahpneumoniamencakupsetiapkeadaanradangparudimanabeberapaatauseluruh
alveoli terisi dengan cairan dan selsel darah. Jenis pneumonia yang umum adalah
pneumonia bakterialis yang paling sering disebabkan oleh pneumokokus. Penyakit ini
dimulai dengan infeksi dalam alveoli, membran paru mengalami peradangan dan
berlubanglubangsehinggacairandanbahkanseldarahmerahdanseldarahputihkeluar
dari darah masuk kedalam alveoli. Dengan demikian, alveoli yang terinfeksi secara
progresifmenjaditerisidengancairandanselsel,daninfeksidisebarkanolehperpindahan
bakteridarialveoluskealveolus.3

Dalamkeadaannormal,saluranrespiratorikmulaidariareasublaringsampaiparenkim
paruadalahsteril.Salurannapasbawahinidijagatetapsterilolehmekanismepertahanan
bersihan mukosiliar, sekresi imunoglobulin A, dan batuk. Mekanisme pertahanan
imunologik yang membatasi invasi mikroorganisme patogen adalah makrofag yang
terdapatdialveolusdanbronkiolus,IgAsekretori,danimunoglobunlinlain.5

Umumnya mikroorganisme penyebab terhisap ke paru bagian perifer melalui saluran


respiratori.Mulamulaterjadiedemaakibatreaksijaringanyangmempermudahproliferasi
dan penyebaran kuman ke jaringan sekitarnya. Bagian paru yang terkena mengalami
konsolidasi, yaitu terjadi serbukan sel PMN, fibrin, eritrosit, cairan edema, dan
ditemukannya kuman di alveoli. Stadium ini disebut stadium hepatisasi merah.
Selanjutnya, deposisi fibrin semakin bertambah, terdapat fibrin dan leukosit PMN di
alveolidanterjadiprosesfagositosisyangcepat.Stadiuminidisebutstadiumhepatisasi
kelabu.Berikutnya,jumlahmakrofagmeningkatdialveoli,dimanaselakanmengalami
degenerasi,fibrinmenipis,kumandandebris menghilang.Stadiuminidisebutstadium
resolusi.Sistembronkopulmonerjaringanparuyangtidakterkenaakantetapnormal.5

Pneumoniaviralbiasanyaberasaldaripenyebaraninfeksidisepanjangjalannapasatas
yangdiikutiolehkerusakanepitelrespiratorius,menyebabkanobstruksijalannapasakibat
bengkak,sekresiabnormal,dandebrisseluler.Diameterjalannapasyangkecilpadabayi
menyebabkan bayi rentan terhadap infeksi berat. Atelektasis, edema intersitial, dan
ventilationperfusitionmismatchmenyebabkanhipoksemiayangseringdisertaiobstruksi
jalan napas. Infeksi viral pada traktus respiratorius juga dapat meningkatkan risiko
terhadap infeksi bekteri sekunder dengan mengganggu mekanisme pertahanan normal
pejamu,mengubahsekresinormal,danmemodifikasiflorabakterial.5

Ketikainfeksibakteriterjadipadaparenkimparu,prosespatologikbervariasitergantung
organisme yang menginvasi. M. penumoniae menempel pada epitel respiratorius,
menghambat kerja silier, dan menyebabkan destruksi seluler dan memicu respons
inflamasi di submukosa. Ketika infeksi berlanjut, debris seluler yang terlepas, selsel
inflamasi, dan mukus menyebabkan onstruksi jalan napas, dengan penyebaran infeksi
terjadidisepanjangcabangcabangbronkial,sepertipadapneumoniaviral.S.pneumoniae
menyebabkanedemalokalyangmembantuproliferasimikroorganismedanpenyebarannya
ke bagian paru lain, biasanya menghasilkan karakteristik sebagai bercakbercak
konsolidasimeratadiseluruhlapanganparu.7,8

InfeksistreptokokusgrupApadasalurannapasbawahmenyebabkaninfeksiyanglebih
difusdenganpneumoniaintersitial.Pneumonialobartidaklazim.Lesiterdiriatasnekrosis
mukosatrakeobronkialdenganpembentukanulkusyangcompangcampingdansejumlah
besar eksudat, edema, dan perdarahan terlokalisasi. Proses ini dapat meluas ke sekat
interalveolardanmelibatkanfasalimfatika.Pneumoniayangdisebabkan S.aureus adalah
beratdaninfeksidengancepatmenjadijelekyangdisertaidenganmorbiditasyanglama
dan mortalitas yang tinggi, kecuali bila diobati lebih awal. Stafilokokus menyebabkan
penggabunganbronkopneumoniyangseringunilateralataulebihmencolokpadasatisisi
ditandaiadanyadaerahnekrosisperdarahanyangluasdankavernatidakteratur.1
1.6. MANIFESTASIKLINIK

Gejala dan tanda klinis pneumonia bervariasi tergantung dari kuman penyebab, usia
pasien,statusimunologispasien,danberatnyapenyakit.Manifestasiklinisbiasanyaberat
yaitusesak,sianosis,tetapidapatjugagejalanyatidakterlihatjelassepertipadaneonatus.
Gejaladantandapneumoniadapatdibedakanmenjadigejalaumuminfeksi(nonspesifik),
gejala pulmonal, pleural, atau ekstrapulmonal. Gejala nonspesifik meliputi demam,
menggigil, sefalgia, resah dan gelisah. Beberapa pasien mungkin mengalami gangguan
gastrointestinalsepertimuntah,kembung,diare,atausakitperut.3

Gejalapadaparutimbulsetelahbeberapasaatprosesinfeksiberlangsung.Setelahgejala
awalsepertidemamdanbatukpilek,gejalanapascupinghidung,takipnu,dispnu,dan
timbul apnu. Otot bantu napas interkostal dan abdominal mungkin digunakan. Batuk
umumnyadijumpaipadaanakbesar,tapipadaneonatusbisatanpabatuk.2

Frekuensinapasmerupakanindekspalingsensitifuntukmengetahuiberatnyapenyakit.
Halinidigunakanuntukmendukungdiagnosisdanmemantautatalaksanapneumonia.
Pengukuranfrekuensinapasdilakukandalamkeadaananaktenangatautidur.TimWHO
telah merekomendasikan untuk menghitung frekuensi napas pada setiap anak dengan
batuk.Denganadanyabatuk,frekuensinapasyanglebihdarinormalsertaadanyatarikan
dinding dada bagian bawah ke dalam (chest indrawing), WHO menetapkan sebagai
pneumonia(dilapangan),danharusmemerlukanperawatandenganpemberianantibiotik.
Perkusi toraks pada anak tidak mempunyai nilai diagnostik karena umumnya kelainan
patologinyamenyebar;suarareduppadaperkusibiasanyakarenaadanyaefusipleura.2

Suaranapasyangmelemahseringkaliditemukanpadaauskultasi.Ronkhibasahhalusyang
khasuntukpasienyanglebihbesar,mungkintidakterdengarpadabayi.Padabayidan
balitakecilkarenakecilnyavolumetoraksbiasanyasuaranapassalingberbaur,dansulit
untukdiidentifikasi.2

Secaraklinispadaanaksulitmembedakanpneumoniabakterialdenganpneumoniaviral.
Namunsebagaipedomandapatdisebutkanbahwapneumoniabakterialawitannyacepat,
batukproduktif,pasientampaktoksik,leukositosis,danperubahannyatapadapemeriksaan
radiologis.2
Namunkeadaansepertiinikadangkadangsulitdijumpaipadaseluruhkasus.

