Anda di halaman 1dari 329

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN

LA CARACTERIZACIN DEL AROMA DEL VINAGRE DE VINO, DE LOS


PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz

ISBN: 9788469432341
Dipsit Legal: T. 1040-2011

ADVERTIMENT. La consulta daquesta tesi queda condicionada a lacceptaci de les segents


condicions d's: La difusi daquesta tesi per mitj del servei TDX (www.tesisenxarxa.net) ha
estat autoritzada pels titulars dels drets de propietat intellectual nicament per a usos privats
emmarcats en activitats dinvestigaci i docncia. No sautoritza la seva reproducci amb finalitats
de lucre ni la seva difusi i posada a disposici des dun lloc ali al servei TDX. No sautoritza la
presentaci del seu contingut en una finestra o marc ali a TDX (framing). Aquesta reserva de
drets afecta tant al resum de presentaci de la tesi com als seus continguts. En la utilitzaci o cita
de parts de la tesi s obligat indicar el nom de la persona autora.

ADVERTENCIA. La consulta de esta tesis queda condicionada a la aceptacin de las siguientes


condiciones de uso: La difusin de esta tesis por medio del servicio TDR (www.tesisenred.net) ha
sido autorizada por los titulares de los derechos de propiedad intelectual nicamente para usos
privados enmarcados en actividades de investigacin y docencia. No se autoriza su reproduccin
con finalidades de lucro ni su difusin y puesta a disposicin desde un sitio ajeno al servicio TDR.
No se autoriza la presentacin de su contenido en una ventana o marco ajeno a TDR (framing).
Esta reserva de derechos afecta tanto al resumen de presentacin de la tesis como a sus
contenidos. En la utilizacin o cita de partes de la tesis es obligado indicar el nombre de la
persona autora.

WARNING. On having consulted this thesis youre accepting the following use conditions:
Spreading this thesis by the TDX (www.tesisenxarxa.net) service has been authorized by the
titular of the intellectual property rights only for private uses placed in investigation and teaching
activities. Reproduction with lucrative aims is not authorized neither its spreading and availability
from a site foreign to the TDX service. Introducing its content in a window or frame foreign to the
TDX service is not authorized (framing). This rights affect to the presentation summary of the
thesis as well as to its contents. In the using or citation of parts of the thesis its obliged to indicate
the name of the author.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACINDELACROMATOGRAFADEGASES
OLFATOMETRAENLACARACTERIZACINDEL
AROMADELVINAGRE,DELOSPISTACHOSYDEL
ACEITEDEOLIVA

LauraAceaMuoz

TESISDOCTORAL

dirigidaporlasdoctorasMontserratMestresSolyOlgaBustoBusto

DepartamentodeQumicaAnalticayQumicaOrgnica

Tarragona,2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

UNIVERSITAT
ROVIRA I VIRGILI
DEPARTAMENT DE QUIMICA ANALITICA
I QUIMICA ORGANICA
C/ Marcel.l Domingo s/n
Campus Sescelades
43007 Tarragona
Tel. 34 977 55 97 69
Fax 34 977 55 84 46
e-mail: secqaqo@urv.cat

MontserratMestresSol,profesoraagregada,yOlgaBustoBusto,profesoratitular
del Departamento de Qumica Analtica y Qumica Orgnica de la Universidad
RoviraiVirgili,

CERTIFICAMOS:

Queelpresentetrabajo,quellevaporttuloAPLICACINDELACROMATOGRAFA
DEGASESOLFATOMETRAENLACARACTERIZACINDELAROMADELVINAGRE,DE
LOSPISTACHOSYDELACEITEDEOLIVA,hasidorealizado,bajonuestradireccin,
porLAURAACEAMUOZparalaobtencindelttulodeDoctora,enelGrupode
Qumica Analtica Enolgica y de los Alimentos del Departamento de Qumica
Analtica y Qumica Orgnica de esta Universidad y que todos los resultados
presentadossonfrutodelasexperienciasrealizadaspordichadoctoranda.

Tarragona,28deenerode2011

Dra.MontserratMestresSol Dra.OlgaBustoBusto
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011



Este trabajo ha constituido una de las lneas de investigacin del
Grupo de Qumica Analtica Enolgica y de los Alimentos de la
UniversidadRoviraiVirgili.Todoslosresultadosquesepresentan
en esta memoria son fruto de los experimentos realizados en su
laboratoriodelaFacultaddeEnologadeTarragona.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Parece que por fin llega el final. No ha sido fcil, pero hubiera sido an ms difcil
sin todas aquellas personas que han estado a mi lado en algn momento de la
elaboracin de esta Tesis Doctoral, y a las que quiero agradecer que, de una manera u
otra, me hayan ayudado a seguir.

En primer lugar, gracias a la Dra. Olga Busto y a la Dra. Montserrat Mestres por su
confianza.

Olga, gracias por pensar en m y darme la oportunidad de empezar el doctorado.


Por tu seguridad absoluta desde el primer da en que todo esto terminara bien y por
animarme a conseguirlo. Montse, gracias por tu trabajo incansable, por tu dedicacin y
tu gua. Por empujarme cuando ms lo necesitaba, aunque no siempre supiera verlo.
Buena parte del xito de este trabajo te lo debo a ti.

Gracias tambin al Dr. Josep Guasch, por su sabidura y disponibilidad.

Gracias a la gente del laboratorio que ha compartido conmigo todos estos aos. A
Pili, por introducirme en el mundo de los aromas y por ser como es. A Susanna, por su
amistad incondicional desde el primer da y por todo lo que hemos vivido juntas. A
Luciano, por ser mi compaero y amigo, por las confidencias y las risas, y por
aguantarme da tras da. A Sandra F. y Sandra J., por los buenos momentos pasados.

Tambin me gustara dar las gracias al resto de miembros del Departamento de


Qumica Analtica y Qumica Orgnica que han estado dispuestos a escucharme y
ayudarme, aunque fuese oliendo vinagres! Gracias a Vanessa, Idoia, Antonio, Rafa, gor,
Irene, Cris F., Ricard Especialmente, gracias a Jaume y Santi. Por todo. No hace falta
que os diga nada ms.

Y gracias a Cris B. Por preocuparte por m, por animarme hasta el final, por estar
siempre ah. Por tus palabras de aliento y tu confianza. Gracias por ser mi amiga.

A Jess y Mari les estoy infinitamente agradecida por haberme acogido en su casa
sin conocerme, y por haberme hecho sentir parte de su familia desde el primer
momento. Nada hubiera sido igual sin vosotros. Quiz no hubiera llegado hasta aqu.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Gracias tambin a Antonio y Geles y a todos los dems por haberme hecho sentir
una ms de vosotros.

Gracias a Eva, Sonia y Pati, por haberme apoyado desde la distancia.

Y por ltimo, gracias a mi familia.

Pap, Angelines y Pul, gracias. Por haber cuidado de m y haberme ayudado a ser
quien soy. Por estar siempre a mi lado y por quererme. Por ser lo mejor que tengo.

Javier, gracias por haber estado conmigo cuando ms lo he necesitado. Gracias por
animarme, apoyarme y confiar en que todo esto saldra adelante. Gracias por tu
paciencia y tu buen humor, s que no siempre ha sido fcil.

Mam, gracias. Sin ti, nada habra sido posible.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Amipadre,amihermanoyaJavier.

Amimadre.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Quiendominalosolores,
dominaelcorazndeloshombres

PatrickSskind
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

NDICE


OBJETIVOS 1

CAPTULO1:Presentacin 5
Bibliografa 13

CAPTULO2:Elaroma 15
2.1. Lapercepcinsensorial 17
2.1.1. Anatomadelolfato 18
2.1.2. Fisiologadelolfato 20
2.1.3. Anatomadelgusto 22
2.1.4. Fisiologadelgusto 24
2.2. Elaroma 25
2.2.1. Clasificacindelosolores 26
2.2.2. Relacinestructuraolor 28
2.2.3. Dimensindelosolores 29
2.2.4. Valordearoma 31
2.2.5. Compuestosaromticosconcarcterimpacto(keyodorants) 32
2.2.6. Compuestosaromticosenlosalimentos 33
2.2.7. Oloresanmalos(offflavours) 35
2.3. Elanlisisdelaroma 36
2.3.1. Elanlisissensorial 37
2.3.1.1. Elpanelsensorial 37
2.3.1.2. Laspruebassensoriales 39
2.3.2. Elanlisisinstrumental 40
2.3.2.1. Lastcnicasdepretratamiento 40
2.3.2.2. Lacromatografadegases 48
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

2.3.2.3. Lanarizelectrnica 50
Bibliografa 52

CAPTULO3:Lacromatografadegasesolfatometra(GCO) 57
3.1. ElanlisisdelaromamedianteGCO 59
3.2. Lacromatografadegasesolfatometra 60
3.2.1. Lastcnicasolfatomtricas 63
3.2.2. LimitacionesdelaGCO 66
3.2.3. Obtencindeextractosaromticosrepresentativos 69
3.2.3.1. Microextraccinenfaseslida 70
3.2.3.2. ExtraccindirectacondisolventeHighVacuumTransfer 79
3.3. LaGCOenelanlisisdelaromadelosalimentos 88
3.3.1. Caracterizacindelaroma 89
3.3.2. Determinacindecompuestosimpacto 90
3.3.3. Determinacindeoffflavours 92
3.3.4. CorrelacinentrelaGCOyelanlisissensorialtradicional 93
3.3.5. Controldecalidad 94
Bibliografa 98
*Lacromatografadegasescondetectorolfatimtrico:unaherramienta 109
esencialparaelanlisisdelaromadebebidasalcohlicas

CAPTULO4:ElvinagredevinoconDOPVinagredeJerez 143
4.1. Elvinagre 145
4.1.1. Definicin 145
4.1.2. Tiposdevinagre 146
4.1.3. Mtodosdeelaboracindevinagredevino 147
4.1.3.1. Mtodosdeacetificacinconcultivosumergidoo 148
mtodosrpidos
4.1.3.2. Mtodosdeacetificacinconcultivosuperficialo 149
mtodoslentos
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

4.2. ElvinagredeJerez 151


4.3. ElaromadelvinagredeJerez 156
Bibliografa 159
*ChemicalcharacterizationofcomercialSherryvinegararomaby
headspacesolidphasemicroextractionandgaschromatography 163
olfactometry

CAPTULO5:Lospistachostostados 187
5.1. Losfrutossecos 189
5.1.1. Definicin 189
5.1.2. Tiposdefrutossecos 190
5.1.3. Procesadodelosfrutossecos 191
5.1.3.1. Recoleccin 192
5.1.3.2. Conservacin 193
5.1.3.3. Elaboracin 194
5.1.3.4. Envasado 195
5.1.4. Composicinqumica 196
5.1.5. Efectosfuncionalesdelosfrutossecos 197
5.2. Lospistachos 198
5.3. Elaromadelospistachostostados 199
Bibliografa 203
*Comparativestudyoftwoextractiontechniquestoobtain
representativearomaextractsforbeinganalysedbygas 209
chromatographyolfactometry:applicationtoroastedpistachios
*Determinationofroastedpistachios(PistaciaveraL.)keyodorantsby
headspacesolidphasemicroextractionandgaschromatography 231
olfactometry

CAPTULO6:Elaceitedeoliva 251
6.1. Elaceitedeoliva 253
6.1.1. Definicin 253
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

6.1.2. Tiposdeaceitedeoliva 254


6.1.3. Mtodosdeobtencindelaceitedeoliva 256
6.1.3.1. Obtencindelosaceitesdeolivavrgenes 257
6.1.3.2. Obtencindelaceitedeorujobruto 259
6.1.3.3. Obtencindelaceitedeolivaydelaceitedeorujo 259
refinados
6.1.3.4. Obtencindelaceitedeolivaydelaceitedeorujode 260
oliva
6.2. Elaceitedeolivavirgen 260
6.2.1. Composicinqumica 260
6.2.2. Criteriosdecalidad 263
6.2.2.1. Parmetrosqumicos 263
6.2.2.2. Evaluacinsensorial 265
6.2.3. Efectosfuncionalesdelaceitedeoliva 267
6.3. Elaromadelaceitedeolivavirgen 268
Bibliografa 271
*Evolutionofoliveoilaromaandoxidationstatusovertimeunder 275
differentatmospheres

CONCLUSIONES 299

CONTRIBUCIONESCIENTFICAS 305

UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

OBJETIVOS
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Objetivos 3

Elaromaquepresentaunalimentoesunodesusmsimportantesfactoresde
calidad. En la prctica totalidad de los casos, el olor que un producto alimenticio
emiteeselresponsabledirectodelabuenaomalaprimeraimpresinquecausaenel
consumidor.Inclusoenciertosalimentos,aqulloscuyoconsumoestestrechamente
ligadoalplacerqueproporcionasudegustacin,suinfluenciaesanmayor,debidoal
destacadopapelquedesempeanlaspropiedadesorganolpticas.

Actualmente, es fundamental conocer en profundidad todos los aspectos


relacionados con el aroma de los alimentos para garantizar una calidad ptima y
poderdesarrollarenelfuturoproductosanmejores,adecuadosalosgustosdelos
consumidoresaquienesvayadestinado.Porestemotivo,elanlisisdelacomposicin
aromtica de los alimentos constituye uno de los principales retos de la industria e
investigacinalimentarias.

El aroma est constituido por numerosos compuestos voltiles, y dada la


complejidaddelasmatricesalimenticiasylaspeculiaridadesdelosanalitosaestudiar,
lacromatografadegases semuestracomolatcnicadeanlisismsadecuada.Sin
embargo,slounapartedeestosvoltilespresentanoloryrealmentecontribuyenal
aroma, al mismo tiempo que la valoracin de las cualidades aromticas tan solo
puede realizarse empleando la nariz humana. De ah que sea la cromatografa de
gasescondeteccinolfatomtricalanicatcnicaquepermitellevarloacabo.

A partir de estas premisas, los objetivos que se propone abordar esta tesis
doctoralsonlossiguientes:

1. Caracterizar el aroma de tres alimentos distintos (el vinagre de vino, los


pistachos tostados y el aceite de oliva) mediante el empleo de la
cromatografadegasesolfatometra.

2. Comprobar la eficacia de dos tcnicas de extraccin y concentracin de


voltiles (la microextraccin en fase slida sobre el espacio de cabeza y la
extraccin directa con disolventes seguida de highvacuum transfer) en la
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
4 Objetivos

obtencin de extractos aromticos representativos de los alimentos


estudiados, aptos para el anlisis mediante la cromatografa de gases
olfatometra.

3.Comprobarlautilidaddelacromatografadegasesolfatometracomotcnica
paraevaluarlaevolucindelacalidadsensorialdelosalimentos.


UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 1
Presentacin
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Presentacin 7

Elolfatoeselprimerodeloscincosentidosqueelserhumanodesarrollaenel
senomaterno.Dehecho,lasestructurasquedanlugaralsistemaolfativocomienzan
a formarse ya al final del primer mes de gestacin. Tambin es el sentido ms
evolucionado en el momento del nacimiento [1]. Sin embargo, a medida que
crecemos y que nuestros otros sentidos se perfeccionan, estos ltimos ganan en
importancia, relegando al olfato a un segundo plano. De la misma manera, nuestro
olfato tambinha idoperdiendo funcionesy capacidades en comparacin con elde
losdemsmamferosalolargodelaevolucinhumana:yanoesindispensablepara
nuestrasupervivencia,noesesencialparapreservarnuestroorganismonilaespecie.

La sociedad actual en la que vivimos ha sustituido parte de la informacin que


nuestros antepasados reciban gracias al olfato por otro tipo de informacin,
percibidaatravsdelrestodelossentidos.Ahorayanoexistendepredadoresdelos
quehayaquehuiraldetectarsupresenciaporelolorqueemiten.Comotampocoes
necesarioolerlosalimentosparacomprobarsusalubridad,valornutricionalycalidad
organolptica,sinoque,enlamayoradeloscasos,essuficienteconleerlasetiquetas
quelosacompaan[2].

Peroanhoyenda,elolfatosiguesiendoimportante,fundamentalenalgunos
aspectos de nuestra vida. Es el nico sentido capaz de modificar nuestro
comportamiento, de alterar nuestro estado de nimo o de provocar reacciones
fisiolgicasinmediatasennuestroorganismodeformadirecta.Adems,seencuentra
estrechamente relacionado con las zonas cerebrales que controlan y regulan la
memoria y las emociones, por lo que permite traer a nuestra mente recuerdos y
sensacionesinstantneaeincontroladamentealdetectarundeterminadoolor.Ysin
l,lacomidanotieneningnsabor.

Portodoello,noesdeextraarqueelolorquepresentaunalimentoconstituya
unfactordecalidadbsico.Deldependeengranmedidalaaceptacinoelrechazo
delproductoporpartedelconsumidor. Enconsecuencia,sienunfuturosequieren
mejorar los productos alimenticios para ofertar otros de mayor calidad,
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
8 Captulo1

organolpticamentebuenos,yquesatisfaganlasdemandasdelosconsumidores,se
requierenestudiosenprofundidadsobreelaromadeestosalimentos:quodorantes
lo constituyen y qu notas aromticas proporcionan, cul es su procedencia y
evolucinalolargodelavidatildelproducto,enquconcentracionesapareceny
cmo interaccionan con el resto de componentes, etc. Adems, existen distintos
alimentos que se consumen, no por su aporte nutritivo, sino por el placer que
proporcionasudegustacin,comoocurre,porejemplo,conelvino.Enestoscasos,las
propiedades organolpticas de los productos, entre las que se encuentra el aroma,
jueganunpapelesencial.

Peroanalizarelaromanoesunatareasencilla.Loconstituyencentenaresde
compuestos voltiles, cada uno con unas propiedades qumicas y aromticas
diferentes,ademsdepresentarencadacasounacontribucinalaromaespecficay
distinta.Ynosedebeolvidarelampliorangodeconcentracionesenlasqueaparecen
yqueesnecesarioconsiderar,nitampocoelefectodelamatrizdelalimentoquelos
contiene. Sin embargo, existen diversas tcnicas analticas que, aunque con
limitaciones, son capaces de proporcionar informacin muy til y valiosa acerca del
aroma.

Las tcnicas cromatogrficas, y ms concretamente, la cromatografa de gases,


son las ms adecuadas cuando se pretende estudiar la fraccin aromtica de un
producto. Gracias a ellas es posible averiguar qu compuestos qumicos integran
dicha fraccin y en qu concentraciones. Y, de entre todas las tcnicas
cromatogrficas, hay que destacar la cromatografa de gases con deteccin
olfatomtrica (GCO), en la que se emplea la nariz humana como detector
cromatogrfico en paralelo con otro detector [3]. De esta manera se combinan
respuestainstrumentalysensorial,loquepermiteidentificarloscompuestosvoltiles
que presentan olor de entre la totalidad de la fraccin voltil de una muestra.
Adems, a lo largo de los aos se han desarrollado diferentes metodologas con el
objetivodeevaluarlacontribucindecadaodoranteenelaromaglobaldelproducto
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Presentacin 9

estudiado,lasdenominadastcnicasolfatomtricas.TodoelloconviertealaGCOen
unaherramientaimprescindibleenelestudiodelaroma.

Sin embargo, es necesario obtener un extracto aromtico representativo del


producto a analizar antes de llevar a cabo el anlisis cromatogrfico. El
pretratamiento de las muestras es un paso crtico en toda investigacin aromtica,
porloquesuponeunimportanteretoparaquienessededicanaella.Alolargodelos
ltimos aos se han producido mejoras en los mtodos clsicos de extraccin y
concentracin y han aparecido nuevas tcnicas de pretratamiento. Pero, a pesar de
estos avances, todava no existe un nico mtodo ideal para la obtencin de un
extractoaromticorepresentativo,seacualsealamuestraquesequieraanalizarola
finalidadquesepersiga.

El grupo de Qumica Analtica Enolgica y de los Alimentos de la Universidad


Rovira i Virgili (URV), donde se ha desarrollado esta tesis doctoral, ha trabajado en
variaslneasdeinvestigacindedicadasalestudiodelaromadelvinodesdedistintos
puntosdevista.As,sibienensusinicioselobjetivosecentrenelanlisisqumico
dediversasfamiliasdecompuestosconunaimportantecontribucinasuaroma[4
6], a lo largo del tiempo el objetivo se concret en el estudio y caracterizacin del
aromadelvinodedistintasvariedades[7],graciasalaaplicacindelaGCO,conmuy
buenos resultados. Por ese motivo, cuando se plante el desarrollo de la presente
tesis doctoral, se crey interesante ampliar el anlisis del aroma a otros productos
alimenticios, pero siempre mediante el uso de la GCO. Inicialmente, el trabajo de
investigacin se dirigi hacia el estudio del aroma del vinagre de vino, dada su
vinculacin con el vino. Posteriormente, y debido al inters mostrado por algunas
empresasdelsectoralimentario,losestudiosseextendieronaotrosproductos,como
lospistachostostadosyelaceitedeolivavirgen.

Lamemoriadeestatesisdoctoralestestructuradadeformaqueenellasehan
incluido los artculos derivados de la experimentacin realizada. Cada captulo, a
excepcindelcaptulo2,presentaunaprimerapartedondeseintroduceydetallael
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
10 Captulo1

temaatratar.Acontinuacinseexponenlaspublicacionesalasquehadadolugarla
investigacin.Encuantoalamemoriaengeneral,estdivididaendospartes.

Laprimeraparte,queenglobaloscaptulos2y3,estenfocadaaproporcionar
unavisingeneraldelaromaydelatcnicacromatogrficaempleadaensuanlisis.
Enelcaptulo2sedescribecmoseproducelapercepcinsensorialdelaromaenlos
sereshumanos,ascomolosaspectosquelodefinenyquehayquetenerencuenta
cuando se trabaja con l. Asimismo, se hace referencia a las distintas formas de
analizarlo con las que se cuenta actualmente. El captulo 3 se centra en la
cromatografa de gasesolfatometra, sus caractersticas y aplicaciones en el anlisis
del aroma de los alimentos. En l tambin se detallan las dos tcnicas de
pretratamiento de muestra que se han utilizado durante el desarrollo del trabajo
experimental.

Lasegundaparteincluyeloscaptulos4,5y6,cadaunodeellosdedicadoauno
delosproductosalimenticiosestudiados[810].Elcaptulo4tratasobreelaromadel
vinagredevinocomercialelaboradobajolaDenominacindeOrigenProtegida(DOP)
VinagredeJerez.Enelartculoqueseadjuntaalfinaldelmismoyqueestenviado
para su publicacin, se caracterizan y cuantifican los compuestos implicados en el
aroma de este tipo de vinagre, los cuales se extraen y concentran mediante la
microextraccin en fase slida sobre el espacio de cabeza (HSSPME). Tambin se
determinan los umbrales de percepcin para estos odorantes en una matriz
hidroactica, similar a la del vinagre. De esta manera se establece una primera
aproximacinalaimportanciasensorialquepresentacadaunodeestoscompuestos
enelaromadelproductofinal.

Enelcaptulo5,cuyoobjetodeestudioeselaromadelospistachostostados,se
incluyen dos artculos, uno ya publicado y otro, aceptado para su publicacin en el
momento de redactar esta memoria. En el primero de ellos se realiza un estudio
comparativodedostcnicasdeextraccinyconcentracindevoltiles:laHSSPMEy
la extraccin directa con disolventes (DSE) seguida de highvacuum transfer (HVT).
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Presentacin 11

Ambas tcnicas se aplican sobre la misma variedad de pistachos tostados, y los


extractosobtenidosseanalizanmedianteGCO.Aunquelasdostcnicasproporcionan
resultadossimilaresydemuestransereficacesextrayendolosodorantesdeestetipo
de frutos secos, la SPME, que es ms rpida y limpia, permite detectar un mayor
nmero de regiones aromticamente activas. Adems, estas regiones se perciben
hasta factores de dilucin ms altos. Por ese motivo, para la siguiente parte del
estudiosedecidiutilizarlaSPMEcomotcnicadeextraccinyconcentracin.

En el artculo derivado de esta segunda fase de la investigacin se caracterizan


loscompuestosresponsablesdelaromadedosvariedadesdistintasdepistachos.La
tcnicaolfatomtricadedilucinempleada,elAEDA(AromaExtractDilutionAnalysis)
permite una primera jerarquizacin de los odorantes. La comparacin de los
resultadosolfatomtricosobtenidosparacadavariedaddemuestraqueunadeellas
tiene un perfil aromtico ms rico que la otra, resultados que corrobora el anlisis
sensorialdescriptivoquesellevaacabo.

Por ltimo, el captulo 6 de la memoria se centra en el anlisis de la evolucin


natural del aroma del aceite de oliva virgen embotellado bajo tres atmsferas
diferentes: aire, nitrgeno y argn. El periodo de tiempo elegido (un ao)
correspondeconlavidatilhabitualdelaceite.Paralograrunaoxidacinnatural,no
seaplicanaltastemperaturasnisemodificanlascondicionesdealmacenamiento,de
manera que stas coinciden con las que usualmente soporta el producto que se
consume en los hogares. Adems del anlisis olfatomtrico del aroma del aceite,
tambin se hace un seguimiento de su oxidacin mediante la determinacin de
ciertos parmetros que establece la actual legislacin. Gracias a este estudio se ha
podidoconcluirqueelaceitedeolivavirgenembotelladoconairepierdepartedesu
calidad organolptica antes que el aceite embotellado bajo algn tipo de atmsfera
protectora, aunque era algo previsible. Sin embargo, lo que se ha demostrado al
aplicar la GCO en el anlisis del aroma del aceite es que la prdida de calidad en
realidad se produce antes de lo que indican los parmetros qumicos. Esto viene a
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
12 Captulo1

corroborarlamayorsensibilidaddelanlisissensorial.Elartculoenelqueseexplica
todalainvestigacinestenviadoparasupublicacin.

Finalmente, en las ltimas pginas se recogen las conclusiones fruto de los


resultados obtenidos a lo largo de toda la experimentacin. En ellas se plantean
nuevascuestionesquepodranserelorigendefuturostrabajosdeinvestigacinenel
campodelanlisisdelaromadelosalimentos.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Presentacin 13

BIBLIOGRAFA
[1] Fisher,C.,Scott,T.R.Flavoresdelosalimentos.Biologayqumica.Zaragoza:Acribia,S.
A.;1997.
[2] Holley,A.Elcerebrogoloso.1edicin.Barcelona:RubesEditorial,S.L.;2006.
[3] Mayol,A.R.,Acree,T.E.Advancesingaschromatographyolfactometry.En:Leland,J.V.,
Schieberle,P.,Buettner,A.,Acree,T.E.,editors.Gaschromatographyolfactometry.The
stateoftheart.Washington:AmericanChemicalSociety;2001,p.110.
[4] Mestres, M., Sala, C., Mart, M. P., Busto, O., Guasch, J. Headspace solidphase
microextractionofsulphidesanddisulphidesusingCarboxenpolydimethylsiloxanefibers
intheanalysisofwinearoma.J.Chromatogr.A1999;835:137144.
[5] Sala, C., Mestres, M., Mart, M. P., Busto, O., Guasch, J. Headspace solidphase
microextraction analysis of 3alkyl2methoxypyrazines in wines. J. Chromatogr. A 2002;
953:16.
[6] Riu, M., Mestres, M., Busto, O., Guasch, J. Comparative study of two chromatographic
methodsforquantifying2,4,6trichloranisoleinwines.J.Chromatogr.A2007;1138:18
25.
[7] Mart, M. P., Mestres, M., Busto, O., Guasch, J. Solidphase microextraction and gas
chromatography olfactometry analysis of successively diluted samples. A new approach
of the aroma extract dilution analysis applied to the characterization of wine aroma. J.
Agric.FoodChem.2003;51:78617865.
[8] Llaguno,C.,Polo,M.C.,coordinadoras.Elvinagredevino.Madrid:ConsejoSuperiorde
InvestigacionesCientficas;1991.
[9] SalasSalvad, J., Ros Rahola, E., Sabat Casellas, J. Frutos secos, salud y cultura
mediterrneas.Barcelona:EditorialGlosa,S.L.;2005.
[10] MataixVerd,J.,BarbanchoCisneros,F.J.Elaceitedeolive,almadelmediterrneo.Jan:
Instituto de Estudios Giennenses (Diputacin de Jan), Universidad de Jan (Servicio de
Publicaciones);2008.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 2
El aroma
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 17

2.1.LAPERCEPCINSENSORIAL

Gracias a los sentidos percibimos el mundo que nos rodea. La vista, el odo, el
tacto,elgustoyelolfatonospermitenrecibir,seleccionar,organizareinterpretarla
informacin que produce nuestro entorno y que nos llega a travs de distintos
estmulos.

Los sentidos del olfato y el gusto constituyen los denominados sentidos


qumicos, ya que resultan de la interaccin directa de ciertos compuestos qumicos
connuestrossistemasreceptoresperifricos:elepitelioolfatoriolocalizadoenlanariz
y los botones gustativos que se encuentran en la lengua [1]. Ambos son los ms
primitivos de nuestros sistemas sensoriales, con una historia evolutiva de 500
millones de aos, y directamente relacionados con las necesidades bsicas del ser
humano: la alimentacin y la deteccin de peligros, cuyo objetivo es preservar el
organismo, y la reproduccin, encaminada a preservar la especie [24], funciones
controladasporlareginmsprimitivadenuestrocerebro,aqullaquecompartimos
conlosreptilesyquesedenominacerebroreptiliano.Enelcasodelolfato,stefue
elnicosentidoquequeddirectamenteconectadoconlasiguientefaseevolutivade
nuestrocerebro,laqueempezaregularlasemociones,elaprendizajeylamemoria,
yquesehadadoenllamarcerebroemocionalosistemalmbico,ygraciasalacual
generamos los mecanismos de identificacin. Posteriormente, los humanos
desarrollamos un nuevo estrato cerebral, capaz de interactuar con las partes
emocionalesydeintegraryprocesarloregistradoporlossentidos[5].

As,elolfatoestligadoalapartedenuestrocerebroquecontrolalamemoriay
las emociones, de forma que, frecuentemente, memoria, emocin y olor se
encuentran interrelacionados [3, 6]. Esto hace que, al percibir un determinado
estmulo oloroso, nuestra mente se traslade a aquella situacin que nosotros
asociamos con l, de manera que somos capaces de sentir lo que sentiramos si
realmentenosencontrsemosendichocontexto.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
18 Captulo2

Por su parte, el sentido del gusto est ntimamente relacionado con las
consecuenciasinternasdeladigestin,siendoelresponsable,yadesdelainfancia,de
nuestras preferencias por los sabores asociados a la nutricin y de nuestro rechazo
visceralaaquellossaboresquenoshayanprovocadonuseasenalgunaocasin[2].

Finalmente, los sentidos del olfato y el gusto se encuentran estrechamente


conectados entre s, llegndose a confundir en ocasiones cul de ellos recibe
realmente el estmulo qumico que los desencadena. Ambos sentidos intervienen
conjuntamente en la apreciacin global de los alimentos y en la evaluacin de su
calidad,actuandodemaneradecisivaenlaeleccinquehaceelconsumidor.

2.1.1.Anatomadelolfato

Elsistemaolfatoriodelserhumanoestcompuestoportresregionesclaramente
diferenciadas: la cavidad nasal, donde se localiza el epitelio olfatorio con sus
correspondientesreceptoresolfatorios,elbulboolfatorioylacortezaolfatoria[13,7]
(Figura2.1).
Corteza
Bulbo olfatoria
olfatorio

Cavidad
nasal

Epitelio
olfatorio

Aberturas
nasales


Figura2.1.Esquemadelsistemaolfatoriohumano

El epitelio olfatorio se sita a lo largo de la parte superior de la cavidad nasal,


est cubierto por la denominada mucosa olfatoria y constituye el tejido receptor
donde se fijan las molculas que presentan olor. En l encontramos tres tipos de
clulas:lasreceptoras,lasdesostnylasbasales(Figura2.2).
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 19

Seestimaqueexistenunos6millonesdeclulasreceptorasencadafosanasal
humana, con una vida media de entre uno y dos meses [8]. Estas neuronas
receptoras, aunque pequeas, presentan largas dendritas que consiguen contactar
conelexterior,dondeformanunosbotones.Deestosbotonessalennumerososcilios,
loscualessedispersanporlacaramsexternadeltejidoreceptor,ycuyasuperficie
est sembrada de partculas que se consideran realmente los receptores donde se
fijanlosodorantes.Porotrolado,desdelacarabasaldelasclulasreceptorasparten
los axones, los cuales se agrupan en haces al abandonar el epitelio olfatorio,
unindoseparaformarnerviosquesedistribuyenporlasuperficiedelbulboolfatorio.

Hacesdeaxones

Clula
receptora
Clula
basal

Clulade
sostn

Dendrita

Cilios
Microvellosidades

Figura2.2.Clulasdelepitelioolfatoriohumano

Las clulas de sostn o sustentaculares son las mayoritarias en el epitelio


olfatorio, ocupando casi un tercio del mismo. Se encargan de separar las clulas
receptoras entre s y de regular la microcomposicin de la mucosa, as como de
desactivar odorantes y de proteger al epitelio de los agentes externos. Aunque no
tienen cilios, s presentan numerosas microvellosidades que se sumergen en la
mucosa.Porsuparte,lasclulasbasalessonlasquedanlugaralosotrosdostiposde
clulascuandoelepitelioolfatoriosedaa.

El bulbo olfatorio es una proyeccin frontal del cerebro que constituye un


complejo centro neuronal donde las seales sensoriales se filtran y modifican. En l
actancincotiposdistintosdeneuronas:dosdeellas(lasclulasmitralesylasclulas
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
20 Captulo2

en penacho) reciben informacin del epitelio que luego envan hacia la corteza,
mientrasquelasotrastresmedianeninteraccioneslocales.Enelbulboconvergenlos
nervios procedentes del epitelio olfatorio, los cuales terminan en los denominados
glomrulos donde se producen las principales interacciones entre esos nervios y las
clulas mitrales y en penacho, y la modulacin de dichas interacciones mediante
complejoscircuitoslocales(Figura2.3)[7,9].

Nervio
olfatorio BULBOOLFATORIO
Tractoolfatorio Clulamitral
lateral

Filamentosnerviosos

Axones
Glomrulo
Neuronaolfatoria
receptora EPITELIO
OLFATORIO
Cilios

Mucosa

AIREYMOLCULASOLOROSAS

Figura2.3.Anatomadelepitelio,elbulboyeltractoolfatoriosenelserhumano

A continuacin, los axones de las neuronas de proyeccin del bulbo forman el


tractoolfatoriolateral,elcualconectadirectamenteconlasdistintasestructurasdela
corteza olfatoria primaria (el ncleo olfatorio anterior, la corteza piriforme, el
tubrculo olfatorio, la amgdala y el crtex entorrinal temporal). Estas estructuras
estnrelacionadasentres yconotraspartescerebrales,entrelas queseincluyeel
hipocampo,quejuegaunpapelimportanteenlaformacindenuevosrecuerdosyen
lapercepcinespacial.

2.1.2.Fisiologadelolfato

Elprocesoporelcualunestmuloqumico(unodoranteomolculaolorosa)se
convierte en una seal elctrica que se transmite al cerebro tiene lugar en la
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 21

superficie de los cilios del epitelio olfatorio [7, 9, 10]. Es lo que se conoce como
transduccin.

Para que la cascada de actividad enzimtica que constituye la transduccin se


desencadene, primero es necesario que los odorantes atraviesen la cavidad nasal y
alcancen la mucosa olfatoria, de ah que la mayora sean partculas voltiles e
hidrofbicas.Acontinuacin,unavezquelleganadichamucosa,debendisolverseen
elmucusyatravesarloparaaccederalasuperficiedeloscilios.

De acuerdo con la Figura 2.4, en las membranas de estos cilios encontramos


distintas protenas receptoras (R) a las cuales se fijan las molculas olorosas, lo que
activalasprotenasfijadorasdeguanidntrifosfato(GTP)(representadaseneldibujo
porlaletra,aunquelasespecficasdelsistemaolfatoriosedenominanGolf),que
actancomomediadorasenlaactivacindelaadenilatociclasa(AC)ycuyafuncines
amplificar los efectos de la transduccin. El acoplamiento de una nica molcula
olorosaalosreceptoresactivacientosdeprotenasGolf,lascuales,alunirsealaAC,
permiten la reduccin del adenosn trifosfato (ATP) a adenosn 3, 5monofostato
cclico(cAMP,eningls).

Canalprotenico
ODORANTE mucosa
Ca2+ olfatoria
Na+

Membrana
R celular

AC


interiorde
GTP ATP CaBP laclula
GDP cAMP
Protena
receptora

Figura2.4.Esquemadelprocesodetransduccinmediadoporsegundomensajeroenlosciliosde
lasclulasreceptorasolfatorias

Las molculas de cAMP actan directamente sobre la membrana celular


cambiando la estructura de los canales protenicos, de manera que los cationes de
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
22 Captulo2

sodioycalcio(Na+,Ca2+)puedenpasardelamucosaolfatoriaalinteriordelaclula.
Comoresultado,segeneraunpotencialdemembrananegativoquetiendeamoverse
hacia valores ms positivos, lo que crea los potenciales de accin, los cuales son
conducidoshastaelcerebroatravsdelosaxonesdelasclulasreceptoras.

Todo este proceso se conoce como sistema de segundo mensajero, donde el


cAMPeselsegundomensajeroylasGolfylaACsonlosintermediariosquepermiten
suaccin[2].Estesistemahasidoestudiadoyanalizadoenprofundidad,aligualque
lafamiliadegenesquecodificalosreceptoresolfatorios,ycuyaimportanciacientfica
estal,quelosinvestigadoresqueen1991descubrieronlaexistenciadedichosgenes,
LindaBuckyRichardAxel[11],fuerongalardonadosen2004conelNobeldemedicina
porello.

Encuantoalacapacidadolfativa,sonmuchoslosfactoresqueinfluyenenella:el
gnero,laedad,lacontaminacin,elhechodeserfumador,elestadoreproductivo,
etc., e incluso se estn llevando a cabo estudios en los que se relacionan algunas
enfermedadesdegenerativas,comoelAlzheimeryelParkinson,conundescensode
lafuncinolfativa[3].Dentrodeestembitotambinmerecenunamencinespecial
lasdenominadasanosmias,lascualesimplicanlaincapacidaddealgunosindividuos
para detectar ciertos odorantes o familias de olores, aunque no hayan perdido en
modoalgunosucapacidadolfativa.

2.1.3.Anatomadelgusto

Enelsistemaolfatorio,lainformacinllegaalcerebrodesdelapartefrontaldel
mismoydemaneraaislada,mientrasquelainformacinqueproporcionaelsistema
gustativo llega al cerebro desde su parte posterior y, adems, acompaada por
sensacionestctiles.

Enelserhumano,elsistemagustativoestlocalizadofundamentalmenteenla
lengua,dondesusreceptoresseagrupanenbotonesgustativos,estructurasenforma
de copa situadas en pequeas elevaciones de la lengua denominadas papilas.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 23


Cadabotngustativoestconstituido
Clulas Microvellosidades
por cuatro tipos distintos de clulas: las epiteliales

clulasbasales(quegeneranlasneuronas
receptoras),lasclulasoscuras(tipoI),las
intermediasylasclaras(tipoII).Estastres Clula
receptora

ltimassonclulasreceptorasendistintos
grados de desarrollo [2, 7] (Figura 2.5),
Clulas
queseextiendendesdelabasedelbotn Fibras basales
gustativas
aferentes
hasta la superficie de la lengua, donde
proyectanfinasmicrovellosidadesatravs
Figura2.5.Cortetransversaldeunbotn
del poro gustativo para explorar el gustativo

ambiente.

Aunqueexistenbotonesenelpaladarblando,lalaringe,lafaringeylaepiglotis,
lamayoraseencuentranenlalengua,agrupadosenpapilas,lascualessedividenen
trestipos(Figura2.6):

Papilacircunvalada
laspapilascircunvaladas,situadasenla
Botones
gustativos parteposteriordelalengua;

las papilas foliadas, localizadas a lo


Papilafoliada
largo de los bordes laterales de la
lengua en forma de cinco o seis
Papilafungiforme pliegues verticales en la superficie del
epitelio;

y las papilas fungiformes, que cubren
Figura2.6.Distribucinytiposdepapilas
gustativas losdosterciosanterioresdelalengua.