2.6.1. Pneumoniapadaneonatusdanbayikecil

Pneumoniainiseringterjadiakibattransmisivertikalibuanakyangberhubungan
denganprosespersalinan,misalnyamelaluiaspirasimekonium,cairanamnion,dari
serviksibu,atauberasaldarikontaminasidengansumberinfeksidariRS.infeksi
juga dapat terjadi karena kontaminasi dari komunitasnya. Gambaran klinis
pneumoniapadaneonatusdanbayikeciltidakkhas,mencakupseranganapnea,
sianosis, merintih, napas cuping hidung, takipnea, letargi, muntah, tidak, mau
minum,takikardiataubradikardi,retraksisubkostadandemam.PadabayiBBLR
seringterjadihipotermi.Keadaaniniseringsulitdibedakandengankeadaansepsis
danmeningitis.6

2.6.2. Pneumoniapadabalitadananakyanglebihbesar

Gejalaklinisyangtimbulpadapneumoniayangterjadipadabalitadananakyang
lebihbesarmeliputidemam,menggigil,batuk,sakitkepala,anoreksia,dankadang
kadangkeluhangastrointestinal(muntahdandiare).Secaraklinisgejalarespiratori
sepertitakipnea,retraksisubkosta(chestindrwaing),napascupinghidung,ronki,
dansianosis.Penyakitiniseringditemukanbersamakonjungtivitis,otitismedia,
faringitis,danlaringitis.Anakbesardenganpneumonialebihsukaberbaringpada
sisiyangsakitdenganlututtertekukkarenanyeridada.Ronkihanyaditemukanbila
adainfiltratalveoler.Bilaterjadiefusipleuraatauempiema,gerakanekskursidada
tertinggaldidaerahefusi.Gerakandadajugaterganggubilaterdapatnyeridada
akibatiritasipleura.Bilaefusibertambah,sesaknapasakansemakinbertambah,
tetapinyeripleuraakansemakinberkurangdanberubahmenjadinyeritumpul.6

Kadangtimbulnyeriabdomenbilaterdapatpneumonialobuskananbawahyang
menimbulkaniritasidiafragma.Nyeriinidapatmenyebarkekuadrankananbawah
danmenyerupaiappendisitis.Abdomenmengalamidistensiakibatdilatasilambung
yangdisebabkanolehaerografiatauileusparalitik.Hatiakanterababilatertekan
oleh diafragma, atau memang membesar karena terjadi gagal jantung kongestif
sebagaiakibatkomplikasipneumonia.6

2.6.3. Pneumoniaatipik

Mikroorganisme penyebab adalah Mycoplasma pneumoniae, Chlamydia spp,


Legionnelapneumofilia,danUreaplasmaurealyticum. Mycoplasmapneumoniae,
Chlamydia pneumoniae merupakan penyebab potensial infeksi respiratori dan
pneumoniapadaanak,terutamapadaanakusiasekolahdanremaja. Chlamydia
trachomatis seringditemukansebagaipenyebabinfeksiakutrespiratoripadabayi
melalui transmisi vertikal (proses kersalinan) dan merupakan etiologi infeksi
perinatal yang penting. Legionnela pneumofilia, dan Ureaplasma urealyticum
jarangdilaporkanmenyebabkanifeksipadaanak.6

2.6.3.1. InfeksiolehMycoplasmapneuoniae

Infeksidiperolehmelaluidropletdarikontakdekat(diasrama,keluargadengan
jumlahanggotakeluargayangsangatbanyak).Masainkubasilebihkurang3
minggu.Gambaranklinispneumoniaatipikdidahuluidengangejalamenyerupai
influenza(influenzalikeflusyndrome)sepertidemam(jaranglebihdari380C),
malaise, sakit kepala, mialgia, tenggorokan gatal dan batuk. Kadangkadang
dapatsembuhsendiri,tetapikasusberatsepertiseverenecrotizingpneumonitis
dengankonsolidasiluaspadajaringanparudanefusipleurapernahdilaporkan.
Kadangdapatberlanjutmenjadibronkitis,bronkiolitis,danpneumonia.6

Batukterjadi35harisetelahawitanpenyakit,awalnyatidakproduktiftetapi
kemudianmenjadiproduktif.Sputummungkinberbercakdarahdanbatukdapat
menetaphinggabermingguminggu.Mengidapatditemukanpada3040%kasus
pneumoniamikoplasmadanlebihseringditemukanpadaanakyanglebihbesar.
Kulturbakterimemerlukanwaktu2minggudanujiserolighanyabermanfaat
bila telah terjadi pembentukan antibodi (ketika penyakit telah sangat
berkembang).Gambaranfotorontgennyasangatbervariasi,meliputigambaran
infiltrat intersisial, retikuler, retikulonoduler, bercak konsolidasi, pembesaran
kelenjarhilus,dankadangkadangdisertaiefusipleura.6

2.6.3.2. InfeksiolehChlamydiapenumoniae

Gejalaklinisawalnyaberupagejalasepertiflu,yaitubatukkering,mialgia,sakit
kepala, malaise, pilek, dan demam yang tidak tinggi. Pada pemeriksaan
auskultasi dada tidak ditemukan kelainan. Gejala respiratori umunya tidak
mencolok.Leukositdarahtepibiasanyanormal.Gambaranfotorontgentoraks
menunjukaninfiltratdifusataugambaranperibronkialnonfokalyangjauhlebih
berat daripada gejala klinis. Pneumonia Klamidia lebih sering ditemukan di
daerahtropis,bersifatendemik,danepidemikdenganinterval34tahun.Infeksi
Klamidiajugadapatberperandalampatogenesisasma.6