Mediantelasfibrasgustativasaferentes(Figura2.5),lainformacinrecogidapor
las clulas receptoras es enviada a travs de distintos nervios hasta el denominado
ncleo del tracto solitario (NTS), donde tambin llega informacin procedente del
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
24 Captulo2

sistemadigestivo.Mientrasqueunpequeoporcentajedelasclulasgustativas del
NTSseproyectahaciareassuperioresdelcerebro,elrestoformaconexionesdentro
delNTS,pasandoacontrolarlosreflejosfijosyprimitivosdeaceptacinyrechazode
la comida o activando reflejos pancreticos y gastrointestinales. Otras fibras se
proyectan hacia la parte delantera del cerebro, llegando a distintas zonas de la
cortezagustativa,entrelasqueseencuentralaamgdala,lacualestrelacionadacon
elhipocampo,comoyasehamencionadoenelsistemaolfatorio.

Deestamanera,elgusto,ademsdedeterminarqusustanciasseingieren,es
capazdecomunicardimensioneshednicas,deactivarprocesosdigestivosydeinfluir
enlosaspectosmotivacionalesdelaalimentacin.

2.1.4.Fisiologadelgusto

Al contrario de lo que ocurre en el olfato, los estmulos gustativos son


principalmentesolublesen aguaynovoltiles,demaneraqueseliberandurantela
masticacin, llegando a los receptores a travs de la saliva. Estos receptores
gustativos se encuentran en las microvellosidades de las clulas receptoras de la
lenguaenformadecanalesdeionesodeprotenasreceptorasespecializadas[2,7],y
lainteraccindelassustanciasspidasconellosprovocacambiosenlaconductancia
de la membrana y una despolarizacin celular. Esta despolarizacin es transmitida
pasivamentedesdelazonasuperiorhastalainferiordelaclulagustativa,dondesta
iniciaunpotencialdeaccinenelnervio,queserloqueproducirlapercepcin.

Los procesos de recepcin y transduccin en el sentido del gusto varan en


funcindelamolculaqueproduceelestmulo,deformaquelosestmulossaladoy
cido interactan directamente con los canales inicos de las microvellosidades. Sin
embargo, el estmulo dulce, los compuestos amargos y los aminocidos (que
proporcionan estmulos dulces, amargos y umami) requieren protenas receptoras
especficas.EnestesegundocasoseempleanprotenasfijadorasdeGTPysegundos
mensajeros,comoenelolfato[2,7,12,13].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 25

Tradicionalmente se ha credo que cada uno de los cincos sabores bsicos que
existen (dulce, salado, cido, amargo y umami) nicamente poda percibirse en un
reaespecficadelalengua[14].Enrealidad,loshumanospodemospercibircualquier
sabor en cualquier rea de la lengua que presente papilas. nicamente vara la
intensidaddelsaborsegnlareginlingualyeltipodepapilaqueexistaenella[7,12,
13](Figura2.7).

Deestamanera,eldulcesepercibemejorenla
puntadelalenguamientrasqueelamargolohace
en la parte posterior, el umami, en la central y el
cido y el salado en los laterales posteriores y
delanterosdelalengua,respectivamente.

Figura2.7.Distintaszonaslinguales

2.2.ELAROMA

Cuandosepierdeelolfatotrasuntraumatismocranealoporunaafeccindelas
vasrespiratorias,losalimentosdejandetenersabor.staeslaevidenciamsclarade
que los sentidos del olfato y el gusto estn ntimamente relacionados, tanto, que a
vecesresultadifcilsaberquinrecibeelestmulocuandoseingiereunalimento.Yes
que los alimentos tienen olor, que percibimos cuando los vapores aromticos que
emiten se introducen por las fosas nasales al acercrnoslos a la boca (va nasal
directa). Pero, una vez en la cavidad bucal, dichos alimentos presentan ms olor si
cabe, ya que la masticacin libera muchas molculas voltiles, las cuales van por
detrs de la boca hasta llegar a la cavidad nasal (va retronasal). A menudo, al olor
generadoporestasmolculasquelleganhastalamucosaolfativa,acontracorriente
delaireinhaladodurantelarespiracin,seledenominaaroma[7].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
26 Captulo2

Enrealidad,cuandoseingiereunalimento,lasinteraccionesdelmismoconlos
receptores del olfato y del gusto, junto con la textura que presenta, producen una
sensacinconjuntayglobalquesehavenidoadefinirconlapalabraflavor[15].De
estamanera,elflavorsedebeatressensaciones:

lasgustativas,que,comosehavistoenelapartado2.1.4,soncinco(salada,
dulce,cida,amargayumami)ysepercibenenlaboca;

lasolfativas,que,adiferenciadelasanteriores,soninfinitamentevariadasy
complejas, percibindose en la nariz en concentraciones extremadamente
bajas[10](tradicionalmentesehamanejadolacifrade10.000oloresqueel
serhumanoescapazdedistinguir[16]);

ylastrigeminales,queseproducenporlaaccindebebidasyalimentosen
las terminaciones del nervio craneal nmero 5, el nervio trigmino,
relacionadotantoconlanarizcomoconlabocaycuyosreceptorestctiles,
deldolorydelatemperaturarecibenlassensacionesdepicor,astringenciay
fro[7,9].

De este modo, el flavor de un alimento constituye una de las principales


propiedades sensoriales que los consumidores valoran a la hora de seleccionar,
aceptar/rechazar e ingerir un producto, ya que los sentidos que nos permiten
percibirlo estn estrechamente relacionados con nuestro sistema digestivo y los
centrosneuronalesdelosrecuerdosylasemociones.

2.2.1.Clasificacindelosolores

As como existe un nmero limitado de sabores, la diversidad de olores es


enorme, de ah la complejidad a la hora de clasificarlos. A esto se le une el que no
contemoscon un lenguajeverbal bien codificado, porque, aunque hay palabras que
definenlosoloresconsideradosbsicos(mentolado,floral,ptrido,etc.),enrealidad,
stas son muy pocas. La mayora de las veces es necesario recurrir a cualidades de
otros mbitos, como el origen, la sensacin que se produce en otros sentidos y/o
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 27

cualquier otro criterio cultural (verde, fresco, dulce, etc.), para describir los olores
percibidos.

Estasdificultades,sinembargo,nohanimpedidoquesehayaintentadoclasificar
los olores. Ya en el siglo XVIII, Linneo estableca 7 categoras para ellos: aromticos
(los del laurel), fragantes (de la tila, el lis y el jazmn), ambrosianos (del mbar y el
almizcle), aliceos(delajo), caprlicosu olor de macho cabro(losolores de algunos
cidosgrasosdecadenacorta),narcticos(delassolanceas)yftidos(delasplantas
ptridas) [7]. Y stas inspiraron en el siglo siguiente a H. Zwaardemaker [17] para
proponerunanuevalistaconnuevecategoras: laspreviamentedescritasmslade
losoloresetreos(delasfrutasmuymaduras)ylosempireumticos(delcafyelpan
tostados,yeltabaco).

Perocuandosetratadeclasificarolores,quizseamstilemplearlateorade
losprototipos,desarrolladaporEleanorRosch[18].Segnestateora,lascategoras
seconstruyenalrededordeunejemplarconsideradocomoelmejorrepresentantede
dicha categora y denominado prototipo. El resto de ejemplares se distribuyen
alrededordelprototiposegnsugradodesemejanzaconl,yelconjuntopresenta
unparecidodefamilia.Deestamanera,elaromademanzanarepresentaraunnivel
base,porelencimadelcualestaraelnivelsuperiordearomadefrutay,enunnivel
subordinado,elolordelamanzanagolden[7].

De todos modos existen sectores en los que el aroma juega un papel


fundamental y donde se han conseguido establecer clasificaciones y terminologas
adecuadas y especficas para facilitar la comunicacin entre los profesionales que
trabajan en ellos. Es el caso de la Rueda de los Gustos de la Cerveza, creada en la
dcadadelos70porMortenMeilgaard[19]yenlaqueseutilizancatorcecategoras
ycuarentaycuatrotrminossensorialesparadescribireloloryelsabordecualquier
estilodecerveza.OeldelaRuedadelosAromasdelVino,creadaen1984porAnnC.
Noble y sus colaboradores [20] y modificada y ampliada en 1987 [21], la cual est
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
28 Captulo2

inspiradaenlaruedadelacerveza,yenlaqueaparecendocecategorasynoventay
cuatrodescriptores(Figura2.8).

Figura2.8.RuedadelosAromasdelVino:descriptoressensorialesutilizadosparaelvino[21]

Dado que las ruedas de los olores organizan los olores especficos de los
productosutilizandounaspocascategorasfcilmentereconocibles,enlaactualidad
existenruedasdeoloresysaboresdeprcticamentecualquierproducto:elchocolate
suizo,elbrandisudafricano,elqueso,lamielmonofloral,etc.[16].

2.2.2.Relacinestructuraolor

Comoyasehaexplicadoenelapartado2.1.3,paraqueseproduzcalaactivacin
de la cascada enzimtica que origina el que nuestro cerebro perciba un estmulo
qumico como un olor, es necesario que la molcula olorosa se fije a una protena
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 29

receptora. Cada ser humano tiene un elevado nmero de receptores olfativos


sumamente diversos. Sin embargo, nuestro sistema olfatorio presenta un amplio
poderdediscriminacin:escapazdedetectaruninmensoespectro deodorantes,y
ellograciasalaselectividaddesusreceptores[7].

Estaselectividadsetraduceenquelasmolculasolorosasno slodebentener
ungrupoosmforo(ungrupofuncionalactivo),sinoqueademsdebenpresentaruna
geometra adecuada que permita activar un receptor si encuentra en l una regin
con la que intercambiar enlaces de baja energa. De esta manera, estudios con
compuestos alifticos de distintas longitudes de cadena han demostrado que la
discriminacindelauninligandoreceptorestanbuena,queunsoloreceptorllegaa
distinguirentrecompuestosqumicosquesediferenciannicamenteenuntomode
carbono en la longitud de la cadena aliftica, o entre compuestos que presentan la
mismacadena,peroquesediferencianenelgrupofuncional[10,15,22].

Por este motivo, dos molculas enantiomricas pueden presentar olores


diferentes,comoocurreenelcasodelbutanoatode2pentilo,cuyosenantimerosse
perciben como frutal y dulce y ahumado y especiado [23, 24]. El componente
estructural es el que se impone en la deteccin de este olor. En cambio, para
molculas con una configuracin estrica prcticamente igual, caso del amoniaco
(NH3) y del sulfuro de hidrgeno (H2S), los olores extremadamente intensos y
diferentes que presentan ambos estn ligados a la presencia de distintos grupos
funcionales. Es decir, que dependiendo del odorante de que se trate ser su grupo
osmforo o su geometra quien influya mayoritariamente en el aroma finalmente
percibido[1].

2.2.3.Dimensindelosolores

Elquedetectemosuncompuestocomoundeterminadoolornoslodependede
suestructura,sinoquetambinexistenotrosfactoresqueinfluyenenlapercepcin,y
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
30 Captulo2

a los que se les considera las tres dimensiones de la sensibilidad aromtica: su


intensidad,sucualidadysuvalorhednico[7,15].

Cuandosehabladeintensidaddeunaromahacemosreferenciaalacantidadde
odorante que se necesita en el entorno de las clulas receptoras de la mucosa
olfatoria para que se produzca la activacin del olfato. Cuando se trata de la
concentracin de odorante ms baja en la que ste es detectado, hablamos del
umbral de percepcin. Si, adems de detectarlo, el olor que se genera se puede
identificar,eseniveldeconcentracineselumbraldereconocimientosensorial[15].
Ambos valores varan en funcin del tipo de compuesto de que se trate y del
individuo que reciba el estmulo, porque, segn el odorante, se estimulan unos u
otros receptores y cada ser humano presenta un sistema olfatorio diferente, ms o
menos desarrollado. De ah que la importancia de un compuesto aromtico en un
producto no pueda determinarse simplemente por la concentracin en la que
aparezca.

Adems, estos dos valores dependen engran medidade la matriz en la quese


encuentreelcompuesto,yaqueserellaquiendeterminecmollegarelodorantea
nuestra nariz [25]. Se pueden dar interacciones con los lpidos, las protenas o los
carbohidratos, de manera que los odorantes queden ms o menos retenidos. En
matricesgrasasyaceites,porejemplo,lasmolculasvoltilesmsapolaressernlas
ms solubles y las que se inhalarn con menos facilidad. Tambin hay que tener en
cuentalascondicionesdelmedio(pH,presenciadeoxgeno,humedad,etc.),porque
pueden modificar las sustancias aromticas [26]. Y a todo esto hay que aadir las
posibles interacciones entre odorantes de la misma matriz: si estos compuestos
potencianlacapacidaddedetectarelolor,selesdenominasinergistas,mientrasque,
siinterfierenenella,selesllamaantagonistas[1,2,7,15].

Encuantoalacualidaddeunaroma,staessuidentidadsensorialyladefinimos
conlosdescriptoressensorialesqueasignamosadichoolorcuandolaconcentracin
delodorantequelooriginasuperaelumbraldereconocimiento.Dependiendodela
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 31

complejidaddelodorantesernnecesariosunoomsdescriptores,loscualesasuvez
puedeniracompaadosdedistintosmatices.

Para algunos compuestos, la cualidad de su olor vara con la concentracin, lo


que tambin implica que estos compuestos tengan varios umbrales de
reconocimiento. Es el caso del (E)2nonenal: justo por encima de su umbral de
deteccin(0,1g/L)presentaoloramadera,mientrasqueporencimadelos8g/L,
hueleagrasa.Aunaconcentracinde30g/Lseconvierteendesagradableyenuna
disolucinacuosade1mg/Lpresentaunintensoolorapepino[2].

Porltimo,elvalorhednicootonalidadafectivahacereferenciaalasensacin
quenosproduceelolorquepercibimos,sinosresultaagradableodesagradable,por
ejemplo.Estrelacionadoconlainterpretacinsubjetivaquecadaindividuohacedel
olor, el cual es capaz de influir en nuestras emociones y modificar nuestro
comportamiento. Adems, la memoria olfativa es sumamente superior a la
proporcionadaporlavistaoelodo,ypermiterecuperartodoelcontextoemocional
enelquesememorizundeterminadoolor[5,6].

Pero el olfato tambin debe ser visto como nuestro primer sistema de alarma
frenteapeligrostandiversoscomoelfuego,unescapedegasocomidaestropeada
[3].Nuestrocuerporeaccionainclusofrenteaoloresdealimentosquenoshanhecho
enfermar, haciendo que durante mucho tiempo no tengamos ganas de consumirlos
[7].

2.2.4.Valordearoma

El valor de aroma u Odor Activity Value (OAV) es el cociente entre la


concentracindeunodoranteysuumbraldepercepcin,yproporcionaunaprimera
idea sobre la importancia o contribucin de dicho odorante al aroma global del
producto en el que se encuentre. Si la concentracin del compuesto es igual o
superioralumbraldedeteccin,entonceselOAVesigualomayorquelaunidadyel
compuestoparticiparenelaroma,tantoms,cuantomayorseaelcociente.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
32 Captulo2

Sin embargo, este parmetro no tiene en cuenta los efectos sinrgicos y


antagnicos que se pueden dar entre odorantes. Adems, asume que la relacin
entre la concentracin de un compuesto y la intensidad con la que se percibe es
lineal,cuandoenrealidadnoloes.Deacuerdoconlaleyuniversalparalosestmulos
fisiolgicos formulada por Stevens [15], la variacin de la intensidad respecto a la
concentracinesexponencial:
E=k(SS0)n

dondeEeslaintensidaddelapercepcin,kesunaconstantedeproporcionalidadque
depende de cada estmulo, S es la concentracin del estimulante y S0, su
concentracinumbral.Elexponentenestablecelatasadeaumentodelaintensidad
percibidaconlaconcentracin,antelaintensidadfsicadelestmulo.

Por tanto, para el caso del aroma habr una clara dependencia entre la
intensidad delolor dada por un compuesto y su concentracin, pero que variar en
funcindeltipodeodoranteydelamatrizquelocontenga,yaquetantoncomoS0
dependen de estas variables. Sin embargo, aunque el OAV constituya un parmetro
aproximado, s proporciona de forma rpida una idea acerca de la importancia
sensorialdeuncompuesto,loquepermiteevaluarytransformardemanerasencilla
losdatosobtenidosapartirdelanlisiscuantitativoeninformacinsensorial[27].

2.2.5.Compuestosaromticosconcarcterimpacto(keyodorants)

De forma general, el aroma de un producto est constituido por un nmero


elevado de compuestos voltiles muy diversos, cada uno con una mayor o menor
contribucinalaroma,perotodosellosnecesariosparaproporcionarelaromanicoy
caracterstico de ese producto [15, 28]. Sin embargo, tambin existen algunos
compuestosvoltilesque,porsmismos,soncapacesdeproporcionaralproductosu
olorcaracterstico.

Sonlosdenominadoscompuestosconcarcterimpactoocompuestosclave(key
odorants) [2], cuyo olor es el que da la identidad sensorial al propio producto, tal y
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 33

como puede observarse en la Tabla 2.1, donde aparecen algunos ejemplos de


compuestosconcarcterimpacto,elalimentoenelqueseencuentranyeldescriptor
universalmenteempleadoparadescribirelolordelodorante.

Alimento Odorante Descriptor

Almendras Benzaldehido Almendrasamargas

Col Sulfurodedimetilo Col

Limn Neral/geranial Limn

Pepino 2(E)6(Z)nonadienal Pepino

Pimientoverde 3isobutil2metoxipirazina Pimientoverde

Remolacha Geosmina Terroso

Setas 1octen3ona Champin

Vainilla Vainillina Vainilla

Tabla2.1.Compuestosaromticosconcarcterimpacto

2.2.6.Compuestosaromticosenlosalimentos

Segn distintos estudios, slo un 5% de los 8000 compuestos voltiles


identificadosenlosalimentoscontribuyerealmenteasuaroma[15].Sinembargo,el
abanico de olores en los alimentos es inmenso, lo que se explicara por la gran
especificidadyselectividaddelosreceptoresdenuestrosistemaolfatorio[7].

Estoscompuestos,sinapenasvalornutricional,constituyenunodelosprimeros
contactos que los consumidores tienen con los alimentos, siendo en gran medida
responsablesdesuaceptacinorechazo,raznporlacualseconsideranimportantes
ndices de calidad. Sus orgenes son variados, en funcin del tipo de alimento y del
compuesto de que se trate, pero en general se producen a partir de dos tipos de
reacciones:lasenzimticasylasnoenzimticas.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
34 Captulo2

DentrodelasreaccionesnoenzimticasencontramoslareaccindeMaillard y
suasociada,ladegradacindeStreckerdelosaminocidos,ascomolapirlisisdelas
protenas, la oxidacin de los lpidos va radicales libres y la heterolisis de los
carbohidratos, adems de distintas interacciones posteriores entre los productos
intermedios.Atemperaturaambiente,estasreaccionesnosedan(comoeselcasode
la pirlisis de las protenas), o bien necesitan tiempos de almacenamiento
prolongadosparaproducirse,perosevenfavorecidasduranteeltratamientotrmico
de los alimentos. De hecho, las altas temperaturas utilizadas durante la fritura, la
coccin, el asado o el tostado, enriquecen la diversidad aromtica, por lo que son
acciones habituales en el procesado de alimentos, como es el caso de la
caramelizacinoelahumado.Graciasaellas,lasuperficiedelalimentosedeshidrata
y comienza la pirlisis de los carbohidratos, las protenas, los lpidos y dems
constituyentes, generndose los distintos odorantes: compuestos carbonlicos,
pirazinas,pirroles,piridinas,furanonas,compuestosazufrados,fenoles,etc.[2,15].