1.7. PEMERIKSAANPENUNJANG

a) DarahPeriferLengkap

Padapneumoiavirusdanjugamikoplasmaumumnyaditemukanleukositdalambatas
normal atau sedikit meningkat. Akan tetapi pada pneumonia bakteri didapatkan
leukositosis ( 15.000 40.000/mm3 ). Dengan prdominan PMN. Leukopenia ( <
5000/mm3 )menunjukkanprognosisyangburuk.Padainfeksi Chlamydia kadang
kadang ditemukan eosinofilia. Pada efusi pleura didapatkan sel PMN pada cairan
eksudatberkisar300100.000/mm3,protein>2,5g/dl,danglukosarelatigflebihrendah
daripada glukosa darah. Kadang kadang terdapat anemia ringan dan LED yang
meningkat. Secara umum hasil peneriksaan darah perifer lengkap tidak dapat
membedakanantarainfeksivirusdanbakterisecarapasti.6
b) CReaktifProtein(CRP)

CRP adalah suatu protein fase akut yang disisntesis oleh hepatosit. Sebagai respon
infeksi atau inflamasi jaringan, produksi CRP secara cepat distimulasi oleh sitokin,
terutamaIL6,IL1daTNF.Meskipunfungsipastinyabelumdiketahui,CRPsangat
mungkinberperandalamopsonisasimikroorganismeatauselrusak.6

SecaraklinisCRPdigunakansebagaialatdiagnostikuntukmembedakanantarafaktor
infeksidannoninfeksi,infekivirusdanbakteri,atauinfeksisuperfisialisatauprofunda.
KadarCRPbiasanyalebihrendahpadainfeksivirusatauinfeksisuperfisialisdaripada
profunda.6

c) UjiSerologis

Uji serologik untuk mendateksi antigen dan antibodi pada infeksi bakteri tipik
mempunyaisensitivitasdanspesifisitasyangrendah.Secaraumum,ujiserologistidak
terlalu bermanfaat dalam mendiagnosis infeksi bakteri tipik, namun bakteri atipik
sepertiMycoplasmadanchlamydiatampakpeningkatananibodiIgMdanIgG.6

d) Pemeriksaanmikrobiologis

Untukpemeriksaanmikrobiologik,spesimendapatdiambildariusaptenggorok,sekret
nasofaring, bilasan bronkus, darah, punksi pleura atau aspirasi paru. Diagnosis
dikatakan definitif apabila kuman ditemukan dari darah, cairan pleura, atau aspirasi
paru.6

KulturdarahjarangpositifpadainfeksiMycoplasmadanChlamydia.6

e) PemeriksaanrontgenThoraks
Secaraumumgambaranotothoraksterdiridari:

Infiltrat interstisial, ditandai dengan peningkatan corakan bronkovaskuler,


peribronchialcuffingdanhiperaerasi.6

Infiltrat alveoler, merupakan konsolidasi paru dengan air bronchogram.


Konsolidasidapatmengenaisatulobus(pneumonialobaris),atauterlihatsebagai
leitunggalyangbiasanyacukupbesar,berbentuksferis,batastidakterlalutegas,
menyerupailesitumorparu,dikenalsebagairoundpneumonia.6

Bronkopneumonia, ditandai dengan gambaran difus merata pada kedua paru,


berupabercakbercakinfiltratyangmeluashinggakedaerahperiferparu,disertai
denganpeningkatancorakanperibronkial.6

Gambaran radiologis pneumonia meliputi infiltrat ringan pada satu paru hingga
konsolidasi luas pada kedua paru. Pada satu penelitian, ditemukan bahwa lesi
pneumonia pada anak terbanyak berada di paru kanan, terutama di lobus atas. Bila
ditemukan di pru kiri dan terbanyak di olbus bawah, hal itu merupakan prediktor
perjalananpenyakityanglebihberatdenganresikoterjadinyapleuritislebihbesar.6

1.8. DIAGNOSIS

Diagnosisetiologiberdasarkanpemeriksaanmikrobiologisdan/atauserologismerupakan
dasar terpi yang optimal. Akan tetapi penemuan bakteri penyebab tidak selalu mudah
karenamemerlukanlaboratorimyangmemadai.Prediktorpalingkuatadanyapneumonia
adalahdemam,sianosis,danlebihdarisatugejalarespiratorisebagaiberikut:takipnea,
batuk,nafascupinghidung,rtraksi,ronkidansuaranafasmelemah sertadidukungoleh
gambaranradiologis.6

Akibat tingginya angka morbiditas dan mortalitas pneumonia pada balita, maka dalam
upaya peanggulangannya WHO mengembangkan pedoman diagnosis dan tatalaksana
pneumoniayangsederhana.6

Berikutadalahklasifikasipneumoniaberdasarkanpedomantersebut.6,8
Bayidananakberusia2bulan5tahun

o Pneumoniasangatberat

Tidakdapatminum/makan

Kejang

Letargis

Malnutrisi

o Pneumoniaberat

Bilaadasesaknafas,adaretraksi

Harusdirawatdandiberikanantibiotik

o Pneumonia

Bilatidakadasesaknafas

Adanafascepatdenganlajunafas

>50x/menituntukanakusia2bulan1tahun

>40x/menituntukanakusia>15tahun

Tidakperludirawat,diberikanantibiotikoral

o Bukanpneumonia

Bilatidakadanafascepatdansesaknafas

Tidakperludirawatdantidakperluantibiotik,hanyadiberikanpengobatan
simptomatissepertipenurunpanas.

Bayiberusiadibawah2bulan
o Pneumoniasangatberat

Tidakmaumenetek/minum

Kejang

Letargis

Demamatauhipotermi

Bradipneaataupernapasanireguler

o Pneumoniaharusdirawatdandiberikanantibiotik

Bilaadanafascepat(>60x/menit)atausesaknafas

Retraksi

Harusdirawatdandiberikanantibiotik

o Bukanpneumonia

Tidakadanafascepatatausesaknafas

Tidakperludirawat,cukupdiberikanpengobatansimptomatis

1.9. KOMPLIKASI

Komplikasi yang dapat terjadi meliputi empiema torasis (komplikasi tersering oleh
pneumonia bakteri), perikarditis purulenta, pneumotoraks, atau infeksi ekstrapulmoner
seperti meningitis purulenta. Miokarditis (tekanan sistolik ventrikel kanan meningkat,
kreatininkinasejugameningkat,dangagaljantung)jugadilaporkancukuptinggipadaseri
pneumoniaanakberusia224bulan.6

1.10. PENATALAKSANAAN
Sebagian pneumoni pada anak tidak perlu dirawat inap. Indikasi perawatan trutama
berdasarkanberatringannyapenyakit,misalnyatoksis,disterspernafasan,tidakmaumakan
atau minum, atau ada penyakit dasaryang lain, komplikasi, dan terutama
mempertimbangkan usia pasien. Neonatus dan bayi kecil dengan kemungkinan klinis
pneumoniaharusdirawatinap.6