Respecto a las reacciones enzimticas, forman parte del metabolismo de los


animales, las plantas y los microorganismos. Los aromas generados a partir de ellas
sonproductossecundariosdelasdistintasrutasmetablicas,diferencindosedelos
metabolitos primarios (protenas, lpidos, carbohidratos) en que no poseen ninguna
funcinfisiolgicadirecta.Algunasdelasreaccionesenzimticasmsimportantesse
desencadenan tras las rotura de los tejidos, especialmente durante el troceado de
frutas y verduras. Tambin hay algunas enzimas implicadas indirectamente en la
formacin de los aromas, ya que ellas llevan a cabo la primera etapa del proceso,
liberandoaminocidosdelasprotenas,azcaresdelospolisacridosuortoquinonas
de los compuestos fenlicos, los cuales son posteriormente convertidos en
compuestos aromticos por reacciones no enzimticas. De este modo se generan
aldehdos, steres, hidrocarburos, lactonas, terpenos, pirazinas, compuestos
azufrados,etc.[2,15].

Gracias a todas estas reacciones, tanto a las enzimticas como a las no


enzimticas,algunosalimentospresentanelaromaqueloscaracteriza[28].Eselcaso
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 35

de los frutos secos tostados, cuyo olor es muy caracterstico, a pesar de que son
prcticamente inodoros antes de ser procesados trmicamente [29, 30]. Algo
parecido le pasa al pan: es necesaria una primera fermentacin seguida de un
horneadoparaquesucortezadesprendaeltpicoaromaapanrecinhecho[15].En
cuantoalascarnesylospescadosahumados,elahumadoconstituainicialmenteun
mtodo de conservacin de los alimentos, pero el proceso aportaba un aroma tan
peculiar a los productos que en la actualidad se utiliza ms como mtodo
aromatizantequecomoconservador[2].

2.2.7.Oloresanmalos(offflavours)

Dadalaestrecharelacinquetienenaromaycalidad,yelimportantepapelque
juegaelprimeroenlaeleccindelosdistintosproductosporpartedelconsumidor,
un aspecto a tener muy en cuenta es la posible aparicin de olores extraos o
anmalos.Estosdefectosuoffflavourssonatributossensorialesquenormalmente
no estn presentes en el alimento y que no se asocian, por lo tanto, con su aroma
tpico[15,28].Puedensersutilesomuyacusados,peroencualquiercasorepercuten
negativamenteenlacalidaddelalimento.

Los offflavours pueden originarse de diversas maneras: por utilizacin de


ingredientes inapropiados, por contaminacin (a travs del aire, del agua, por
interaccin con los materiales del envasado), por reacciones qumicas y
microbiolgicas que tienen lugar en el propio alimento (oxidaciones, pardeamientos
noenzimticos,reaccionesinducidasporlaluz,etc.),oporelmismoprocesonatural
dedeteriorodelproducto[7,28],nosloduranteelprocesado,sinotambindurante
el envasado y el almacenamiento. En general, estas acciones llevan a la prdida de
compuestosimpacto,acambiosenlaconcentracindeunaovariassustanciasoala
aparicin de otros compuestos que pasan a convertirse en key odorants, pero cuya
presencianoseasociaalalimentoenelqueaparecen.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
36 Captulo2

2.3.ELANLISISDELAROMA

Tradicionalmente,elanlisissensorialhasidoelmtodoempleadoparaevaluar
lacalidaddelosalimentos,yanhoyendasesigueutilizando,yaquegraciasalse
obtiene una valiosa informacin sobre las propiedades sensoriales y, lo que es ms
importante, sobre la aceptacin o el rechazo de esos alimentos por parte del
consumidor.

Elaromanoesajenoaestosprocedimientossensorialesdeanlisis.Dehecho,la
nicamaneradeconocerlapercepcinglobalqueseexperimentacuandosehueleun
producto es mediante este tipo de anlisis, a travs de las denominadas catas. Sin
embargo, su utilizacin conlleva una serie de inconvenientes, como la necesidad de
emplear un panel de catadores entrenado, constituido por un nmero considerable
de individuos, as como un elevado coste (tanto de dinero como de tiempo), entre
otrosfactores.Deahlaexistenciayelextendidoempleodelanlisisinstrumental.

Dadoqueloscompuestosqueconstituyenelaromasonmolculasvoltiles,de
entrelasdistintastcnicasanalticasqueexisten,lacromatografadegaseseslams
adecuadaparaanalizarlafraccinaromtica.Eldesarrollodedetectoresespecficosy
laaparicindelaespectrometrademasashanpermitidoseparareidentificarcientos
decompuestosimplicadosenelaromadelosalimentosalolargodelosltimosaos
[31].Sinembargo,estonoessuficiente.nicamenteconunalistadeodorantesnose
puedesaberquesloquerealmenteexperimentalapersonaquehueleunproducto.

En la actualidad, el anlisis del aroma va encaminado hacia el desarrollo de


instrumentosque,trasunacalibracininicialenbasealosdatosproporcionadospor
un panel sensorial, puedan realizar el anlisis como si fueran un catador, pero de
manera rpida y objetiva. Se trata de las denominadas narices electrnicas, las
cuales, si bien no podrn sustituir totalmente a los paneles de catadores, porque
siemprenecesitarndeunaprimeracalibracinsensorial,spodrncomplementarlos
alencargarsedelosanlisismasivosyrutinarios.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 37

2.3.1.Elanlisissensorial

El anlisis sensorial permiti, ya a los primeros humanos, diferenciar entre


alimentos buenos o malos, y actualmente lo seguimos empleando cada vez que
elegimos un producto, y no otro, basndonos en la percepcin de sus propiedades
sensoriales (ya sea de forma consciente o inconsciente). Sin embargo, los anlisis
sensoriales estandarizados, ms all de los realizados por el consumidor a ttulo
personal,tienencomoobjetivofundamentalllevaracaboestudiosvlidosyfiablesen
losquesecuantifiquelaintensidadylaformadeunestmuloutilizandolossentidos
como instrumentos de medida [32]. La informacin obtenida servir para, por
ejemplo, evaluar la calidad organolptica de las materias primas, seguir la
transformacindelproductoalolargodelprocesodeelaboracin,detectardefectos
enelproductoterminado,oconocerlaspreferenciasdelosconsumidores,datosque
permitirn tomar importantes decisiones relacionadas con la produccin y el
marketing.Deahqueseanecesarioseguirmetodologasytcnicasespecficas.

2.3.1.1.Elpanelsensorial

Antes de llevar a cabo un anlisis sensorial hay que constituir el panel de


catadores,yelprimerpasoparahacerloesestablecer,enfuncindeltipodepruebas
quesevayanarealizar,siserequiereunjuradodeexpertosounodeconsumidores.
En cualquiera de los dos casos es necesario reclutar, seleccionar y entrenar
previamentealosintegrantesdedichopanel[32,33].

Con el reclutamiento, lo que se pretende es reunir un nmero adecuado de


personaspotencialmenteaptasoquepresentenciertasaptitudesparaelanlisisde
alimentos. En esta primera fase, adems de solicitarse informacin general, es
necesario averiguar la disponibilidad de los candidatos y si presentan restricciones
alimenticias. As podr saberse quines tienen inters por este tipo de anlisis y/o
puedenllevarlosacabo.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
38 Captulo2

Graciasalaseleccin,seadquiereunaideadelcomportamientogeneraldelos
individuos,pudindosedeterminarsucapacidadpararealizarpruebassensoriales(si
detectan diferencias en los alimentos segn el aspecto, el olor, la textura,) y su
aptituddescriptiva.

Por ltimo, con el entrenamiento se aprende a describir (construir una


terminologa) y a evaluar las caractersticas sensoriales de un alimento (tcnicas de
degustacinocata).As,terminanidentificndoseydescribindoselaspercepciones,
determinndoseelordendeaparicinyelgradodeintensidaddecadapropiedad,y
reconocindoselapersistencia.

Esta ltima fase es la ms larga y laboriosa de todas, ya que el percibir las


sensaciones y traducirlas a un lenguaje uniforme y a datos matemticos tambin
implica un proceso de memorizacin. Porque, aunque los seres humanos somos
capaces de detectar un gran nmero de sensaciones, hemos de aprender a
relacionarlasconaqullasquesondereferencia.

En cualquier caso, tanto si se trata de catadores experimentados como de


simples consumidores, se necesita un nmero elevado de individuos que, adems,
deben cumplir con una serie de requisitos: disponibilidad, motivacin, capacidad de
expresin,etc.Aestohayqueaadirlequeslopuederealizarseunnmerolimitado
deanlisisalda,yaque,sihablamosdelanlisissensorialdelaroma,lasensibilidad
olfativa se ve reducida por la exposicin prolongada a ciertos olores. Y no hay que
olvidar la variabilidad entre individuos y los problemas inherentes a cada catador
(adems de la inevitable subjetividad): anosmias que impiden detectar ciertos
compuestos,variacionesenlasensibilidadperceptiva(porelcansancio,losprocesos
catarrales,loscambioshormonales,...),etc.

Sin embargo, y a pesar de los inconvenientes que implica, el anlisis sensorial


sigue siendo la forma ms adecuada para evaluar aquellos alimentos que no se
consumen por sus propiedades nutritivas, sino por el placer que produce su
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 39

degustacin.Eslanicamaneradedeterminarsucalidad,dadoquestadependeen
granmedidadelasatisfaccinpersonalqueproporcionenalconsumidor.

2.3.1.2.Laspruebassensoriales

En el anlisis sensorial se distinguen bsicamente tres tipos de pruebas: las


pruebasdepreferenciayaceptacin,laspruebasdediscriminacinodiferenciaylas
pruebasdescriptivas[33,34].

Las pruebas de preferencia y aceptacin proporcionan una gua a la hora de


identificar los factores queinfluyen en las preferencias de losconsumidores,ya que
noserealizanconpanelesdeexpertos,sinocongruposdelospropiosconsumidores.
Se apoyan en el grado de preferencia o en una medida que permita determinar la
preferencia relativa, y estn muy influenciados por la atraccin personal que cada
participantesientehaciaelproducto.

Las pruebas de discriminacin o diferencia permiten distinguir adecuadamente


las muestras entre s. En ellas, la persona que lleva a cabo el anlisis no tiene en
cuentasusgustospersonales.Seempleancuandolasdiferenciasentreproductosson
tanpequeasquenopuedenserdescritas(eselcasodelosteststriangulares,donde
hayquesealarculdelastresmuestrasproporcionadasesdistintaalasotrasdos),o
biencuandoquierendeterminarselosumbralesdepercepcinsensorial.

Encuantoalaspruebasdescriptivas,seutilizanparadeterminarlanaturalezay
laintensidaddelasdiferenciasyconsistenenexaminarlosatributosdelosalimentos
(olor,textura,sabor,etc.)paraobtenerunadescripcindetalladadelosmismos.Las
realizan catadores entrenados, los cuales, adems, deben utilizar un vocabulario
especfico y comn establecido de antemano. Gracias a ellas se puede diferenciar
entre muestras, definir el tipo de producto y establecer su aceptabilidad en funcin
delacalidaddesusatributos(ennuestrocaso,elaroma).
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
40 Captulo2

Laeleccindeunauotrapruebaserealizarteniendoencuentaelobjetivoque
sepersigaconlaaplicacindelanlisissensorialaunproductodeterminado.

2.3.2.Elanlisisinstrumental

Comoyasehavistopreviamente,elaromadelosalimentosestconstituidopor
numerososymuyheterogneoscompuestosvoltiles,presentesenconcentraciones
de muy distinta magnitud (desde ppm hasta ppt), aunque, por lo general, bajas
respecto a las de otros compuestos mayoritarios [15]. Sin embargo, dada la gran
sensibilidad de nuestro sistema olfatorio, muchos de estos compuestos voltiles
superan el umbral de percepcin an estando a estas bajas concentraciones [35].
Adems, no hay que olvidar las posibles interacciones que pueden darse con otros
componentes de los alimentos que afectan a la retencin de los voltiles y a la
intensidadycalidaddelaroma.

Portodoello,elanlisisinstrumentaldelaromadelosalimentosdebellevarsea
cabo nicamente si previamente se han tratado las muestras y se han aislado los
compuestos aromticos, de manera que se hayan eliminado las interferencias que
puedanproducirotrostiposdecompuestos.Enesteprocesohayquetenerencuenta
queelrangodepolaridad,volatilidadyconcentracinquepresentanlosodorantesde
losalimentosesmuyamplioyqueenmuchoscasosvaacompaadoporproblemas
deinestabilidad.Porestemotivo,laetapadepreparacindelamuestrasueleserla
ms crtica de todo el proceso analtico, resultando difcil escoger un mtodo
adecuado para el anlisis de todos los compuestos voltiles de manera simultnea
[36].

2.3.2.1.Lastcnicasdepretratamiento

Son muchas las tcnicas empleadas en la preparacin de las muestras para el


anlisis del aroma. La eleccin de una u otra depende, en gran medida, de los
compuestos que se quieran analizar. Todas presentan ventajas e inconvenientes, y
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 41

debe ser el analista quien sopese cada uno de los factores antes de decantarse por
unatcnicaenconcreto[36].

A continuacin se presentan las tcnicas de preparacin de muestra ms


comunesyampliamenteutilizadasenelanlisisdelaromadealimentos,aunqueen
modoalgunopretendeserunarevisinexhaustiva.Solamentelamicroextraccinen
faseslida(SPME)ylaextraccincondisolventessedescribirnconmsdetalleenel
siguiente captulo de esta tesis doctoral, al haber sido las tcnicas implicadas en su
desarrolloexperimental.

Tcnicasdedestilacin

Estos mtodos de separacin se basan en la distinta volatilidad de los


componentes de una muestra. En el caso del aroma, los compuestos aromticos
presentan una volatilidad mucho mayor que el resto de los componentes de los
alimentos.Porestemotivo,esposiblesepararlosprimerosdelrestodelamatrizde
formarpidamediantesuvaporizacinyposteriorcondensacin,locualseconsigue
con una instrumentacin sencilla [36, 37]. En el caso de muestras acuosas, hay que
tenerencuentaqueelaguapuedeconstituirunainterferenciaimportante,yaque,al
tener un punto de ebullicin relativamente bajo, tambin se destilar junto con los
voltiles. Si la cantidad de agua que se extrae es excesiva, entonces ser necesario
eliminarla por adicin de sales anhidras, por congelacinconcentracin o bien
medianteunaextraccincondisolventes[38].

La ms sencilla de estas tcnicas es la destilacin directa. Sin embargo, no es


aconsejable aplicarla ms que sobre alimentos con un alto contenido en grasas e,
inclusoenestoscasos,elhechodesometeralasmuestrasatemperaturaselevadas
puede provocar cambios en la composicin del aroma, por lo que generalmente se
utilizaladestilacinconarrastredevaporoladestilacinavaco.Enestaltimanose
sobrepasan los 35 C, con lo que no se produce descomposicin de la muestra ni
aparecenartefactospordegradacintrmica.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
42 Captulo2

No obstante, con las tcnicas de destilacin no suele conseguirse una


concentracin adecuada de los compuestos voltiles, por lo que, previamente a su
inyeccinenelcromatgrafodegases,esnecesarioconcentrarlos.Enestesentido,la
destilacinextraccin simultnea consigue solventar este problema. Mientras la
muestradispersadaenaguasecalientahastaebullicin,elvaporquesegenerayque
contiene los voltiles es dirigido hacia una parte del aparato empleado donde
condensajuntoalosvaporesdeundisolventeextractante.Deestamanera,graciasa
lacondensacinconjunta,serecuperanloscompuestosaromticosporvolatilidady
por solubilidad en el disolvente [38], logrndose en un solo paso la extraccin y la
concentracin de los odorantes, y, adems, empleando un pequeo volumen de
disolvente orgnico. El inconveniente es que se requiere una instrumentacin ms
complejaytiemposlargos[39].

Extraccincondisolventes

staesunadelastcnicasmsutilizadasparaextraerloscompuestosvoltiles
de los alimentos, distinguindose entre la extraccin lquidolquido (LLE), cuando la
matriz es lquida, y la extraccin directa con disolventes (DSE), cuando la matriz es
slida. En ambos casos se emplean disolventes orgnicos (diclorometano, ter
dietlico, hidrocarburos, etc.) y la extraccin se lleva a cabo durante perodos de
tiempo largos (entre 8 y 12 horas). Finalmente, es necesaria una concentracin del
extractomedianteevaporacindeldisolvente[3638].

Aunque estas tcnicas dan buenos resultados y presentan ventajas, como su


gran sensibilidad y sencillez, tambin cuentan con numerosos inconvenientes. Entre
ellos, que de forma general utilizan grandes volmenes de disolventes orgnicos
perjudiciales para el medio ambiente, que necesitan tiempos de anlisis muy largos
conunagranmanipulacindelasmuestrasosubajaselectividad[36,39],porloque
empiezanasersustituidasporotrastcnicasmsrpidas,eficacesylimpias.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 43

Tcnicasdeespaciodecabeza

Las tcnicas de espacio de cabeza (o headspace) consisten en extraer los


compuestosvoltilesdelafasegaseosaqueestenequilibrioconlamatriz,deforma
queseobtieneunextractolomsparecidoposiblealafraccinvoltilqueinhalamos
yquellegahastanuestroepitelioolfatoriocuandoolemosunproducto.

Se dividen en dos grandes grupos en funcin del sistema de muestreo: las


tcnicasestticasylastcnicasdinmicas.Engeneral,ambassecaracterizanporuna
manipulacinmnimadelasmuestrasypornoempleardisolventesorgnicos,loque
permiteobtenerextractosmuchomslimpios,sinimpurezasnicontaminantes.Esto
evitalainterferenciacromatogrficadelpicodeldisolvente,quemuchasvecesimpide
la determinacin de algunos voltiles, como ocurre cuando se llevan a cabo
extracciones con disolventes. Adems, estas tcnicas no daan ni destruyen las
muestras,yaqueselimitanaextraerlasfraccionesvoltiles,yprecisamenteporeso
tampocooriginanartefactosquepuedaninterferirenelposterioranlisisdelaroma.
Deigualmodo,estosprocesospuedenautomatizarse,loqueproporcionaunamayor
repetitividad[36,39,40].

Respecto a la tcnica de espacio de cabeza esttico, simplemente consiste en


introducir el producto a analizar en un recipiente cerrado (que puede ser un vial) y
dejarquelasmolculasvoltilesdelamatrizalcancenelequilibrioentrelafaseslida
o lquida que las contiene, y la fase gaseosa. Una vez alcanzado dicho equilibrio, el
espacio de cabeza es introducido directamente en el puerto de inyeccin del
cromatgrafodegases,loquehacequelatcnicaseasumamentesencilla.

Sinembargo,tambinhayquetenerencuentalosinconvenientesquepresenta.
Uno de ellos es la tendencia a discriminar aquellos compuestos menos voltiles, lo
que implica distintas recuperaciones de los analitos en funcin de su volatilidad,
factorquehabrquetenerencuentasisedeseahaceranlisiscuantitativos.Adems,
aunque se puede aumentar su rendimiento modificando la fuerza inica de la
muestra, incrementando la temperatura o aplicando agitacin, esta tcnica no
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
44 Captulo2

permite concentrar los voltiles, lo que provoca una baja sensibilidad del mtodo,
insuficiente para los compuestos que se encuentren en menor concentracin. As
pues,suslmitesdedeteccin(delordendeppm)sonpeoresquelosqueselogran
conotrastcnicas.

Perolatcnicadelespaciodecabezaestticohademostradoseradecuadapara
separar los compuestos voltiles mayoritarios del aroma, lo que resulta de gran
intersenalgunosestudiosenlosquelainformacinquecontieneestafasegaseosa
essuficienteparasuspropsitos,comoocurre,porejemplo,enlatcnicadelanariz
electrnica[41].

Enlatcnicadeespaciodecabezadinmico,yalcontrariodeloqueocurreenla
esttica, no se deja alcanzar el equilibrio de los voltiles entre la matriz y la fase
gaseosa, sino que el equilibrio se ve desplazado constantemente hacia la fase
gaseosa.Losanalitossonarrastradosdeformacontinuaporungasinertehaciauna
trampa,enlaquequedanretenidos.Esporelloqueestatcnicatambinseconoce
conelnombredepurgaytrampa(P&T).Deestatrampa,quepuedesercriognica
o adsorbente, los analitos son transferidos al cromatgrafo de gases mediante
desorcin,generalmentetrmica.Asseconsigueincrementarelnmero,ytambin
la cantidad, de voltiles que se extraen de la matriz con respecto al headspace
esttico,loquepermiterebajarloslmitesdedeteccinalordendeppt.

Pero al igual que en el resto de tcnicas de preparacin de muestra, para el


headspacedinmicotambinexisteninconvenientes,lamayorarelacionadosconlas
trampas en las que se retienen los voltiles. En el caso de las trampas criognicas,
stassonespecialmentesensiblesalagua,porloqueesnecesario eliminarelvapor
deaguaantesdequelleguealatrampa.Tambinpresentanuncosterelativamente
altoyrequierentiemposdeanlisisligeramentemslargos,yaquenecesitanvolvera
enfriarse antes del siguiente anlisis. Por su parte, las trampas con materiales
adsorbentes,comopolmerosporosos(Tenax,Porapak,Chromosorb)ocarbnactivo,
sonmsselectivas,perohayquetenerencuentasuvolumenderupturaparaevitar
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 45

prdidas. Adems, pueden presentar un efecto memoria. Es decir, algunos


compuestosnosedesorbentotalmente,sinoquequedanfuertementeretenidosenla
trampa,apareciendoenanlisisposteriores[39,40].

Tcnicasdeextraccinenfaseslida

En los ltimos aos, las tcnicas de extraccin en fase slida han derivado en
mtodosampliamenteutilizadosparaelanlisisdeloscompuestosaromticosdelos
alimentos,graciasasurapidezysensibilidadyaque,obienempleancantidadesde
disolventes mucho menores que las extracciones con disolventes, o bien se llevan a
cabo,directamente,sinnecesidaddeellos.Deentreellascabedistinguirlaextraccin
en fase slida (SPE), la microextraccin en fase slida (SPME) y la stir bar sorptive
extraction(SBSE)[38,42].

La SPE fue introducida a finales de los aos 70, e implica la utilizacin de un


slidoadsorbente,enformadecartuchosodiscos,queactacomofaseestacionaria
a travs de la cual, tras un breve paso de acondicionamiento, se hace pasar la
muestra.Enfuncindelanaturalezadelafaseestacionariaydeltipodemuestrade
quesetrate,graciasalaSPEsepuedellevaracabouncleanupdedichamuestra(si
los compuestos que quedan retenidos en el slido son interferencias) o un
fraccionamiento de los analitos de inters (cuando los compuestos que quedan
retenidosenlafaseestacionariasonlosquequierenextraersedelamatriz).Eneste
segundo caso es necesario un posterior proceso de elucin mediante disolventes
orgnicos,conelobjetivoderecuperaresosanalitos,yque,normalmente,serealiza
aplicando vaco para aumentar la velocidad del procedimiento [42, 43]. De forma
general, los adsorbentes que se emplean no son selectivos, ya que deben cubrir un
ampliorangodepolaridades,ylamayorasonmaterialesconsliceensuestructurao
copolmerosdeestirenodivinilbenzeno.Elrendimientodeestatcnicadeextraccin
dependedeltipodeadsorbenteydelosdisolventesutilizados,y,aunquevlidapara
determinar concentraciones a niveles traza, la SPE est limitada a compuestos de
volatilidad baja o moderada. Adems, las muestras han de atravesar la fase
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
46 Captulo2

estacionaria,porloquetienenqueserlquidasogaseosasy,sisonslidas,estaren
disolucin.

Por su parte, la microextraccin en fase slida es una tcnica aparecida a


principiosdelosaos90quepermitelaextraccinyconcentracinsimultneasdelos
compuestos [44]. En este caso, la fase estacionaria donde los analitos quedan
retenidosrecubreunafibradeslicefundidadepequeasdimensiones,lacualpuede
exponersealespaciodecabezadelamuestraaanalizaroalapropiamuestra.Trasla
extraccin,lafibraseinsertaenelpuertodeinyeccindelcromatgrafodegases,y
los compuestos se desorben trmicamente. Las principales ventajas que presenta la
SPMEsonsusimplicidad,lamanipulacinprcticamentenuladelamuestra,elqueno
requiera disolventes o elevadas temperaturas durante la extraccin y su gran
selectividad, ya que existe una amplia variedad de fases estacionarias
comercializadas, y en funcin de sta y del grosor de la misma, la fibra tendr una
mayoromenorafinidadporundeterminadotipodecompuestos[39,45].

Por ltimo, dentro de las tcnicas de extraccin en fase slida, tambin


encontramoslastirbarsorptiveextraction,tcnicaderivadadelaSPMEysurgidaen
1999[46].Aqu,laqueestrecubiertaporunafinacapadefaseestacionariaesuna
pequea barra imantada, que puede colocarse sobre el headspace de la muestra o
dentro de la propia muestra (si sta es lquida). En el primer caso, la tcnica se
denominaheadspacesorptiveextraction(HSSE).Enelsegundo,traslaextraccinde
los voltiles, la barra debe lavarse con agua destilada para eliminar los posibles
compuestos interferentes, como azcares o protenas, y se seca empleando un
pauelodepapel.Acontinuacin,elimnessometidoaunadesorcintrmicaylos
analitos pasan directamente a la columna cromatogrfica [42, 47]. La ventaja que
presenta la SBSE frente a la SPME es su mayor sensibilidad y la posibilidad de
determinar voltiles que aparezcan en concentraciones traza, gracias a la mayor
cantidaddefaseestacionariaempleadapararecubrirlabarray,portanto,asumayor
capacidad de extraccin [39, 46]. Entre sus inconvenientes, que la disponibilidad
actual de fases estacionarias se reduce a recubrimientos de polidimetilsiloxano
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 47

(PDMS), aunque comienzan a hacerse pruebas con PDMS y carbn con buenos
resultadosparalaextraccindecompuestosmuyvoltiles[42].

Otrastcnicas

Una alternativa a la extraccin lquidolquido es la microextraccin lquido


lquido(LLME),tambinllamadasingledropmicroextraction(SDME).ComolaSPME,
stanoesunatcnicaexhaustiva,ynicamenteunapartedelosanalitosseextraey
preconcentra para el anlisis. Consiste en depositar una gota de disolvente con una
microjeringaenelvialdondeseencuentrelamuestra.Lamezclaseagita,oinclusose
calienta,ysedejaquelaextraccinalcanceelequilibrioantesderetirarconlajeringa
elextractante,elcualseinyectaposteriormenteenelcromatgrafo[42,43].Enella,
comoenlaLLE,seempleaundisolventeorgnicoinmiscibleconlamuestra,peroen
este caso, el volumen es mucho menor, del orden de L, con lo que se reduce la
problemticamedioambiental.

Tambin se ha aplicado la tcnica de la sonicacin para extraer compuestos


aromticos de distintos alimentos y bebidas. Esta tcnica de extraccin asistida por
ultrasonidos(USAE)aplicavibracionesacsticasconfrecuenciasporencimadelos20
kHz, lo que permite un contacto ntimo entre la muestra y el disolvente [42, 48]. El
problema es que, aunque rpida, la eficacia de la extraccin no es tan alta como la
que se logra con otros mtodos y, si se incrementa el tiempo de sonicacin, esto
implicaunaumentodelatemperatura,conlasdesventajasqueconlleva.

Otra tcnica, ya empleada desde hace dcadas a nivel industrial para, por
ejemplo,descafeinarelcafyelt,procesarproductosdeorigenvegetalyanimal,o
extraeringredientesactivosdedistintasmatrices,perocuyaaplicacincomomtodo
deextraccindecompuestosaromticosesrelativamentenueva,eslaextraccincon
fluidossupercrticos.Enellaseempleadixidodecarbono(CO2)gaseosoalquesele
aplicanunapresinytemperaturasuficientesparaquealcanceelestadosupercrtico,
cosa que logra a 309 C y 738 bar. En este punto, el CO2 adquiere propiedades de
disolvente [36, 42, 47], por lo que no es necesario utilizar disolventes orgnicos.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
48 Captulo2

Adems, y gracias a las especiales propiedades adquiridas, el dixido de carbono


consigue extraer compuestos no muy voltiles o fuertemente unidos a la matriz, de
forma respetuosa con el medio ambiente y relativamente barata. En su contra, la
dificultadparalograrunequilibrioentrepresin,temperaturayflujoparacadatipo
demuestra(loquesetraduceenlargostiemposdeanlisis),yelcarcterapolardel
dixido de carbono, queno permite extraer de forma eficienteanalitos polares [36,
39,42].

2.3.2.2.Lacromatografadegases

Aparecida en 1952, la cromatografa de gases (GC) es la tcnica ms adecuada


paraanalizarlafraccinvoltildelosalimentos,entreotrascosasporlosavancesque
se han producido tanto en las columnas cromatogrficas como en los sistemas de
deteccinduranteelmsdemediosiglotranscurridodesdeentonces[31].

Inicialmente, las columnas que se empleaban estaban rellenas de un material


slido o de soportes slidos recubiertos con lquidos que actuaban como fase
estacionaria.Sinembargo,sucapacidaddeseparacineralimitada,ynofuehastael
desarrollodelascolumnascapilarescuandoseprodujoelprimeravanceimportante
en la investigacin del aroma de los alimentos. Estas columnas, con dimetros
internos sumamente pequeos (025, 032 053 mm) y una fina capa de fase
estacionaria unida a la pared interna de las propias columnas, presentan una gran
capacidadparasepararmezclascomplejasdecompuestosvoltiles[31,43].

En cuanto a los sistemas de deteccin, hay que distinguir entre los detectores
universales,queproporcionansealcuandolesllegacualquiertipodemolcula,ylos
detectoresespecficos,quenicamenteproporcionansealsileslleganmolculasde
unasdeterminadascaractersticas[31,43].

Entrelosdetectoresuniversales,elmsutilizadoeseldetectordeionizacinde
llama (FID), porque da respuesta a casi todos los compuestos orgnicos. Adems,
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 49

presenta una buena sensibilidad y una respuesta lineal en un amplio rango de


concentraciones,esestableyrequierepocomantenimiento.

Otrosistemadedeteccinmuyutilizadoenlaactualidadeslaespectrometrade
masas(MS),desarrolladaenlosaos70delsiglopasado.Graciasalafragmentacin
delasmolculasqueproporcionayalaexistenciadeunampliosoftwareconlibreras
espectrales,sepuedenidentificarlosdistintosanalitosseparadosporlacolumna,lo
quehaconducidoaungranavanceenlainvestigacindelanlisisdelosvoltilesde
los alimentos. Adems, tambin permite la deteccin en modo SIM (Selective Ion
Monitoring),muytilenelcasodeloscompuestosqueaparecenaniveltraza,yaque
aumenta la sensibilidad de la tcnica al seleccionarse previamente las masas de los
ionesmsabundantesdelespectrodelosanalitosdeinters.

Respecto a los detectores especficos, sirven para analizar determinados


compuestosodeterminadasfamiliasde compuestos. Entreellosdestacaeldetector
de captura electrnica (ECD), muy sensible a los compuestos halogenados, y el
detectordenitrgenofsforo(NPD),quepermiteanalizarcompuestosnitrogenados
oconfsforoensuestructura,yquetambinpresentaunaelevadasensibilidad.En
cuanto a los compuestos azufrados, los dos detectores ms utilizados son el
fotomtrico de llama (FPD) y el de quimioluminiscencia (SCD), ya que son muy
sensiblesalostomosdeazufre.

De este modo se ha obtenido un amplio conocimiento de la composicin de la


fraccin voltil de los alimentos. Sin embargo, a la hora de intentar relacionar los
resultadoscromatogrficosobtenidosconlaspercepcionessensorialesquesetienen
al oler un determinado producto, los diferentes datos no terminan de encajar. Y es
queexistenmuchoscompuestosvoltilesencadaalimento,peronotodospresentan
olor. Es ms: de todos los compuestos aromticos, slo unos pocos, aqullos cuya
concentracin est por encima de su umbral de percepcin sensorial, realmente
contribuyenalaroma.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
50 Captulo2

Porestemotivo,yconelobjetivodeidentificaralosodorantesentrelatotalidad
delafraccinvoltil,sedesarrollen1964lacromatografadegasescondeteccin
olfatomtrica o GCO [49], en la que la nariz humana es utilizada como detector
cromatogrficoenparaleloconotrodetectorconvencional(generalmenteunFIDoun
MSD). De este modo, los compuestos que eluyen separados de la columna son
percibidosporelanalista,queescapazdedescribirelolorycuantificarlaintensidad
aromtica, a la vez que el detector convencional proporciona una seal
cromatogrfica.

En el siguiente captulo de esta tesis doctoral se describen las distintas


metodologas que permiten obtener informacin cuantitativa de las caractersticas
aromticasdeloscompuestos,ascomounadiscusinmsampliadelaGCOydesu
aplicacinalanlisisdelaromadelosalimentos.

2.3.2.3.Lanarizelectrnica

En la actualidad, la industria alimentaria demanda mtodos rpidos, sencillos y


fiables que permitan evaluar los compuestos voltiles para la identificacin, la
autentificacin yelcontrol de procesos de sus productos [50]. Hasta ahora, paneles
sensorialesconstituidosporexpertosentrenadoshansidoquieneshanllevadoacabo
estas tareas, ayudados por la cromatografa de gasesolfatometra. Sin embargo, es
difcil correlacionar las informaciones y adems, como ya se vio anteriormente, el
anlisis sensorial conlleva una serie de inconvenientes imposibles de solventar. Por
estemotivo,losesfuerzosrealizadosenelanlisisdelaromadelosalimentosenlos
ltimosaoshanidodirigidoshacialacreacindeuninstrumentocapazdefuncionar
comosifueraunanarizhumana,conelobjetivodeemularaunpaneldecatadores,y
quesehadadoenllamarnarizelectrnica[51].

Unanarizelectrnicarealizaunanlisisglobaldelaromaaportandoinformacin
bsicamente cualitativa: diferencias y similitudes entre muestras, presencia de
defectosaromticosodenotascaractersticas,etc.,demanerasimilaracomolohace
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 51

un panel sensorial. Sin embargo, y a diferencia de las tcnicas cromatogrficas en


general, la nariz electrnica no proporciona informacin detallada sobre la
composicinqumicadelaroma[39].

Constade tres partes bsicas bien diferenciadas: elsistema de muestreo,elde


deteccinyelsistemadetratamientodedatos.Generalmente,latomademuestrase
realiza mediante tcnicas de espacio de cabeza como las que se han descrito
previamente.Encuantoalsistemadedeteccin,eslaparteprincipaldelinstrumento,
y en base a l se puede realizar una divisin de los diferentes tipos de narices
electrnicas que existen en elmercado: las queutilizan sensores de gases y las que
empleanlaespectrometrademasas[52,53].Lossensoresdegasesmodificanalguna
desuspropiedadescuandoloscompuestosdelaromainteraccionanconsusuperficie,
mientras que la espectrometra de masas acta como un multisensor con tantos
sensores como iones formados en el sistema MS. En ambos casos, la seal que se
obtiene es la huella digital del aroma del producto analizado. La ltima parte de la
nariz electrnica es el sistema de tratamiento de datos, que permite tratar con
distintas herramientas quimiomtricas toda la informacin obtenida a partir del
sistemadedeteccin.

Losbuenosresultadosobtenidosendistintosestudiosenlosquesehautilizado
lanarizelectrnica,hacendeestatcnicaunabuenaherramientaquepuedeayudar
enelcontroldecalidadalimentario.Esos:siempreycuandoelmtododereferencia
sea el adecuado y, adems, se posean suficientes muestras representativas de la
variable que se quiera medir para poder llevar a cabo la calibracin del equipo de
manerafiable[5456].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
52 Captulo2

BIBLIOGRAFA
[1] Ohloff,G.Scentandfragrances:thefascinationofodorsandtheirchemicalperspectives.
Berlin:SpringerVerlag;1994.
[2] Fisher,C.,Scott,T.R.Flavoresdelosalimentos.Biologayqumica.Zaragoza:Acribia,S.
A.;1997.
[3] Hawkes, C. H., Doty, R. L. The neurology of olfaction. 1st edition. Cambridge: Cambridge
UniversityPress;2009.
[4] Philpott,C.M.,Bennett,A.,Murty,G.E.Abriefhistoryofolfactionandolfactometry.J.
Laryngol.Otol.2008;122:657662.
[5] Boyd,J.Perfumeysensibilidad.LlinarsdelValls:EdicinPerfumeras;2009.
[6] German, J. B., Yeritzian, C., Tolstoguzov, V. B. Olfaction, where nutrition, memory and
immunity intersect. En: Berger, R. G., editor. Flavours and fragrances. Chemistry,
bioprocessingandsustainability.Berlin:Springer;2007,p.2541.
[7] Holley,A.Elcerebrogoloso.1edicin.Barcelona:RubesEditorial,S.L.;2006.
[8] Moran,D.T.,Rowley,J.C.III,Jafek,B.W.,Lovell,M.A.Thefinestructureoftheolfactory
mucosainman.J.Neurocytology1982;11:721746.
[9] Holley, A. Processing information about flavour. En: Voilley, A., Etivant, P., editors.
Flavourinfood.Cambridge:WoodheadPublishingLimited;2006,p.3661.
[10] Hatt, H. Molecular and cellular basis of human olfaction. En: Kraft, P., Swift, K. A. D.,
editors.Perspectivesinflavorandfragranceresearch.Zrich:VHCA,WileyVCH;2005,p.
113.
[11] Buck, L., Axel, R. A novel multigene family may encode odorant receptors: a molecular
basisforodorrecognition.Cell1991;65:175187.
[12] Lindemann,B.Receptorsandtransductionintaste.Nature2001;413:219225.
[13] Bufe, B., Meyerhof, W. The human perception of taste compounds. En: Voilley, A.,
Etivant,P.,editors.Flavourinfood.Cambridge:WoodheadPublishingLimited;2006,p.
335.
[14] Hnig,D.P.ZurPsychophysikdesGeschmackssinnes.Phil.Stud.1901;17:576623.
[15] Belitz, H.D., Grosch, W., Schieberle, P. Food Chemistry. 3rd revised edition. Berlin:
Springer;2004.
[16] Gilbert, A. La sabidura de la nariz. La ciencia del olfato aplicada a la vida cotidiana. 1
edicin.Barcelona:EdicionesB,S.A.;2009.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 53

[17] Zwaardemaker,H.LOdorat.Pars:OctaveDoin;1925.
[18] Rosch, E. Principles of categorization. En: Rosch, E., Lloyd, B. B., editors. Cognition and
categorization.Hillsdale:L.Erlbaum;1978.
[19] Meilgaard, M. C. Flavor chemistry of beer. Mast. Brew. Association Am. Technical Q.
1975;12:107117.
[20] Noble, A. C., Arnold, R. A., Masuda, B. M., Pecore, S. D., Schmidt, J. O., Stern, P. M.
Progress towards a standardized system of wine aroma terminology. Am. J. Enol. Vitic.
1984;35:107109.
[21] Noble, A. C., Arnold, R. A., Masuda, B. M., Pecore, S. D., Schmidt, J. O., Stern, P. M.
Modification of a standardized system of wine aroma terminology. Am. J. Enol. Vitic.
1987;38:143146.
[22] Jackson,J.F.Molecularbiologyoftasteandaromareceptors:implicationsfortasteand
aroma of plan products. En: Jackson, J. F., Linskens, H. F., editors. Analysis of taste and
aroma.Berlin:Springer;2002,p.16.
[23] Leffingwell, J. C. Chirality & Odour Perception [internet]. Leffingwell & Associates; 2002
[actualizada06042010;acceso30092010].Disponibleen:
http://www.leffingwell.com/chirality/chirality.htm
[24] Sell,C.S.Scentthroughthelookingglass.En:Kraft,P.,Swift,K.A.D.,editors.Perspectives
inflavorandfragranceresearch.Zrich:VHCA,WileyVCH;2005,p.6788.
[25] Voilley,A.,Souchon,I.Flavourretentionandreleasefromthefoodmatrix:anoverview.
En: Voilley, A., Etivant, P., editors. Flavour in food. Cambridge: Woodhead Publishing
Limited;2006,p.117132.
[26] Salles, C. Odourtaste interactions in flavor perception. En: Voilley, A., Etivant, P.,
editors.Flavourinfood.Cambridge:WoodheadPublishingLimited;2006,p.345368.
[27] Cacho, J. F. Los compuestos aromticos y su significacin sensorial. Jornada tcnica: els
compostos aromtics del vi. Vilafranca del Peneds: Institut Catal de la Vinya i el Vi,
UniversitatdeBarcelona;1999,p.14.
[28] McGorrin,R.J.Characterimpactcompounds:flavorsandoffflavorsinfoods.En:Marsili,
R., editor. Flavor, fragrance, and odor analysis. New York: Marcel Dekker, Inc.; 2002, p.
375413.
[29] Chetschik, I., Granvogl, M., Schieberle, P. Comparison of the key aroma compounds in
organically grown, raw WestAfrican peanuts (Arachis hypogaea) and in ground, pan
roastedmealproducedthereof.J.Agric.FoodChem.2008;56:1023710243.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
54 Captulo2