Dasartatalaksanapneumoniarawatinapadalahpengobatankausaldenganantibiotikyang
sesuai,sertatindakansuportif.Pengobatansuportifmeliputipemeberincairanintravena,
oksigen,koreksiterhadapgangguanasabasa,elektrolit,danguladarah.Untuknyeridan
demam dapat diberikan analgetik /antipiretik. Suplementasi vitamin A tidak terbukti
efektif.6

Penggunaanantibiotikyangtepatmerupakankunciutmakeberhasilanpengobatan.Terapi
antibiotikharussegeradiberikanpadaanakdenganpneumoniayangdidugadisebabkan
olehbakteri.6

a. PneumoniaRawatJalan

Pada pneumonia rawat jalan diberikan antibiotik lini pertama secara oral, misalnya
amoksisilinataukotrimoksazol.Dosisamoksisilinyangdiberikanadalah25mg/kgBB,
sedangkankotrimoksazoladalah4mg/kgBBTMP20mg/kgBBsulfametoksazol.6

Makrolid, baik eritromisin maupun makrolid baru dapat digunakan sebagai terapi
alternatif beta laktam untuk pengobatan inisial pneumonia, dengan pertimbangan
adanyaaktivitasgandaterhadapS.pneumoniadanbakteriatipik.Dosiseritromisin30
50mg/kgBB/hari,diberikansetiap6jamselama1014hari.Klaritromisindiberikan2
kaliseharidengandosis15mg/kgBB.Azitromisin1kalisehari10mg/kgBB35hari
(haripertama)dilanjutkandengandosis5mg/kgBBuntukhariberikutnya.6

b. PneumoniaRawatInap

Padapneumoniarawatinapantibiotikyangdiberikanadalahbetalaktam,ampisilinatau
amoksisislindikombinasikandegankloramfenikol.Antibiotikyangdiberikanberupa:
PenisilinGintrvena(25.000U/kgBBsetiap4jam)dankloramfenikol(15mg/kgBB
setiap 6 jam ), dan seftriaxon intravena ( 50 mg/kgBB setiap 12 jam ). Keduanya
diberikanselama10hari.6

2.12. PREVENTIF

2.12.1. PencegahanPrimer

Pencegahanprimerbertujuanuntukmenghilangkanfaktorresikoterhadapkejadian
pneumonia.Upayayangdapatdilakukanantaralain:9

a. Memberikan imunisasi campak pada usia 9 bulan dan imunisasi DPT


(Dipteri, Pertusis, Tetanus) sebanyak 3 kali yaitu pada usia 2, 3, dan 4
bulan.

b. MenjagadayatahantubuhanakdengancaramemberikanASIpadabayi
neonatalsampaiberumur2tahundanmakananyangbergizipadabalita.Di
sampingitu,zatzatgiziyangdikonsumsibayidananakanakjugaperlu
mendapatperhatian.

c. Mengurangi polusi lingkungan seperti polusi udara dalam ruangan dan


polusidiluarruangan.

d. Mengurangikepadatanhunianrumah.

2.12.2. PencegahanSekunder

Tingkatpencegahankeduainimerupakanupayamanusiauntukmencegahorang
yang telah sakit agar sembuh, menghambat progresifitas penyakit, menghindari
komplikasi, dan mengurangi ketidakmampuan. Pencegahan sekunder meliputi
diagnosis dini dan pengobatan yang tepat sehingga dapat mencegah meluasnya
penyakitdanternjadinyakomplikasi.Upayayangdapatdilakukanantaralain:9

a. Pneumoniaberat:dirawatdirumahsakit,diberikanantibiotikparenteral
danpenambahanoksigen.
b. Pneumonia : diberikan antibiotik kotrimoksasol oral, ampisilin, atau
amoksisilin.

c. Bukan pneumonia : perawatan di rumah saja. Tidak diberikan terapi


antibiotik.Bilademamtinggidiberikanparacetamol.Bersihkanhidungpada
anak yang mengalami pilek dengan menggunakan lintingan kapas yang
diolesiairgaram.Jikaanakmengalaminyeritenggorokan,beripenisilindan
dipantauselama10harikedepan.

2.12.3. PencegahanTersier

Tujuan utama dari pencegahan tersier adalah mencegah agar tidak munculnya
penyakitlainataukondisilainyangakanmemperburukkondisibalita,mengurangi
kematiansertausaharehabilitasinya.Padapencegahantingkatinidilakukanupaya
untukmencegahprosespenyakitlebihlanjutsepertiperawatandanpengobatan.
Upayayangdilakukandapatberupa:9

a. Melakukan perawatan yang ekstra pada balita di rumah, beri antibiotik


selama 5 hari, anjurkan ibu untuk tetap kontrol bila keadaan anak
memburuk.

b. Bilaanakbertambahparah,makasegerabawakesaranakesehatanterdekat
agarpenyakittidakbertambahberatdantidakmenimbulkankematian.

2.13. PROGNOSIS

Denganpemberianantiboitikyangtepatdanadekuat,mortalitasdapatditurunkansampai
kurangdari1%.Anakdalamkeadaanmalnutrisienergiproteindanyangdatangterlambat
menunjukanmortalitasyanglebihtinggi.1

DAFTARPUSTAKA

1. Anonim.Bronkopneumoni.Diunduhdari:http://id.scribd.com
2. SupriyatnoB.InfeksiRespiratoriAkutpadaAnak.September2006.Diunduhdari:Sari
Pediatri,Vol.8,No.2.h.1006

3. Guyton,Hall.BukuAjarFisiologiKedokteran.BukuKedokteranEGC.Jakarta:1997.
Hal633.

4. Soeparman,WaspadjiS.IlmuPenyakitDalam.JilidII.BalaiPenerbitFKUI.Jakarta:
1999.hal:695705.

5. PedomanDiganosisdanTerapiKesehatanAnak,UNPAD,Bandung:2005

6. Said M. Pneumonia. Buku Ajar Respiratori Anak. Edisi II. Ikatan Dokter Anaka
Indonesia.Jakarta:2008.h.35064.

7. Pedoman Diagnosis dan Penatalaksanaan di Indonesia. Perhimpunan Dokter Paru


Indonesia.Bandung:2005.