[30] BurdackFreitag, A., Schieberle, P. Changes in the key odorants of Italian hazelnuts
(CoryllusavellanaL.var.TondaRomana)inducedbyroasting.J.Agric.FoodChem.2010;
58:63516359.
[31] Maga, J. A. Analysis of aroma volatiles. En: Gordon, M. H., editor. Principles and
applications of gas chromatography in food analysis. Chichester: Ellis Horwood Limited;
1990,p.86110.
[32] Meilgaard, M., Civille, G. V., Carr, B. T. Sensory evaluation techniques. 2nd edition. Boca
Raton:CRCPress,Inc.;1991.
[33] Fortin, J., Desplancke, C. Gua de seleccin y entrenamiento de un panel de catadores.
Zaragoza:Acribia,S.A.;2001.
[34] Noble, A. C., Lesschaeve, I. Sensory analysis of food flavor. En: Voilley, A., Etivant, P.,
editors.Flavourinfood.Cambridge:WoodheadPublishingLimited;2006,p.6280.
[35] Rychlik,M.,Schieberle,P.,Grosch,W.Compilationofodorthresholds,odorqualitiesand
retention indices of key food odorants. Garching: Deutsche Forschungsanstalt fr
Lebensmittelchemie and Institut fr Lebensmittelchemie der Technischen Universitt
Mnchen;1998.
[36] DaCosta,N.C.,Eri,S.Identificationofaromachemicals.En:Rowe,D.J.,editor.Chemistry
andtechnologyofflavorsandfragrances.Oxford:BlackwellPublishingLtd.;2005,p.12
34.
[37] Parliment,T.Solventextractionanddistillationtechniques.En:Marsili,R.,editor.Flavor,
fragrance,andodoranalysis.NewYork:MarcelDekker,Inc.;2002,p.123.
[38] Reineccius, G. A. Flavourisolation techniques. En: Berger, R. G., editor. Flavours and
fragrances. Chemistry, bioprocessing and sustainability. Berlin: Springer; 2007, p. 409
426.
[39] Plutowska,B.,Wardencki,W.AromagramsAromaticprofilesintheappreciationoffood
quality.FoodChem.2007;101:845872.
[40] Wampler, T. P. Analysis of food volatiles using headspacegas chromatographic
techniques.En:Marsili,R.,editor.Flavor,fragrance,andodoranalysis.NewYork:Marcel
Dekker,Inc.;2002,p.2554.
[41] Vera,L.,Mart,M.P.,Boqu,R.,Mestres,M.,Busto,O.,Guasch,J.Controldecalidadde
bebidasalcohlicasmediantenarizelectrnica.CervezayMalta.2008;180:2535.
[42] deKoning,S.,Janssen,H.G.,Brinkman,U.A.Th.Modernmethodsofsamplepreparation
forGCanalysis.Chromatographia2009;69:S33S78.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaroma 55

[43] Miller,J.M.Chromatography.Conceptsandcontrasts.2ndedition.Hoboken:JohnWiley&
Sons,Inc.;2005.
[44] Arthur, C. L., Pawliszyn, J. Solid phase microextraction with thermal desorption using
fusedsilicaopticalfibers.Anal.Chem.1990;62:21452148.
[45] Wardencki, W., Michulec, M., Curylo, J. A review of theoretical and practical aspects of
solidphasemicroextractioninfoodanalysis.Int.J.FoodSci.Technol.2004;39:703717.
[46] Baltussen,E.,Sandra,P.,David,F.,Cramers,C.StirBarSorptiveExtraction(SBSE),anovel
extractiontechniqueforaqueoussamples:theoryandprinciples.J.Microcol.Sep.1999;
11:737.
[47] Werkhoff, P., Brennecke, S., Bretschneider, W., Bertram, H.J. Modern methods for
isolatingandquantifyingvolatileflavorandfragrancecompounds.En:Marsili,R.,editor.
Flavor,fragrance,andodoranalysis.NewYork:MarcelDekker,Inc.;2002,p.139204.
[48] Kou, D., Mitra, S.Extractionofsemivolatile organiccompoundsfromsolid matrices.En:
Mitra,S.,editor.Samplepreparationtechniquesinanalyticalchemistry.NewJersey:John
Wiley&Sons,Inc.;2003,p.139182.
[49] Fuller, G. H., Steltenkamp, R., Tisserand, G. A. The gas chromatography with human
sensor:perfumermodel.AnnalsN.Y.Acad.Sci.1964;116:711724.
[50] LpezFeria, S., Crdenas, S., Valcrcel, M. Simplifying chromatographic analysis of the
volatilefractionoffoods.TrendsAnal.Chem.2008;27:794803.
[51] Kollmannsberger, H., Nitz, S., Blank, I. Advanced instrumental analysis and electronic
noses. En: Berger, R. G., editor. Flavours and fragrances. Chemistry, bioprocessing and
sustainability.Berlin:Springer;2007,p.313361.
[52] Rck,F.,Barsan,N.,Weimar,U.Electronicnose:currentstatusandfuturetrends.Chem.
Rev.2008;108:705725.
[53] Wilson, A. D., Baietto, M. Applications and advances in electronicnose technologies.
Sensors2009;9:50995148.
[54] Mart,M.P.,Busto,O.,Guasch,J.Applicationofaheadspacemassspectrometrysystem
to the differentiation and classification of wines according to their origin, variety and
ageing.J.Chromatogr.A2004;1057:211217.
[55] Mart, M. P., Busto, O., Guasch, J., Boqu, R. Electronic noses in the quality control of
alcoholicbeverages.TrendsAnal.Chem.2005;24:5766.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
56 Captulo2

[56] Vera, L., Acea, L., Boqu, R., Guasch, J., Mestres, M., Busto, O. Characterization and
classificationofthearomaofbeersamplesbymeansofanMSenoseandchemometric
tools.Anal.Bioanal.Chem.2010;doi:10.1007/s002160104343y.

UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 3
La cromatografa de
gases-olfatometra (GCO)
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 59

3.1.ELANLISISDELAROMAMEDIANTEGCO

Laevaluacinsensorialdelosalimentosestanantiguacomolossereshumanos,
yaquepersigue,enltimainstancia,preservarnuestroorganismo.Graciasaellayala
interconexinqueexisteentrelossentidosquelallevanacabo(fundamentalmente,
elolfatoy el gusto), nuestro sistema digestivo y loscentros neuronales queregulan
los recuerdos y las emociones, los hombres somos capaces de identificar aquellos
alimentosqueestnligadosalanutricin,ascomoderechazarlosproductosqueno
seencuentranencondicionesptimasyquepodrantenerunefectonegativosobre
nuestrasalud.

PeronofuehastaelsigloXIX,conelnacimientodelaqumicadelflavor,cuando
pudieron identificarse los responsables reales de que un alimento guste o no
guste, de que sea aceptado o rechazado: los flavores. Entre ellos encontramos
compuestos voltiles odorantes (responsables del aroma) y sustancias con sabor
(responsablesdelgusto)[1].

En la actualidad, y gracias a la investigacin realizada en este campo y a los


avances logrados durante los ltimos cincuenta aos en la qumica analtica
instrumental,elnmerodeflavoresquehanllegadoadeterminarseasciendeams
de7000[2].Cadaunodeestoscompuestospuedeencontrarseenalimentosdemuy
distintanaturaleza,delmismomodoquecadaproductoalimentariocontienecientos
de flavores. Sin embargo, slo unos pocos de estos compuestos realmente
contribuyen de forma significativa al aroma y al sabor, ya que esto depende de la
concentracinenlaqueaparezcanenelalimento,delanaturalezadeste,ydesus
umbralesdedeteccin[3].

Respecto a la fraccin aromtica de un determinado producto, son muchos los


odorantesresponsablesdelamisma,loquelaconvierteenunamezclacomplejade
compuestos voltiles de diferente naturaleza qumica presentes en concentraciones
muy variadas. Pero los humanos no somos capaces de distinguir cada una de las
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
60 Captulo3

individualidades que conforman el aroma, sino que percibimos un nico estmulo


global[4].Porestemotivo,sisebuscaestudiarlosdistintosresponsablesdelolorque
presenta un alimento, es necesario llevar a cabo un anlisis cromatogrfico que
permita la separacin de los compuestos. Pero, en la mayora de los casos, el perfil
cromatogrfico obtenido mediante un detector convencional (un FID o un MSD) no
coincide con el perfil aromtico del producto [5]. Y es que existen numerosos
compuestos voltiles que no presentan olor y que, por tanto, no participan en el
aroma, pero que, si se hallan en concentraciones elevadas, proporcionan picos
cromatogrficos importantes. Por el contrario, hay odorantes de los que no se
consigue seal instrumental porque se encuentran en concentraciones inferiores al
lmite de deteccin del detector. Sin embargo, sus umbrales de percepcin son tan
sumamentebajosquecontribuyenalaromaengranmedida.Aspues,paradistinguir
entre la totalidad de la fraccin voltil de un alimento aquellos compuestos que
presentanoloryque,portanto,puedenparticipardesuaroma,esnecesarioacoplar
alacromatografadegasesladeteccinolfatomtrica(GCO).

3.2.LACROMATOGRAFADEGASESOLFATOMETRA

Poco tiempo despus de inventarse la cromatografa de gases en 1952 [6], los


perfumistasylosinvestigadoresdelaindustriadelflavorcomenzaronaoler(sniff
eningls)elgasqueefluadelcromatgrafo.En1964,Fuller,SteltenkampyTisserand
publicaronporprimeravezladescripcindelcromatgrafodegasesmodificadoque
permitaalanarizhumanaactuarcomodetectorcromatogrfico[7].Deestamanera
se iniciaba una nueva etapa, que constitua toda una revolucin en el anlisis del
aroma: poder asignar descriptores olfativos a los picos cromatogrficos y, ms an,
detectar con la nariz olores originados por compuestos que los detectores
instrumentales no conseguan registrar. Y, aunque durante los ltimos aos la
sensibilidad de los detectores qumicos se ha incrementado enormemente,
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 61

logrndoserebajarengranmedidaloslmitesdedeteccin,lanarizhumanacontina
siendomuchomssensibleaalgunassustanciasquecualquierotrodetector.

En general, la cromatografa de gasesolfatometra, o GCO, consiste en evaluar


con la nariz humana las cualidades aromticas de los compuestos que eluyen de la
columnacromatogrfica,alavezqueeldetectorinstrumentalinstaladoproporciona
un cromatograma. De esta manera se pueden asignar olores a los picos y/o
determinarse a qu tiempos de retencin se detectan olores. As, tal y como puede
verseenlaFigura3.1,ladeteccinolfatomtricaylainstrumentalsonsimultneas,lo
quepermiterelacionarlainformacinsensorialconlainformacinqumica.

EXTRACTO AROMTICO

FIDoMSD
INYECTOR

O VEN
TEMP 220
FLOW 1.6
Ins trument 1(offline): D ataAnalys is
File G raphics Integration Calibration
Data An alysis P IST0 6 5 . D P ISTA C HO.M
FID1 A, (LAURA\PIST065.D)
pA

100
80
60
40
20

0 5 10 15 20 25 30 35 40 45 m

GC Fi le P IST0 6 5 .D 1 Area Width H eight

File P ath C :\HP C HEM \1 \DATA 2

Date 2 4 0 9 0 9 3

Samp le 4

FID1 A, (LAURA\PIST065.D)
pA

100
80
60
40
20

0 5 10 15 20 25 30 35 40 45 mi

AZUFRADO QUESO ESTABLO


AZUL
MANTEQUILLA CHAMPIN PAPEL ROSAS REGALIZ
FRESA PATATAS MERMELADA PIMIENTA
RANCIO PLTANO COCIDAS AHUMADO

0 5 10 15 20 25 30 35 40 45 min

Figura3.1.Esquemadelanlisiscromatogrficoolfatomtrico

En un anlisis por GCO es necesario introducir un extracto aromtico


representativo del producto a analizar en el cromatgrafo de gases a travs del
puertodeinyeccin.Traslaseparacindelosdistintoscomponentesdelamezclaen
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
62 Captulo3

lacolumnacapilarcromatogrfica,alasalidadelamismasedivideelflujo.Unaparte
delefluentesedirigealdetectorqumico(FIDoMSD)mientrasquelaotravahaciael
puertoolfatomtricolocalizadofueradelcromatogrfoydondesesitaunanalista.

En los primeros estudios en los que se emple la GCO, se ola el efluente que
saladirectamentedelcromatgrafo.Perosteeraungassecoymuycaliente,loque
provocabaladeshidratacinnasaldequienesllevabanacabolosanlisis.Ademsde
ser un procedimiento sumamente incmodo, disminua la capacidad olfativa de los
analistas, lo que se traduca en problemas de reproducibilidad. Por ese motivo, en
1971sediseelprimercromatgrafodegasescondetectorolfatomtricoreal,en
elquesemezclabaelefluentecalientequesaladelacolumnaconairehumidificado
[8](aunqueanhoyendahayalgunosanalistasquetrabajanoliendoeseefluentesin
humidificar). Desde entonces se han introducido distintas mejoras y actualizaciones
enlainstrumentacinparahacermscmodoyergonmicoelanlisis.Tambinpara
facilitarelregistrodelosdatosyasegurarlacorrectatransferenciadelosodorantes
hasta el sniffer o cono olfativo sin prdidas por la condensacin. En esencia, el
sistema aqu descrito es el que se utiliza actualmente en casi todos los detectores
olfatomtricos.

De esta forma, los compuestos que presentan olor pueden distinguirse entre
todos los voltiles de un alimento. Sin embargo, la cromatografa de gases
olfatometraporssolanoessuficiente.Cuandosetrabajaenelcampodelaromaes
necesario identificar los odorantes ms potentes, determinar cul es la importancia
relativadecadacompuestoenelaromaglobal.Sloassepuedeaveriguarquines
sonlos key odorants, las sustanciasa las quese debe elquecadaproducto huela
como lo hace. Por este motivo, desde la aparicin de la GCO se han desarrollado
distintastcnicasolfatomtricasconelfindeevaluarlaimportanciasensorialdelos
compuestos aromticos. Cada una de estas tcnicas presenta sus ventajas e
inconvenientes[911],ydebeserelanalistaquien,enfuncindesusobjetivos,elija
unauotra.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 63

3.2.1.Lastcnicasolfatomtricas

En 1957, poco despus de la invencin de la cromatografa de gases, Patton y


Josephson [12] propusieron relacionar la concentracin de un compuesto con su
umbralsensorialmedianteunvalorque expresarala efectividadaromtica.Perono
fuehasta1963(unaoantesdeldesarrollodelaGCO),cuandoRotheyThomas[13]
evaluaronporvezprimeralacontribucinsensorialdeuncompuestoalaromadeuna
sustancia al calcular su valor de aroma: el cociente entre su concentracin en la
matrizysuumbraldepercepcinendichamatriz.As,paraundeterminadoalimento,
los compuestos olorosos con un valor de aroma superior a la unidad sern los que
ms influirn en el aroma de ese alimento, contribuyendo tanto ms cuanto mayor
sea el valor. Sin embargo, esta forma de evaluar la importancia sensorial de los
odorantesrequiereunacuantificacinyunadeterminacindelumbraldepercepcin
paracadacompuestoencadamatriz,loqueimplica untrabajolargoytedioso que,
cuando no sea posible la cuantificacin, no podr llevarse a cabo [4]. Adems, tal y
comoyaseexplicenelapartado2.2.4deestatesisdoctoral,elclculodelosvalores
dearomanotieneencuentalosefectossinrgicosyantagnicosquepuedendarse
entre compuestos. Tambin correlaciona linealmente concentracin e intensidad
percibida,cuando,enrealidad,larelacinentreestosparmetrosesexponencial.

De ah que, con el paso de los aos, se haya intentado estimar la contribucin


sensorial de los diferentes odorantes al aroma de un determinado producto de una
forma ms sencilla que calculando los valores de aroma para cada uno de esos
odorantes. Para ello se han desarrollado distintas tcnicas olfatomtricas que
recopilan y procesan los datos obtenidos a travs de la GCO, y que se clasifican en
cuatro grupos en funcin del tipo de medida que lleven a cabo: las tcnicas de
dilucin,lastcnicasdefrecuenciadedeteccin,lastcnicasdetiempointensidady
lastcnicasdeintensidadposterior.

Enelartculoqueseadjuntaalfinaldeestecaptulo,tituladoLacromatografa
de gases con detector olfatimtrico: una herramienta esencial para el anlisis del
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
64 Captulo3

aromadebebidasalcohlicas,ypublicadoenlarevistaCervezayMalta2009;XLVI
(2);182:4962,sedetallantodasestastcnicasconsusventajaseinconvenientes,por
loqueacontinuacin,stassedescribennicamentedeformasomera.

Lastcnicasdedilucin

Enestastcnicas,elextractoaromticoobtenidoseanalizamedianteGCOpara
determinarlostiemposde retencinenlosqueaparecenolores. A continuacin,se
diluye sucesivamente dicho extracto (normalmente, con el mismo disolvente
empleadoensuobtencin),yseanalizacadadilucinolfatomtricamentehastallegar
a aqulla en la que no se detecta ningn olor en el efluente de la columna
cromatogrfica.Esdecir,hastaquelaconcentracindelodorantequeoriginaelolor
es inferior a su umbral de percepcin. Para cada uno de los olores percibidos
inicialmentesedeterminaentoncessufactordedilucin(FD):laltimadilucinenla
que se ha detectado su olor. Cuanto mayor es el FD de un olor (o ms alta es la
dilucinenlaquestesehadetectadoporltimavez),mayoressucontribucinal
aromadelproductoqueseestanalizando[911].

ElCHARM(CombinedHedonicAromaResponseMeasurements),desarrolladopor
Acreeetal.en1984[14]yelAEDA(AromaExtractDilutionAnalysis),desarrolladoen
1987porGroschetal.[15,16],sonlasdostcnicasdedilucinmsimportantes.Enla
primera,losanalistasdebendescribirelolorquedetectaneindicarelmomentoenel
questeempiezayacaba.Lasegundaesanmssencilla,yaqueenella,losanalistas
slotienenquedescribirelolorpercibido.

Dentro de las tcnicas de dilucin tambin se engloba el AECA (Aroma Extract


ConcentrationAnalysis)desarrolladoen1997porKerscheryGrosch[17]yenelque
seanalizanmedianteGCOconcentracionessucesivasdelextractoobtenido.Mientras
que en el AEDA los compuestos voltiles se extraen de la matriz e inicialmente se
concentran para conseguir el extracto que posteriormente se ir diluyendo, en el
AECA,dichoscompuestosseaslandelamatrizypasanaanalizarseporGCO.Luego
se elimina de forma sucesiva el disolvente, de manera que el extracto se va
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 65

concentrando.Decadapasodeconcentracinserealizaunanlisisolfatomtrico.De
este modo se evitan posibles prdidas de odorantes por la dilucin sucesiva del
extractoaromtico.Tambinsepuedendeterminarlosoloresquesepierdendurante
laconcentracin.