8. PedomanPelayanMedis.Jilid1.IkatanDokterAnakIndonesia.Jakarta:2010.

9. DefinisiPneumoni.Diunduhdari:ChapterII.pdf

SepsisNeonatorum

Definisi
Sepsisneonatorumadalahinfeksialirandarahyangbersifatinvasifdanditandaidengan
ditemukannyabakteridalamcairantubuhsepertidarah,sumsumtulangatauairkemihpadabayi
dalam28haripertamasetelahkelahiran.
Sejakadanyakosensusdari AmericanCollegeofChestPhysicians/SocietyofCritical
CareMedicine(ACCP/SCCM)telahtimbulberbagaiistilahdandefinisidibidanginfeksiyang
banyakpuladibahaspadakelompokbayibarulahirdanpenyakitanak.Istilah/definisitersebut
antaralain:
Sepsis merupakan sindrom respons inflamasi sistemik (Systemic inflammatory respons
syndromeSIRS)yangterjadisebagaiakibatinfeksibakteri,virus,jamurataupunparasit.
Sepsis berat adalah keadaan sepsis yang disertai disfungsi organ kardiovaskuler dan
gangguannapasakutatauterdapatgangguanduaorganlain(sepertineurologi,hematologi,
urogenital,danhepatologi).
Syok sepsis terjadi apabila bayi masih dalam keadaan hipotermi walaupun telah
mendapatkancairanadekuat.
Sindroma disfungsi multi organ terjadi apabila bayi tidak mampu lagi mempertahankan
homeostasistubuhsehinggaterjadiperubahanfungsiduaataulebihorgantubuh.1
DalamPBLblok17inimahasiswadiharapkandapatmenguasaidarisegalaaspekmengenai
sepsisneonatorumberdasarkankasusyangtelahdiberikan.

PEMERIKSAAN

Pemeriksaanfisik

Carapendekatan:untukmengurangiketegangan
<4bulan:pendekatanmudah(belummembedakanorangdisekitarnya)
>4bulan:
Pendekatanmulaisaatdalamgendongan
Lambatlaunkemejaperiksadengandiajakbicaramanisdandipegangpegang
Anakygagakbesar:
Berisalam,tanyanama,umur,sekolah,danlainlain
Dipuji
Inspeksi

Inspeksiumum:dilihatanaksecaraumumapaadaperubahan
(kesan:keadaanumumpasien)
Inspeksilokal:pemeriksaansetempat
Dilihatperubahansampaisekecilkecilnya.1
Palpasi
Merabadengantelapaktangandanjarijaritangan
Ditentukanbentuk,besar,tepi,permukaandankonsistensiorgan:
Besardinyatakandengansatuantertentu
Permukaan:licin/benjolbenjol
Konsistensi:lunak,keras,kenyal,kistik,fluktuasi
Tepi:tajam,tumpul
Bebas/melekat
Palpasiabdomendilakukandengan:
Fleksisendipingguldanlutut
AbdomendirabadengantelapaktanganmendatardanjarijariIIIIIIV
rapat
Bilaadabagianyangsakit,dimulaidaribagianyangtidaksakit
Dengan2tanganuntukmengetahuiadanyacairanatauballotement
Perkusi
Untukmengetahuiperbedaansuaraketukditentukanbatassuatuorgan:paru,jantung,
hatiataumengetahuibatasbatasmassaabnormaldalamronggaabdomen.
Caralangsung:denganjariII/III(jarang)
Caratidaklangsung:
JariIIatauIIIdiletakkanlurusdibagiantubuhsebagailandasanketuk
DiketukpadaphalangebagiandistalproximalkukudenganjariII/IIItangankananyang
membengkok
Suaraperkusi:
Sonor(suaraparunormal)
Pekak(padaperkusiotot)
Timpani(perkusiabdomenbagianlambung)
Redup(diantarasonordanpekak)
Hipersonor(antarasonordantimpani).1,2
Auskultasi
Alatstetoskop
Pediatrik(neonatusdananak)
Diametermembran33.5cm
Diametermangkok3cm
Nadarendahpada
Bisingpresistolik
Middiastolik
BisingjantungI,II,III,IV
Nadatinggipada
Bisingsistolik
Friksipericard

Manifestasiklinis
Keadaanumum:Panas,hipotermia,tampaktidaksehat,malasminum,letargi,sklerema.
Salurancerna:Distensiabdomen,anoreksia,muntah,diare,hepatomegali.
Salurannafas:Apneu,dispneu,takipneu,retraksi,nafastidakteratur,merintih,sianosis.
Kardiovaskuler:Pucat,sianosis,kutismarmorata,kulitlembab,hipotensi,takikardia,
bradikardia.
Sistemsarafpusat:Iritabilitas,tremor,kejang,hiporefleksi,aktivitasmenurunletargi,koma,
peningkatanataupenurunantonus,gerakanmataabnormal,ubunubunmembonjol.
Hematologi:Pucat,ptekie,purpura,perdarahan,ikterus.1,2,3
Sistemsirkulasi:pucat,sianosis,kulitdingin,hipotensi,edema,denyutjantungtidakteratur.

Pemeriksaanpenunjang

Pemeriksaanlaboratorium

Kulturdaridarah,cairanLCSdanurin.
Kulturbakteriaerobdananaerobadalahtindakanyangpalingtepatbagimamastikanetiologi
sepsisneonatorum.Kulturkumananaerobdiutamakanbagisepsisneonatusyangdisertaiabses,
gangguanGIT,holisismasifdanpneumonia.
Pemeriksaan gram dilakukan bagi mengenalpasti bakteri secara umum sebelum dilakukan
pemeriksaanyanglain.
Kultur bakteri seharusnyadapat menunjukkan etiologi sepsis neonatorum yang menginfeksi
dalam3648jam.
Kultur dari urin dapat membantu dalam menegakkan diagnosis sepsis neonatorum awitan
lambat.2
KulturdaridarahdancairanLCSdapatmembantumenegakkandiagnosasepsisneonatorum
bagiawitancepatmaupunawitanlambat.

Pemeriksaanhematologi
Pertandahematologikyangdigunakanadalahhitungseldarahputihtotal,hitungneutrofil,neu
trofilimatur,rasioneutrofilimaturdenganneutrofiltotal(I:T),mikroErytrocyteSedimentation
Rate(ESR),danhitungtrombosit.TeslaboratoriumyangdikerjakanadalahCRP,prokalsitonin,
sitokinIL6,GCSF,tescepat(rapidtest)untukdeteksiantigen,danpanelskriningsepsis.
Sel darah putih dianggap lebih sensitif dalam menunjang diagnosis berbanding hitung
trombosit.Enampuluhpersenpasiensepsisbiasanyadisertaiperubahanhitungneutrofil.Rasio
antaraneutrofilimaturdanneutrofiltotal(rasioI/T)seringdipakaisebagaipenunjangdiagnosa
sepsisneonatorum.SensitifitasrasioI/Tini6090%,karenanyauntukdiagnosis,perludisertai
kombinasidengangambaranklinikdanpemeriksaanpenunjanglain.
Creactive protein (CRP), yaitu protein yang timbul pada fase akut kerusakan jaringan.
PeninggiankadarCRPiniterjadi24jamsetelahterjadisepsis,meningkatpadaharike23sakit
dan menetap tinggi sampai infeksiteratasi. Nilai CRP akan lebih bermanfaat biladilakukan
secaraserialkarenadapatmemberikaninformasiresponspemberianantibiotiksertadapatpula
dipergunakanuntukmentukanlamanyapemberianpengobatandankejadiankekambuhanpada
pasiendengansepsisneonatal.3,4
Saatini,kombinasipetandaterbaikuntukmendiagnosissepsisadalahsebagaiberikut:IL6,dan
IL1rauntuk12harisetelahmunculnyagejala;IL6(atauIL1ra0,IL8,GCSF,TNF,CRP,dan
hematologicalindices) padaharike0;CRP,IL6(atauGCSFdan hematologicalindices) pada
harike1;danCRPpadaharihariberikutnyauntukmemonitorresponsterhadapterapi.

Pemeriksaanradiologi
Pemeriksaanfototoraksmungkinakanmenunjukkangambaraninfiltratsegmentalataulobar
namunlebihseringmenunjukkangambaranyangdifus,retikulogranulasisepertiyangterlihat
padaRespiratoryDistressSyndrom(RDS).Efusipleurajugamungkindapatterobservasi.
Pemeriksaan CTscan atau MRI mungkin diperlukan apabila disyaki timbulnya neonatal
meningitiskompleks.
Pemeriksaan USG pada kepala neonatus dapat menunjukkan gambaran ventrikulitis, cairan
ekstraseldandapatmenunjukkanprogresivitaskomplikasisepsis.

Tabel1.KriteriaDiagnosisSepsispadaNeonatus

Variabelklinis
Suhutidakstabil
DenyutJantung>180kali/menit,<100kali/menit
Frekuensinapas>60kali/menitditambahmerintih/retraksiataudesatusari
Letargisataupenurunankesadaran
Intoleransiglukosa(glukosaplasma>10mmol/L)
Intoleransiminum
Variabelhemodinamik
Tekanandarah<2SDdibawahnilainormaluntukusia
Tekanandarahsistolik<50mmHg(neonatususia1hari)
Tekanandarahsistolik<65mmHg(bayi<1bulan)
Variabelperfusijaringan
Waktupengisiankembalikapiler>3detik
Laktatplasma>3mmol/L
Variabelinflamasi
Leukositosis(hitungleukosit>34.000/mL)
Leukopenia(hitungleukosit<5.000/mL)
Neutrofilimatur>10%
Immature:totalneutrophil(IT)ratio>0,2
Trombositopenia<100.000/mL
CRP>10mg/dLatau>2SDdiatasnilainormal
Prokalsitonin>8,1mg/dLatau>2SDdiatasnilainormal
IL6atauIL8>70pg/mL
16sPCRpositif

EPIDEMIOLOGI
Insidenssepsisneonatorumberagammenurutdefinisinya,dari15/1000kelahiranhidup
dinegaramajudanfluktuasiyangbesarsepanjangwaktudantempatgeografis. 4 Keragaman
insidensdarirumahsakitkerumahsakitlainnyadapatdihubungkandenganangkaprematuritas,
perawatanprenatal,pelaksanaanpersalinan,dankondisilingkungandiruangperawatan.Angka
sepsisneonatorummeningkatsecarabermaknapadabayidenganberatbadanlahirrendahdan
bilaadafaktorresikoibu(obstetrik)atautandatandakorioamnionitis.
ETIOLOGI

Sepsis pada neonatus dapat disebabkan oleh infeksi virus, parasit, jamur dan bakteri
namunkebanyakankasussepsisneonatorumadalahdisebabkanolehbakteriiaitu Escherichia
coli dan Staphylococcus aureus. Pada kasus yang berlaku di rumah sakit pula, Klebsiella
ozaenae sering menjadi etiologi bagi sepsis neonatorum. Namun etiologi sepsis neonatorum
dapatjugadibagikankepadaduakelompokiaitubakteriyangmenyebabkanawitancepat(72
jamselepaskelahiran)danbakteriyangmenyebabkanawitanlambat(selepas72jamkelahiran).
Kuman penyebab sepsis awitan dini berturutturut adalah GBS, A. calcoaceticus, S.
epidermidis,Klebsiellasp., Pseudomonassp.,dan E.coli.Sedangkanpenyebabsepsisawitan
lambatberturutturutadalahA.calcoaceticus,E.aerogenes,Staphylococcussp.,Klebsiellasp.,
S.marcescens,danPseudomonassp.3,5