Lastcnicasdefrecuenciadedeteccin

Estastcnicasfueronempleadasporprimeravezen1993porLinssenetal.[18],
aunque no fue hasta 1997 cuando Pollien et al. [19] desarrollaron y formalizaron el
mtodo. En ellas, un panel de analistas analiza un mismo extracto aromtico
medianteGCO.Paracadaindividuoseregistranlostiemposderetencinenlosque
se detectan olores y la descripcin y duracin de los mismos. Tras los anlisis, se
determinaelnmerodeanalistasquepercibencadaolor,demaneraquelosolores
detectados con mayor frecuencia son los que presentan una mayor importancia
relativa.Estoserelacionaasuvezconunamayorintensidadaromtica.Assepuede
dibujar un aromagrama, un perfil aromtico del producto analizado en el que se
enfrenta la frecuencia de deteccin (en %) con los tiempos de retencin. En este
aromagrama, mientras la altura del pico (que se denomina NIF: nasal impact
frequency) corresponde al nmero de analistas que han detectado un olor a ese
tiempo de retencin, el rea se relaciona con la duracin del olor (y se denomina
SNIF:surfaceofnasalimpactfrequency)[911].

Lastcnicasdetiempointensidad

En las tcnicas de tiempointensidad, los analistas deben evaluar la intensidad


delolorpercibido,ascomodescribirloyregistrarsuduracin.Laprimeratcnicade
estascaractersticasfuedesarrolladaen1990porMcDanielysuscolaboradores[20,
21] y la denominaron OSME. En ella, el analista evala la intensidad del olor en un
rango de 0 (intensidad nula) a 15 (mxima intensidad) moviendo un indicador
electrnicoconectadoaunsistemainformticoalolargodeunaescalade150mm.
Alenfrentarlasintensidadesdelosoloresconeltiempoderetencinseobtieneun
osmeograma, una representacin grfica de la importancia sensorial de los
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
66 Captulo3

compuestos en el aroma global de la sustancia. Pero esta tcnica presenta algunas


dificultadesparalosanalistas,sobretodoalahorademarcarlaintensidadutilizando
el dispositivo indicador. Por ese motivo se desarroll posteriormente la Finger Span
Crossmodality Matching (FSCM), otra tcnica en la que el analista seala la
intensidaddelolorpercibido,peroestavezseparandoeldedopulgardelndiceoel
corazn mediante un aparato: a mayor intensidad, mayor distancia entre los dedos
[22, 23]. Y, aunque en estas tcnicas se reduce considerablemente el tiempo de
anlisis con respecto a las de dilucin, la subjetividad de los analistas est ms
presente[911].

Lastcnicasdeintensidadposterior

Comoenlasanteriores,enestastcnicastambinsemidelaintensidaddelolor,
pero en una escala previamente fijada y una vez que el odorante ha eluido de la
columnacromatogrfica.Elanlisisolfatomtricolorealizaunpaneldeanalistas.Para
un olor, el valor de intensidad que se le asigna es la media de las intensidades
proporcionadasporcadaindividuo,conloquesereducelasubjetividad.Sinembargo,
elmayorproblemaquepresentaestatcnicaeselusodelaescalaporpartedelos
analistas:lapercepcindelamismadifiereconsiderablementedeunindividuoaotro
y no es posible proporcionar los valores de referencia mientras se est llevando a
caboelanlisisolfatomtrico[911].

3.2.2.LimitacionesdelaGCO

Todas las tcnicas olfatomtricas desarrolladas presentan, como ya se dijo


anteriormente, ventajas e inconvenientes. Adems, cada una de ellas se basa en
principios diferentes, por lo que su aplicacin a una misma muestra proporciona
tambinresultadosdiferentes.As,compuestosconumbralesdedeteccinmuyaltos
pueden presentar FD obtenidos por AEDA y valores CHARM muy bajos, pero unas
respuestasmuyaltassiseaplicanlastcnicasdefrecuenciadedeteccinodetiempo
intensidad. O compuestos con el mismo FD para AEDA e idntica frecuencia de
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 67

deteccinpuedenpresentarvaloresCHARMmuydistintosenfuncindequeeluyan
durantemsomenostiempo[10].Deestemodo,segnlosobjetivosquesebusquen
o los requerimientos que se impongan, ser ms adecuado emplear una tcnica u
otra, para seleccionar y clasificar los odorantes de acuerdo con su potencia y/o su
intensidadaromtica[24].

De forma general, las tcnicas ms rpidas son las de frecuencia de deteccin,


seguidasporlasdetiempointensidad,mientrasquelasdedilucinrequierentiempos
de anlisis considerablemente ms largos. En cuanto a la facilidad para llevarlas a
cabo, las de frecuencia de deteccin son las ms sencillas, seguidas por las de
dilucin.Lasmscomplejassonlasdetiempointensidadporquerequierenunpanel
deanalistasadecuadamenteentrenado[25].

Todasestastcnicashandemostradoestarcorrelacionadasentresypresentar
sensibilidadessimilares[25,26].Sinembargo,sisecomparanlatcnicadefrecuencia
de deteccin y la de intensidad posterior, la primera presenta una mayor
repetitividad,mientrasquelasegundadiscriminamejorentrelosdistintosnivelesde
concentracin de los odorantes [26]. No obstante, comparando los resultados
obtenidos a partir de una evaluacin sensorial con los resultados de
intensidad/concentracin que proporciona cada una de las dos tcnicas, todos son
similares[27].

En las tcnicas de dilucin, un analista puede no percibir un odorante en una


dilucin, pero s detectarlo en diluciones superiores [28], motivo por el cual, las
tcnicasdefrecuenciadedeteccinylasquemidenintensidadessonmsadecuadas
alahoradecompararmuestrasdiferentesorealizaranlisiscuantitativos[27,29,30].
Sin embargo, y aunque estos dos tipos de tcnicas s que cumplen las leyes
psicofsicasdelapercepcin,lainformacinqueproporcionannoesunamedidareal
delpapelquejuegauncompuestoenelaromadeunasustancia,porquenosepuede
asegurar que la concentracin de ese compuesto que llega a la nariz del analista
duranteelanlisiscromatogrficosealamismaquecuandosehueledirectamenteel
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
68 Captulo3

producto.Porsuparte,lastcnicasdedilucinsonlasidneassiloquesepretende
esjerarquizarlosodorantesenfuncindesucontribucinsensorialalaroma,yaque,
segn el principio en el que se basan, potencia odorfera e intensidad del estmulo
aromticonotienenporquestardirectamenterelacionadas[10].

Pero,ademsdelaspropiaslimitacionesquepresentacadaunadelasdistintas
tcnicas olfatomtricas, esnecesario considerar aqullas queaparecen por elhecho
de emplear la nariz humana como detector cromatogrfico y que principalmente
influyen sobre la reproducibilidad del anlisis [10, 31]. Es el caso del cansancio y la
saturacin sensorial que puede sufrir el analista y que afectan negativamente a la
calidaddelosdatosobtenidos.Paraevitarlo,debenacortarselostiemposdeanlisis.
Tambinhayquetenerencuentaqueelordendeelucin,laidentidadaromticayla
intensidad percibida para un determinado compuesto pueden afectar de forma
directaalaintensidadconlaquesepercibeelodorantequeeluyeinmediatamente
despus de l. Una manera de eliminar este efecto es modificar la elucin de los
compuestos variando algunos parmetros cromatogrficos (temperatura, presin) o
cambiando el tipo de columna empleada. Adems, el orden en el que eluyen los
compuestos puede llegar a memorizarse, lo que origina fenmenos de anticipacin:
se sabe qu olor ser el siguiente en detectarse y se le espera, lo que reduce la
objetividad. Por ese motivo se debe alternan el orden de los analistas o introducir
blancosentrelasmuestras.

Asimismo, el ambiente en el que se realiza el anlisis debe reunir una serie de


requisitos,yaquepuedeinduciraquesecometanerroresdepercepcin[10,31].Los
ruidos, las distracciones, los olores extraos o las condiciones de anlisis poco
confortablesdebenevitarse.Loidealesllevaracaboelanlisisolfatomtricoenuna
habitacinaisladaytranquila,conunapresindeairepositivaparaevitarlaentrada
de olores extraos y que cuente con un sistema de aireacin que filtre el aire. Para
asegurarelconfortdelanalista,latemperaturadebeserlaadecuadaylaposicinen
la que se realiza el anlisis, cmoda, preferiblemente sentado. Para evitar la
deshidratacindelasfosasnasales,eleluyentedebemezclarseconairehumidificado.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 69

Tambin hay que tener en cuenta la sensibilidad de los analistas y si han sido
entrenadosono[10].Cadaindividuotieneunumbraldedeteccindistintoparacada
compuesto, con lo que los valores de percepcin pueden variar mucho entre
analistas.Adems,comoyaseexplicenelapartado2.1.3deestatesisdoctoral,hay
personas que presentan anosmias y que, an sin haber perdido el sentido del
olfato,sonincapacesdedetectarelolordealgunoscompuestosodealgunasfamilias
de compuestos. Esto supone un problema en el caso de las tcnicas de dilucin,
dondesloseempleanunoodosanalistas,aunqueenelrestodetcnicassesolventa
utilizandounpaneldeanalistas.Encuantoalentrenamientodelosindividuos,stees
un proceso indispensable para la obtencin de resultados fiables. Slo tras un
correcto entrenamiento se mejoran la precisin y exactitud de los datos
olfatomtricos obtenidos y se adquiere un vocabulario comn que facilita el
entendimiento a la hora de describir las cualidades aromticas percibidas por los
distintosindividuos.

En ltima instancia, caracterizar adecuadamente el aroma de un producto


mediante la cromatografa de gasesolfatometra depende del extracto aromtico
obtenido. La tcnica de pretratamiento de muestra empleada para aislar los
compuestos voltiles de la matriz debe proporcionar un extracto representativo del
aroma que se quiera analizar. Sin embargo, esto no es sencillo, dado el elevado
nmero de voltiles presentes en cada alimento, con muy diferentes propiedades
fsicasyqumicas,yelampliorangodeconcentracionesenlasquepuedenaparecer.

3.2.3.Obtencindeextractosaromticosrepresentativos

Cuando se habla de la representatividad de un extracto aromtico se hace


referencia al hecho de que ese extracto debe contener, no slo los voltiles
responsables del aroma del producto, sino que, adems, esos voltiles deben
aparecerenlasmismasproporciones enlasqueseencuentranenlamatriz.Perola
representatividaddelextractodependedelobjetivodelainvestigacin,porloqueno
hayqueconsiderarlaentrminosabsolutos.Porquenoeslomismoquerercuantificar
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
70 Captulo3

una determinada familia de compuestos, para lo que se necesitar que la


recuperacin de los analitos de inters sea elevada, que comparar el aroma de dos
muestrasdiferentes,dondeloquesebuscaesextraerlosodorantesmsimportantes
ycaractersticos.

Como ya se mencion en el apartado 2.3.2, y ms concretamente en el


subapartado2.3.2.1quetratasobrelastcnicasdepretratamiento,nohayunanica
tcnicaidealparalaextraccindelosvoltilesdeunalimento.Sonvarioslosfactores
quehayquetenerencuentay,enfuncindelamatriz,deloscompuestosaanalizar
y,sobretodo,delosobjetivosperseguidos,sermsconvenienteemplearunayno
otra, aunque casi siempre ser necesario llegar a un compromiso [32]. En cualquier
caso, hay que tener presente que todas las tcnicas presentan ventajas e
inconvenientes[911],porloquedebeserelanalistaquienevalelasituacin,valore
cadaunodelospuntosaconsideraryfinalmente,decida.

En ese mismo apartado del captulo 2 tambin se describen los distintos


mtodosqueseempleanhabitualmenteenlaobtencindeextractosaromticos,con
lo que a continuacin se explican con ms detalle nicamente las dos tcnicas que
han sido utilizadas a lo largo del desarrollo experimental de esta tesis doctoral: la
microextraccin en fase slida (SPME) y la extraccin directa con disolvente (DSE)
seguidadehighvacuumtransfer(HVT).

3.2.3.1.Microextraccinenfaseslida

Lamicroextraccinenfaseslida,osolidphasemicroextraction(SPME),esuna
tcnica de preparacin de muestra desarrollada a principios de los aos 90 por
Pawliszynysuscolaboradores,enlaquenoseempleandisolventesorgnicosyque
permite la extraccin y concentracin de los analitos de inters en una sola etapa,
reducindosedeformaconsiderableeltiempodeanlisis[33,34].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 71

Enella,seutilizaunafibradeslicefundidade
d
pequeasdimensiones.Comopuedeobservarseen
la Figura 3.2,la fibra est recubierta por una fase
estacionariapolimrica(enalgunoscasos,mezclada
conunslidoadsorbente),queescapazderetener
los analitos (a). Va protegida en el interior de una
c
aguja de acero inoxidable (b), la cual, a su vez, se
instala en una jeringa modificada o holder (c)
mediante un simple sistema de rosca. Al presionar
haciaabajoelmbolodelholder(d)sedesenvaina
b
la fibra del interior de la aguja, con lo que la fase
a estacionaria de la fibra queda expuesta a la

muestra. Al subir el mbolo, la fibra vuelve al
Figura3.2.Esquemadel
dispositivodelaSPME interiordelaaguja.

Estatcnicanoprecisadeningunainstrumentacinadicional,apartedelholder,
ypuedeaplicarsedeformasencillaamuestrasslidas,lquidasogaseosas.Adems,y
encomparacinconotrastcnicasdepretratamiento,laSPMEempleacantidadesde
muestra considerablemente menores. Como se muestra en la Figura 3.3, se puede
llevaracabodedosformasdiferentes.Enlaprimera(a),lafibraseexponealespacio
decabezaoheadspacedelamuestra(HSSPME),conloquelaextraccintienelugar
en la fase gaseosa. Es el procedimiento ms utilizado, recomendado para analizar
matricescomplejasocuandosetrabajaconcompuestosvoltiles.Enelsegundo(b),
lafibrasesumergedirectamenteenlamuestra(DISPME),porloquelaextraccinse
lleva a cabo en la fase lquida. Se utiliza con analitos no muy voltiles y muestras
limpias, pero an as, esta forma de extraccin reduce el tiempo de vida til de la
fibra,porloquesuempleonoesttanextendidocomoeldelaHSSPME.

Enamboscasos,elprocesodemicroextraccineselmismo.Unavezintroducida
lamuestrajuntoconunpequeoimnenunvial,stesecierrahermticamentecon
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
72 Captulo3

un septum (paso I de la Figura 3.3). Tras acondicionar o limpiar la fibra, sta se


introduceenelvialatravesandoelseptumconlaagujaquelaaloja.Acontinuacin,se
empujaelmbolodelholderhastaquelafibraquedafueradelaagujayexpuestaal
headspace o a la propia muestra. Entonces tiene lugar la extraccin de los analitos,
favorecidaporlaagitacinconstantedelamuestraporelimn(pasoIIdelaFigura
3.3). Segn las caractersticas de la fase estacionaria, dicha extraccin seguir un
procesodeadsorciny/oabsorcin.Unavezalcanzadoelequilibrioentrelasfases,la
extraccinyconcentracinsimultneasfinalizan,conloqueslorestasubirelmbolo
delholderparaguardarlafibradentrodelaaguja.Porltimo,seretirastadelvial
(pasoIII de la Figura 3.3)y se procede a la desorcin posterior de losanalitos de la
fibra.

a)HSSPME b)DISPME

Holder

Agujacon
lafibra

Vial
encapsulado

Muestra
Imn

I II III I II III
Figura3.3.EsquemadelprocedimientodelaSPME,(a)sobreelespaciodecabezay(b)directa.

Elprocesodeladesorcinvaraenfuncindeltipodeseparacincromatogrfica
que se vaya a llevar a cabo: mientras que para la cromatografa lquida (HPLC) es
necesario utilizar un disolvente en una interfase previa al cromatgrafo de lquidos,
enelcasodelacromatografadegasesladesorcinestrmica[35].Enestesegundo
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 73

supuesto nicamente hay que introducir la aguja en el inyector del cromatgrafo


atravesando el septum y empujar el mbolo del holder para exponer la fibra a una
temperaturaelevada(200300C).Ladesorcindelosanalitosesinstantnea,yestos
pasandirectamentealacolumnacromatogrfica.Asuvez,laexposicindelasfibras
alasaltastemperaturasdelinyectortambinesnecesariaparaelacondicionamiento
delasmismasantesdesuprimerusoyparasulimpiezaentreanlisis.

Elfundamentotericodelamicroextraccinenfaseslidasebasaenunproceso
de equilibrio o particin de los analitos entre mltiples fases. Si se considera la DI
SPME,elequilibrioseestableceentrelamatrizylafaseestacionariadelafibra.Pero
sihablamosdelaHSSPMEhayqueconsiderarlosequilibriosqueseestablecenentre
lamatriz,elheadspaceylafaseestacionaria[34,36,37].Encualquiercaso,distintos
parmetrosinfluyenenestosequilibriosy,porlotanto,enlacantidaddeanalitoque
puedeextraerse:eltipoderecubrimientodelafibra,eltiempoylatemperaturade
extraccin,elvolumenylafuerzainicadelamuestra,eltipodeanalito,etc.Poreste
motivo, y con el objetivo de obtener los mejores resultados posibles, es necesario
optimizar cada una de estas variables antes de llevar a cabo un anlisis mediante
SPME.

Tiposdefibras

En el mercado existen varios tipos de fibras. Se diferencian en el grosor y la


polaridaddesusfasesestacionarias,loquedeterminalacantidadyeltipodeanalito
que permiten extraer. Adems, segn cmo estn inmovilizadas las capas de fase
estacionaria sobre la fibra de slice fundida, encontramos fases ligadas, no ligadas,
parcialmente entrecruzadas o fuertemente entrecruzadas (Figura 3.4). Las fases no
ligadas son estables en algunos disolventes orgnicos miscibles con el agua, aunque
puedenhincharsesiseusandisolventes apolares.Por suparte,lasfasesligadasson
estables en todos los disolventes orgnicos, a excepcin de algunos apolares. Y en
cuanto a las fases entrecruzadas, todas, tanto las parcial, como las fuertemente
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
74 Captulo3

entrecruzadas,sonestablesenlamayoradelosdisolventesorgnicosmisciblescon
elagua,ademsdeenalgunosapolares[35].
Polaridad

PEG(60m)

PDMS/DVB(60m) PDMS/DVB(65m)

PA(85m)
DVB/CAR/PDMS
(50/30m)

CAR/PDMS(75m) CAR/PDMS(85m)

PDMS(7m) PDMS(30m) PDMS(100m)

Capacidad deextraccin

Figura 3.4. Propiedades de las fases estacionarias de las fibras de SPME comerciales. PDMS:
polidimetilsiloxano; DVB: divinilbenzeno; PEG: carbowaxpolietilenglicol; PA: poliacrilato; CAR: carboxen.
Fases ligadas ; noligadas ; parcialmente y fuertemente entrecruzadas.

Las fibras sern tanto ms afines a un tipo de analito cuanto ms semejantes


seana dichoanalito en trminos de polaridad. De este modo, las fibras apolaresde
polidimetilsiloxano (PDMS) estn recomendadas para la extraccin de compuestos
voltiles apolares, mientras que las fibras polares de poliacrilato (PA) son ms
efectivas para la extraccin de compuestos muy polares. Respecto a las fibras con
mezclasdefasesestacionarias,losefectosdeadsorcin/absorcinydistribucindela
fase estacionaria se ven mutuamente potenciados, con lo que se incrementa la
capacidaddeextraccin[35,36].As,lasfibrasdepolidimetilsiloxano/divinilbenceno
(PDMS/DVB) se utilizan para la extraccin de compuestos voltiles polares de bajo
pesomolecular.Lasdedivinilbenceno/carboxen/polidimetilsiloxano(DVB/CAR/PDMS)
son aptas para extraer un amplio rango de analitos con valores de peso molecular
entre40y275.

En cuanto al grosor de la fase estacionaria, se ha comprobado que los


recubrimientosmsgruesosfavorecenlaextraccindeloscompuestosmsvoltiles.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 75

Las fases ms finas son ms efectivas con los semivoltiles. Adems, las fibras con
fases estacionarias ms gruesas presentan una mayor sensibilidad al poder extraer
ms cantidad de analito. Sin embargo, tambin necesitan de tiempos de extraccin
mslargosparaalcanzarelequilibrio,puestoqueladifusindelosanalitosenlafase
estacionariaresultamsdifcil[34].