PATOFISIOLOGI

Imunitasseluler
Pada neonatus, sel neutrofil dan sel PMN yang sepatutnya mempertahankan tubuh
dengan membunuh bakteri yang efektif menyebabkan infeksi masih kekurangan kapasitas
kemotaksisdanmembunuh.Kekuranganfaktoradherensipadalapisankapilerpembuluhdarah
menyebabkan selsel ini tidap dapat bermigrasi ke dalam jaringan tubuh. Meskipun ada sel
neutrofil danselPMN yangberjayamenembus ke jaringan, proses degranulasisel terhadap
responsfaktorkemotaktikmungkintidakberhasil.
Selainitu,selPMNpadaneonatusjugakurangmampudeformasi,menyebabkankurang
mampubergerakmelaluijaringanmatriksekstraselluleruntukmencapailokasiperadangandan
infeksi.Kemampuan terbatas sel PMN neonatal untuk fagositosis dan membunuh bakteri ini
lebihnyatabilabayisecaraklinissakit.Cadanganneutrofilyangmudahhabiskarenarespon
yang berkurang dari sumsum tulang juga menyumbang kepada rentannya neonatus terhadap
infeksi.
Konsentrasimonositneonatalberadapadatingkatmanusiadewasayangnormal,namun
kemotaksismakrofagterganggudanterusmenunjukkanpenurunanfungsipadaawalkehidupan
neonatus.Jumlahmutlakmakrofagmengalamipenurunandiparuparudancenderungmenurun
dihatidanjugalimpa.Kemotaksisdanaktivitasbacteriocidaldanpresentasiantigenolehselsel
inijugatidaksepenuhnyakompetensaatlahir.Produksisitokinolehmakrofagmenurun,yang
mungkinterjadisehubungandenganpenurunannilaiproduksiTsel.2,4
Meskipun sel T ditemukan di awal kehamilan dalam sirkulasi janin dan semakin
meningkat jumlahnya dari lahir sampai sekitar usia 6 bulan, selsel ini merupakan sel yang
belummatangsepenuhnya.SelselinitidakberploriferasisepertiselTdewasaketikadiaktifkan
dantidakefektifmenghasilkansitokinyangmembantustimulasidiferensiasiselB,granulosit
dan proliferasi monosit.Keterlambatan tersebut terjadi dalam pembentukan fungsi memori
antigenspesifikberikutaninfeksiprimer,danfungsiselTsitotoksikneonataladalah50100%
kurangefektifberbandingselTdewasa.Saatlahir,neonatuskekuranganmemoriTsel.Pada
sebagianneonatusyangterkenarangsanganantigenik,jumlahselTmemoriinimeningkat.
Naturalkillersel(NK)ditemukandalamjumlahkecildalamdarahperiferneonatus.Sel
selinijugasecarafungsionalmasihbelummatang,danmenghasilkangamainterferonyangjauh
lebihrendahterhadaprangsanganantigenberbandingselNKdewasa.
Imunitashumoral
Janinmemilikibeberapaimunoglobulinyangberperan,terutamayangdiperolehmelalui
transferplasentaspesifikdariibu.Kebanyakandaritransferiniterjadipadaakhirkehamilan,
sehinggatingkatterendahditemukandenganmeningkatnyausianeonatus.
Kemampuan neonatus untuk menghasilkan imunoglobulin dalam menanggapi
rangsangan antigenik masih belum sempurna, namun besarnya respon yang pada awalnya
kurang, cepat meningkat dengan bertambahnya usia pascakelahiran. Neonatus juga mampu
mensintesisimunoglobulinM(IgM)didalamrahimpadakehamilan10minggu,namuntingkat
IgM umumnya rendah saat lahir, kecuali bayi itu terkena agen infeksi selama kehamilan,
sehinggamerangsangpeniingkatanproduksiIgM.ImunoglobulinG(IgG)danimunoglobulinE
(IgE)dapatdisintesisdidalamrahim.SebagianbesarIgGtersebutdiperolehdariibuselama
kehamilan akhir.neonatus dapat menerima imunoglobulin A (IgA) dari ASI tetapi tidak
mensekresikan IgA sampai 25 minggu setelah kelahiran.Respon untuk antigen polisakarida
bakterijugamasihkurangdanmulaberfungsisempurnasetelahtahunkeduakehidupan.5
Produksi komplemen protein dapat dideteksi sedini kehamilan 6 minggu, namun
konsentrasi berbagai komponen sistem komplemen luas bervariasi antara individu
neonatus.Meskipun beberapa bayi telah melengkapi tingkat sebanding dengan mereka yang
dewasa,kekurangantampaklebihbesardijaluralternatifdaripadadijalurklasik.Komponen
komplemensitotoksikterminalkaskadeyangmengarahkepembunuhanorganisme,terutama
bakterigramnegatifmasihbelumterbentuksempurna.Kekuranganinilebihditandaipadabayi
prematur.Aktivitas komplemen yang sempurna tidak akan terbentuk sehingga berumur 610
bulan yang menyebabkan berkurangnya efisiensi opsonisasi terhadap GBS,E coli,danS
pneumoniae karena tingkat penurunan fibronektin, suatu protein serum yang membantu
keberkesananfungsineutrofildanmemilikisifatopsonisasi.
Barierfisik
Hambatanfisikdankimiauntukinfeksipadabayiyangbarulahiradalahdisebabkan
kekurangan fungsional.Kulit dan selaput lendir mudah abrasi pada neonatus menyebabkan
rentanterhadapinfeksi.Selainitu,neonatusyangsakitdan/atautambahanprosedurinvasifjuga
menyumbangkearahmudahnyaterkenainfeksi.
4)Infeksi
Baiksendirianataupunkombinasi,produkprodukbakteridansitokinproradangmemicu
responsfisiologisuntukmenghentikaninvasimikroba.Responsiniadalah:
(1)Aktivasisystemkomplemen
(2)AaktivasifaktorHageman(faktorXII),yangkemudianmencetuskan
(3)Pelepasanhormonadrenokortikotropindanbetaendorfin
(4)Rangsanganneutrofilpolimorfonuklear
(5)Rangsangansistemkalikreinkinin
TNFdanmediatorradanglainmeningkatkanpermeabilitasvascular,menimbulkankebocoran
kapiler difus, mengurangi tonus vaskuler, dan terjadi ketidakseimbangan antara perfusi dan
kenaikankebutuhanmetabolikjaringan.

Perubahan sistem imun penderita sepsis menimbulkan perubahan pula pada sistem
koagulasi.PadasistemkoagulasitersebutterjadipeningkatanpembentukanTissueFactor(TF)
yangbersamaandenganfaktorVIIdarahakanberperanpadaproseskoagulasi.Keduafaktor
tersebut menimbulkan aktivasi faktor IX dan X sehingga terjadi proses hiperkoagulasi yang
menyebabkanpembentukantrombinyangberlebihandanselanjutnyameningkatkanproduksi
fibrindarifibrinogen.
Pada pasien sepsis, respon fibrinolisis yang biasa terlihat pada bayi normal juga
terganggu. Supresi fibrinolisis terjadi karena pembentukan plasminogenactivator inhibitor1
(PAI1) yang dirangsang oleh mediator proinflamasi (TNF). Demikian pula pembentukan
trombin yang berlebihan berperan dalam aktivasi thrombinactivatable fibrinolysis inhibitor
(TAFI)yaitufaktoryangmenimbulkansupresifibrinolisis.Keduafaktoryangberperandalam
supresiinimengakibatkanakumulasifibrindarahyangdapatmenimbulkanmikrotrombinpada
pembuluhdarahkecilsehinggaterjadigangguansirkulasi.Gangguantersebutmangakibatkan
hipoksemiajaringandanhipotensisehinggaterjadidisfungsiberbagaiorgantubuh.Manifestasi
disfungsi multiorgan ini secara klinis dapat memperlihatkan gejalagejala sindrom distres
pernapasan, hipotensi, gagal ginjal dan bila tidak teratasi akan diakhiri dengan kematian
pasien.3,4,6

PENATALAKSANAAN

Medikamentosa
a)Antibiotika
Eliminasi kuman merupakan pilihan utama dalam manajemen sepsis neonatal. Pada
kenyataannyamenentukankumanspesifikpastitidakmudahdanmembutuhkanwaktu.Untuk
memperolehhasilyangoptimalpengobatansepsisharuscepatdilaksanakan.Sehubungandengan
haltersebutpemberianantibiotikasecaraempiristerpaksacepatdiberikanuntukmenghindarkan
berlanjutnyaperjalananpenyakit.Pemberianpengobatanpasienbiasanyadenganmemberikan
antibiotikkombinasiyangbertujuanuntukmemperluascakupanmikroorganismepatogenyang
mungkindideritapasien.Diupayakankombinasiantibiotiktersebutmempunyaisensitifitasyang
baik terhadap kuman gram positif ataupun gram negatif. Selain pola kuman hendaknya
diperhatikan pula resistensi kuman. Namun lama pemberian antibiotik begantung pada hasil
kulturdarah,dansegerasetelahdidapatkanhasilkulturdarah,jenisantibiotikayangdipakai
disesuaikandengankumanpenyebabdanpolareistensinya.2,4

Tabel2.Waktu/durasipemberianantibiotikpadasepsisneonatal.
Diagnosis Durasi
Meningitis 21hari
Kulturdarah(+),tandatandasepsis(+) 1014hari
Kulturdarah(),komponenskriningsepsis(+) 710hari
Kulturdarah(),komponenskriningsepsis() 57hari

Tabel3.Antibiotikuntuksepsisneonatal
Antibiotik Dosis Frekuensi Pemberian Durasi

<7hari <7hari
Ampicillin 50mg/kgBB/x 12jam 8jam IV,IM 710hari
atau
Cloxallin 50mg/kgBB/x 12jam 8jam IV,IM 710hari
Dan
Gentamicin 2,5mg/kgBB/x 2jam 8jam IV,IM 710hari
atau
Amikacin 7,5mg/kgBB/x 12jam 8jam IV,IM 710hari

Mempertimbangkan pola kuman yang tersering ditemukan, obat golongan Ceftasidim


dijadikan sebagai antibiotik pilihan pertama dengan dosis yang dianjurkan 50100
mg/kgBB/hari, 2 kali sehari. Beberapa kuman Gram negatif saat ini hanya sensitif terhadap
imipenemataumeropenemdengandosis25mg/kgBB/dosis,2kalisehari.
StreptokokusGrupBdankumanGrampositiflainnyamasihsensitifterhadappenisilin
(dosis100.000200.000U/kgBB/hari)atauampisilin(dosis100200mg/kgBB/hari).Sedangkan
kumanListeriamasihsensitifterhadapkombinasiantibiotikampisilindanaminoglikosid,serta
golongan Pseudomonas umumnyasensitifterhadapsefalosporin.Lamanyapengobatansangat
bergantung kepada jenis kuman penyebab. Pada penderita yang disebabkan oleh kuman
Streptococcus dan Listeria, pemberian antibiotik dianjurkan selama 1014 hari, sedangkan
penderita yang disebabkan oleh kuman Gram negatif pengobatan kadangkadang diteruskan
sampai23minggu.
b)Pengobatansuportif
Transfusi exchange telah digunakan untuk sepsis berat pada neonatus untuk meningkatkan
tingkat sirkulasi imunoglobulin, menurunkan sirkulasi endotoksin, meningkatkan kadar Hb
(dengantingkat2,3diphosphoglyceratelebihtinggi),danmeningkatkanperfusi.
Plasma segar beku (FFP) dapat membantu membaik pulih gangguan koagulasi darah pada
neonatus.6
Nonmedikamentosa

Perhatikankeadaanumum,tandatandavital
Perhatikankeseimbangannutrisidancairan
Evaluasikeadaanhematologi

PREVENTIF
Sepsisneonatarumadalahpenyebabkematianutamapadaneonatus,tanpapengobatan
yangmemadai,gangguaninidapatmenyebabakankematiandalamwaktusingkat.Olehkarena
itu,tindakanpencegahanmempunyaiartipentingkarenadapatmencegahterjadinyakesakitan
dankematian.Tindakanpencegahanitudapatdilakukandengancara:
Padamasaantenatal
Perawatanantenatalmeliputipemeriksaankesehatanibusecaraberkala,iminisais,pengobatan
terhadap infeksi yang diderita ibu, asupan gizi yang memadai, penanganan segera terhadap
keadaanyangdapatmenurunkankesehatanibudanjanin,rujukansegeraketempatpelayanan
yangmemadaibiladiperlukan.
Padasaatpersalinan
Perawatan ibu selama persalinan dilakukan secara aseptik, dalam arti persalinan diperlukan
sebagaitindakanoperasi,tindakanintervensipadaibudanbayiseminimalmungkindilakukan.
Mengawasi keaadan ibu dan janin yang baik selama proses persalinan, melakukan rujukan
secepatnyabiladiperlukan,danmenghindariperlukaankulitdanselaputlendir.5
Padamasasesudahpersalinan
Perawatansesudahlahirmeliputimenerapkanrawatgabungbilabayinormal,pemberianASI
secepatnya,mengupayakanlingkungandanperalatanagartetapbersih,setiapbayimenggunakan
peralatan sendiri. Tindakan invasif harus dilakukan dengan memperhatikan prinsipprinsip
aseptik.Sebelumdansesudahmemegangbayiharusmencucitanganterlebihdahulu.Danbayi
yang berpenyakit menular harus diisolasi, dan pemberian antibotik secara rasional, sedapat
mungkinmelaluipemantauanmikrobiologidantesresistensi.
KOMPLIKASI
Syok karena lepasnya toksin kedalam cairan darah, yang dimana gejalanya sukar untuk
dideteksi.
Meningitis
Gangguanmetabolic
Pneumonia
Infeksisalurankemih
Gagaljantungkongestif
Kematian

PROGNOSIS
Prognosispadasepsisneonatorumumumnyabaik.
Namunhalinijugatergantungpadamasagestasi,jeniskuman,sensitifitaskumandanlama
penyakit,dan25%bayimeninggalmeskipuntelahdiberikanantibiotikdanperawatanintensif.
Angkakematianpadabayiprematuryangkeciladalah2kalilebihbesar.Dankirakiraangka
kematiandarikasussepsisneonatorumadalah3060%.2,3

DAFTARPUSTAKA
1. David H. Dasardasar pediatri. Edisi 3. Jakarta (INA) : Penrbit Buku Kedokteran
EGC;2008.p.49
2. Musrifatul U.Keterampilan dasar praktik klinik untukkebidanan.Edisi 2.Jakarta
(INA):PenerbitSalembaMedika;2008.p.14053
3. IdaA.Bukuajarpatologiobstetriuntukmahasiswakebidanan.Edisi.Jakarta(INA):
PenerbitBukuKedokteranEGC;2006.p.13841
4. Michael C. Oskis essential pediatrics. Edisi 2. Philadelphia (USA) : Lippincot
Williams&Wilkins;2004.p.6875
5. WilliamW,MyronJ,JudithM,etall.Lange:currentdiagnosisandtreatmentin
pediatrics.Edisi18.NewYork(USA):McgrawhillCompanies;2007.p.116589
6. Mhairi G, Martha D, Mary M. Averys neonatology: pathophysiology and
managementofthenewborn.Edisi6.Philadelphia(USA):LippincotWilliams&
Wilkins;2005.p.123649
7. Constance S. Buku saku kebidanan. Edisi 1. Jakarta (INA) : Penerbit Buku
KedokteranEGC;2003.p.35862
8. CaroleK.Comprehensiveneonatalcare.Edisi1.Missouri(USA):ElsevierSaunders;
2007.p.46789
9. JanR.Breastfeedingandhumanlactation.Edisi3.London(UK):JonesandBarlett
Publisher2005.p.31020