Adems de las fibras comerciales anteriormente descritas, han comenzado a


desarrollarse nuevas fases estacionarias, como los molecularly imprinted polymers
(MIPs) o los materiales de acceso restringido (RAM) [38, 39], con el objetivo de
incrementar la afinidad y selectividad de la SPME. Los primeros consisten en
receptoressintticosquenicamenteinteraccionanconlasmolculasquepresentan
una determinada geometra y grupo funcional. Los segundos son materiales
especiales capaces de fraccionar la muestra, de forma que los componentes ms
grandes de la matriz (protenas, cidos nucleicos, etc.) no son adsorbidos, mientras
quelosanalitosdeinters(debajopesomolecular)sonextradosyconcentradosen
elinteriordelafaseestacionaria.

Variablesdeextraccin

Como ya se ha comentado previamente, la eficacia de la extraccin no slo


dependedeltipodefibraempleada,sinotambindeotrosfactoresqueinfluyenen
ella y que deben ser optimizados: el tiempo y la temperatura de extraccin, la
agitacin,lafuerzainica,elpHyelvolumendemuestra.

Eltiempodeextraccinvienedeterminado,principalmente,porlavelocidadde
agitacinyporelcoeficientedeparticindelosanalitosentrelafaseestacionariayla
matrizdelamuestra,sisetratadeunaextraccindirecta(DISPME),oentrelafase
estacionaria,lamatrizylafasegaseosaquehaysobrelamuestra,siesunaextraccin
sobreelespaciodecabeza(HSSPME).Encualquiercaso,yaunquelasensibilidades
mxima en el punto de equilibrio, no es necesario alcanzar estas condiciones para
obtenerunosbuenosresultadosencuantoaprecisinyexactitud,yaqueexisteuna
relacin lineal entre la cantidad de analito retenido por la fibra y su concentracin
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
76 Captulo3

inicial en la matriz. Sin embargo, en estas condiciones de noequilibrio hay que


controlar minuciosamente el tiempo a lo largo de las distintas extracciones, para
asegurarlarepetitividaddelproceso[35].

Otrodelosparmetrosqueesimportantecontrolar,dadoqueafectatantoala
sensibilidadcomoalacinticadeextraccin,eslatemperatura,delacualdependen
los coeficientes de particin. En el caso de la HSSPME, aunque el aumento de la
temperaturafavoreceelpasodemsanalitosdelamatrizalheadspace,tambinhace
quedisminuyanloscoeficientesdeparticinentrelafibraylafasegaseosa,yaqueel
proceso de extraccin de la fibra es exotrmico [35, 36]. Para solventar este
problema,yenelcasodequeseanecesariocalentarconsiderablementelamuestra,
Zhang y Pawliszyn [40] desarrollaron un dispositivo complejo que enfra la fibra
mediante CO2 lquido y que se ha probado en la extraccin de compuestos en
distintasmatricesconmuybuenosresultados[41].

Encuantoalaagitacindelamuestra,staaceleraeltransporteconvectivode
los analitos de la matriz a la fibra. Y, aunque al aumentar la velocidad de agitacin
disminuyeprogresivamenteeltiempodeextraccinnecesarioparallegaralequilibrio,
una agitacin excesiva e incontrolada puede provocar cambios en el tiempo que se
tardaenalcanzarelequilibrio,conlaconsiguientedisminucindelaprecisin[35].

Otrodelosfactoresquemejoranlaeficaciadelaextraccineslavariacindela
fuerzainicadelasmuestrasmediantelaadicindesalessolubles.Elclorurosdico,
elsulfatoamnicoyelcarbonatopotsicosonlassalesmsutilizadas.Enprincipio,si
lasmuestrassesobresaturanconellas,seincrementalaextraccindeloscompuestos
apolares.Sin embargo, es preferible adicionarlas cuandose trabajacon la HSSPME,
yaque,siseutilizalaDISPME,lafibrapuedeterminardaada[35,36].

EncuantoalpH,leselresponsabledelaformainicaenlaqueseencuentran
losanalitosenlamuestra,conloquetambininfluyeenlaeficaciadelaextraccin.
Cambios en su valor pueden mejorar la sensibilidad de la SPME para analitos con
cierto carcter cido o bsico. En general, la muestra se acidifica para extraer los
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 77

analitos cidos y se alcaliniza para extraer los bsicos, aunque siempre teniendo en
cuenta que, si se trabaja con la fibra sumergida, valores extremos de pH pueden
daarla[35].

Yporltimohayqueconsiderarelvolumendemuestra.Cuandosetrabajacon
HSSPME,esnecesariominimizarelvolumendelafasegaseosaparafavorecerelque
losanalitosseacumulenenelespaciodecabeza,yasaumentarlasensibilidad.Sise
trabajaconDISPMEylaconstantededistribucindelanalitoentrelafibraylamatriz
es elevada, entonces tambin es necesario emplear volmenes de muestra
considerables, aunque, si estos volmenes son lo suficientemente grandes, la
cantidaddeanalitoextradaesindependientedeestavariable[34].

Variablesdedesorcin

Si los analitos extrados y concentrados por la fibra de SPME se van a analizar


mediante cromatografa de gases, su desorcin es trmica y se lleva a cabo
directamenteenelpuertodeinyeccindelcromatgrafo.Losprincipalesfactoresque
afectanalaeficaciadedichadesorcinsonlavolatilidaddelosanalitos,elgrosorde
lafaseestacionariadelafibra,latemperaturadelinyector,yeltiempodeexposicin
delafibraalmismo[35,42].

Normalmente, la temperatura del inyector para proceder a la desorcin se


encuentraentre150y250C,aunque,deformageneral,elvalorptimocoincidecon
el punto de ebullicin del analito menos voltil. Para mejorar la resolucin
cromatogrfica, el inyector debe operar en el modo splitless y adems se debe
emplearunlinerestrecho,de0,75mmdedimetro,paraevitarelensanchamientode
lospicoscromatogrficos.Eltiempodeexposicindelafibraalinyectordependede
latemperatura,perosepuededecirqueladesorcinesinstantnea,yqueenunos
pocossegundostodoslosanalitoshansidodesorbidos.Sinembargo,esaconsejable
mantener la fibra expuesta durante algunos minutos para limpiarla y eliminar el
posibleefectomemoriaenposterioresanlisis[35,36].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
78 Captulo3

AplicacindelaSPMEenelanlisisdelaromadealimentos

La microextraccin en fase slida se emple inicialmente como tcnica de


extraccindecontaminantesorgnicosenagua[33,43],aunquepocodespusdesu
aparicin comenz a utilizarse como tcnica de pretratamiento de muestras para el
anlisis del aroma de los alimentos. Como se ha comentado anteriormente, esto se
debeasusencillezinstrumentalyfcilaplicacinsobremuestrastantoslidas,como
lquidas o gaseosas. Tambin, a que proporciona buenos resultados cuantitativos y
cualitativos, y supone un considerable ahorro de tiempo con respecto a las tcnicas
tradicionalesgraciasalaextraccinyconcentracinsimultneas[44,45].Adems,si
laSPMEseutilizasobreelespaciodecabezadelamuestra,elextractoaromticoque
se obtiene es lo ms parecido a lo inhalado por un individuo cuando huele un
alimento, porque se trata de la fraccin realmente voltil que llega hasta sus fosas
nasales.

Porestemotivo,laSPMEsehaaplicadoenelanlisistantodelaroma,comode
los offflavors u olores anmalos de muy distintos productos alimenticios: frutas y
vegetales, cereales, hierbas y especias, bebidas (alcohlicas o no), aceites, salsas,
carnes y pescados, derivados lcteos, etc. [35, 4447]. Pero no se ha utilizado
nicamente para determinar los compuestos mayoritarios del aroma. Tambin ha
demostradoserunatcnicafiable,conunaaltasensibilidadyreproducibilidad,enla
deteccindeodorantesminoritarios:compuestosazufrados[48],pirazinas[49],TCA
[50],etc.

Algunosdeestosodorantespresentanoloresmuyfuertesycaractersticosporlo
que,apesardeaparecerenconcentracionestraza,jueganunimportantepapelenel
aroma global del producto en el que se encuentren. De ah que sea necesaria su
determinacin. En muchos casos, adems de las bajas concentraciones, estos
compuestos presentan otros problemas asociados, como inestabilidad, elevada
reactividad de sus grupos funcionales, baja volatilidad, etc., pero que pueden
solventarse mediante derivatizacin. Y la SPME permite una derivatizacin sobre la
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 79

misma fibra de microextraccin, que, en algunos casos determinados y trabajando


bajo unas condicionesmuy concretas, reduce eltiempo de anlisis y elconsumo de
reactivos[5153].

Todoestohacedelamicroextraccinenfaseslidaunatcnicadepreparacin
demuestraconinfinitasposibilidades.

3.2.3.2.ExtraccindirectacondisolventeHighvacuumtransfer

Extraccindirectacondisolvente(DSE)

Las extracciones con disolventes son tcnicas ampliamente utilizadas para la


obtencin de extractos aromticos de los alimentos. En ellas se produce una
transferencia de los compuestos odorantes desde la matriz hasta un disolvente
orgnico,pudindosedistinguir,talcomoyaseexplicenelapartado2.3.2,entrela
extraccin lquidolquido (LLE), si la muestra es lquida, y la extraccin directa con
disolvente (DSE), si sta es slida. En ambos casos, elfundamentodelmtodo es el
mismo y se basa en la mezcla y agitacin de la muestra con eldisolvente,de forma
manual o automtica, para permitir la extraccin de los analitos de la matriz. La
eficacia de esta extraccin depende del tipo de disolvente que se use, de la tcnica
empleada (que puede ser en continuo o en discontinuo), y del tiempo y la
temperaturadeextraccin[54].

En el caso de la DSE, dado que se trata de matrices slidas, normalmente es


necesariaunahomogeneizacin,unmolidoounmachacadodelasmuestrasantesde
llevar a cabo el procedimiento de extraccin. A veces, como ocurre con las frutas
frescas,inclusodeberealizarseunadesactivacinenzimticaparaevitaralteraciones
de la composicin de la muestra [55]. Tras la extraccin, se procede al decantado y
filtrado de la mezcla y, posteriormente, a la concentracin de la fase orgnica por
evaporacindelamayorpartedeldisolvente,motivoporelqueseprefiereelusode
disolventesconbajospuntosdeebullicin.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
80 Captulo3

Precisamente, uno de los puntos crticos del mtodo es la eleccin del


disolvente,yaquedebereunirunaseriederequisitos.Enprimerlugar,sercapazde
extraerelmayornmerodecompuestostantopolarescomoapolares,perotambin
nopresentarimpurezasytenerunpuntodeebullicinbajo[45,55].

Losdisolventesorgnicosqueseempleanhabitualmentesoneldiclorometano,
elterdietlicoydistintoshidrocarburoscomoelpentanooelhexano,ascomolos
freones y varias mezclas binarias de estos mismos disolventes [55, 56]. Algunos de
estosdisolventes,juntoasuspuntosdeebullicinysison,ono,misciblesenagua,se
detallan en la Tabla 3.1, siendo losdos primeros de la misma losms comunes a la
horadeextraeraromas.

Puntode
Disolvente ebullicin(C) Interaccinconelagua
Diclorometano 45 Inmiscible/msdensoqueelagua

Pentano/terdietlico 35 Inmiscible/menosdensoqueelagua

Freones(mezclahalogenada) <45 Inmiscible/msdensoqueelagua

Hexano 69 Inmiscible/menosdensoqueelagua

Etanol 78 Miscibleconelagua

Acetona 56 Miscibleconelagua

Tabla3.1.DisolventesmscomnmenteutilizadosenlaDSE[55]

En general, el diclorometano puede considerarse como el disolvente ms


universal,yaquetienelaventajadenoserinflamable(loquenoocurreconelresto
de productos, a excepcin de los freones), y presentar un punto de ebullicin
relativamente bajo. Pero si la muestra contiene alcohol, entonces se recomienda
utilizar freones o hidrocarburos. De otra manera, el disolvente (caso del
diclorometanooelterditlico)extraeraeletanol[56].Seobtendraentoncesuna
solucindiluidadevoltilesenetanoly,dadoquestetieneunpuntodeebullicin
elevado, a la hora de concentrar el extracto se perderan numerosos compuestos
aromticos junto con l. En cuanto al ter, al llevar inhibidores para evitar la
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 81

formacin de perxidos explosivos, puede dar problemas de contaminacin en el


anlisiscromatogrfico[54,56].

La extraccin directa con disolventes, y en general, todas las extracciones con


disolventes,presentannumerososinconvenientes.Entreellas,subajaselectividad:al
utilizarse los disolventes orgnicos habituales, no slo se extraen los compuestos
voltiles de la matriz, sino tambin todos aquellos compuestos que presentan
afinidad por dicho disolvente. Estos compuestos pueden tener puntos de ebullicin
altos o no ser voltiles, lo que origina problemas posteriores en, por ejemplo, el
anlisis cromatogrfico. Todo esto, adems, reduce la sensibilidad del mtodo
respecto a los analitos de inters que se encuentren en concentraciones traza [45,
55]. Sin embargo, este problema puede solventarse hasta cierto punto empleando
disolventescondiferentespolaridades.

Tambin hay que tener muy presente la problemtica medioambiental que


supone el uso de disolventes orgnicos. Para conseguir un extracto representativo,
normalmente es necesario emplear grandes volmenes, tanto de muestra como de
disolvente,perolamayoradeestosltimossontxicosy/oinflamables.Adems,los
disolventesdebenserproductosdecalidadyelevadapurezaparanocontaminarcon
trazas de sus propias impurezas los extractos aromticos que se obtengan, lo que
encarece todo el proceso [45, 55]. A esto hay que aadirle la posibilidad de que se
formen emulsiones, sobre todo si la presencia de lpidos es elevada. Para intentar
minimizarlaaparicindeestasemulsionesesaconsejableaplicarunaagitacinsuave
ymantenerelsistemaabajastemperaturas[55,56].

Otro inconveniente de las extracciones con disolvente es que se requieren


prolongadostiemposdeanlisisyunagranmanipulacindelasmuestras,queenla
DSEimplicahastaunafiltracin.Todoestoprovocaprdidasdeanalitosencadauno
delospasos delaextraccinylaposibilidaddesufrircontaminaciones[45].Elpaso
mscrticodetodoelproceso,ydondeconmsfacilidadseproducenlasprdidasde
voltiles,esenlaetapafinaldeconcentracin.Generalmente,yunavezquesehan
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
82 Captulo3

separado ya las dos fases, primero es necesario el uso de sales anhidras (sulfato
sdico o magnsico) para eliminar el agua que pueda haber quedado en la fase
orgnicapara,acontinuacin,procederasuconcentracin.Paraintentarminimizarla
prdidadecompuestosvoltilesyconcentrardeformaadecuadagrandesvolmenes
dedisolventes,esaconsejableelusodecolumnasdefraccionamientoKudernaDanish
oVigreux[56].

Porltimo,ycomoencualquierotratcnicaenlaqueseempleeundisolvente,
alinyectarelextractoobtenidoaparecerunpicocromatogrficodebidoaldisolvente
utilizado. Este pico ser ms o menos grande, pero en muchos casos dificultar, o
inclusoimpedir,ladeterminacindeaquelloscompuestosquecoeluyanconl[45,
55]. Es lo que ocurre con el acetato de etilo cuando se realiza una extraccin con
diclorometano y est instalada una columna polar como la CPWAX en el
cromatgrafo.Sinembargo,estopuedesolucionarseutilizandocolumnasdedistintas
polaridadesotrabajandoenelmodoSIMdelGCMSD.

Perolasextraccionescondisolventestambinpresentannumerosasventajas.La
primera, que son relativamente sencillas de llevar a cabo. Y, principalmente, que
permiten utilizar mayores cantidades de muestra que otras tcnicas, con lo que se
extraen ms analitos y se consigue una sensibilidad del mtodo mucho mayor.
Adems,proporcionanbuenosresultados,sobretodosiseaplicansobremuestrasde
baseacuosa,comofrutas,vegetales,zumosobebidasalcohlicas[45,55].

Sinembargo,muchosalimentos(comolosfrutossecos,losaceitesvegetales,las
mantequillasymargarinas,etc.)contienenelevadascantidadesdelpidos,loscuales
secaracterizanporsermuyhidrofbicos,perosolublesendisolventesorgnicos[57].
De tal manera que, si se realiza una extraccin con disolventes para obtener un
extracto aromtico de estos productos, adems de los compuestos voltiles se
extraerntambinloslpidos.Conelobjetivodeeliminarlosyconseguirunextracto
aromtico sin interferencias de este tipo, es necesario aplicar otra tcnica de
extraccincomplementariacomoeselHighVacuumTransfer(HVT).
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 83

HighVacuumTransfer(HVT)

Gracias al HighVacuum Transfer (HVT) los voltiles de un alimento, o los del


extractoobtenidomedianteelusodedisolventes,sedestilanaplicandounaltovaco
y temperaturas moderadas [58]. De esta manera, todos aquellos componentes no
voltiles,comoeselcasodeloslpidos,quedanfueradelextractofinal.Adems,dado
quelascondicionesdedestilacinnosonagresivas(alcontrariodeloqueocurreen
unadestilacintradicional,conosinarrastredevapor),noseproducelaformacin
deartefactosporladegradacintrmica[59].

ElprincipiodelHighVacuumTransferfuepropuestoen1970porWeurmanelal.
[60].Elobjetivoeradesarrollarunatcnicacapazdedestilarelextractoaromticoo
las propias matrices alimenticias, pero, precisamente, minimizando la formacin de
artefactos. La idea consista en transferir (transfer, en ingls) nicamente los
compuestos voltiles de un recipiente a otro pertenecientes al mismo sistema. Para
ello era necesario conectar ambos recipientes entre s por un tubo de vidrio y
establecer una diferencia de temperatura extrema entre ellos, a la vez que todo el
sistemaerasometidoapresinreducida.Deestamaneraseevitaralapresenciade
loscompuestosnovoltilesenelextractodestilado.

Basndoseenestatcnica,SchieberleyGroschpropusieronen1985unequipo
de destilacin (Figura 3.5) [61]. En l, el extracto aromtico procedente de una
extraccinlquidolquidooslidolquidopreviaeradepositadoenunmatrazdedos
bocas(A),elcualestabasumergidoenunbaodeaguaa50C.

A
B C D E

Figura3.5.EquipodedestilacinpropuestoporSchieberleyGrosch[61]
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
84 Captulo3

AtravsdelasalidamarcadacomoF,seaplicabaelvaco(102Torr.).Graciasa
las trampas utilizadas: B (hielo/agua), C (mezcla de acetona/hielo seco), D y E
(nitrgenolquido),selograbaqueladiferenciadetemperaturaentreelmatrazyla
ltimatrampa(190C)fueralosuficientementepronunciadacomoparallevaracabo
el proceso. Al final, las distintas fracciones condensadas que se obtenan en las dos
ltimas trampas, se juntaban, se secaban y se concentraban hasta el volumen
deseadoutilizandounacolumnaVigreux.

Inicialmente, este equipo se empleaba nicamente para destilar extractos


aromticos obtenidos mediante el uso de disolventes, pero las posteriores mejoras
introducidaspermitieronaplicarlodirectamentesobreaceitesvegetalesparaextraer
susvoltiles[6264].Entreestasmejorasestabaelsometeralmatrazconelextractoo
lamuestraadestilaraagitacinmagnticaconstante,parafavorecerlasalidadelos
voltiles. Tambin se recubri con una camisa el tubo de vidrio que conectaba el
matrazylaprimeratrampa,parahacercircularporellaaguaalamismatemperatura
queelaguadelbao.Asseevitabalacondensacindelosvoltilesantesdellegara
las trampas. Por ltimo, se dise un nuevo conector entre el matraz y el tubo
encamisadoqueprotegaalsistemadelassalpicadurasqueseproducanenelmatraz
(Figura3.6).

Este conector consista en una pieza de


vidriocerrada,peroagujereadaenlaparteque
quedaba dentro del matraz, y con un gancho
hueco en su interior, tambin de vidrio. De
esta manera, nicamente los voltiles podan
pasar a travs de los agujeros de la pieza y
atravesar el ganchito para luego subir por el Figura3.6.Piezaqueconectael
matrazyeltuboencamisado[64]
tuboencamisado[64].

Enlaactualidad,elequipoutilizadoparallevaracabolaextraccindevoltiles
utilizandolatcnicadelHVTeselquesemuestraenlaFigura3.7,yhasidoelequipo
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 85

instrumental empleado en parte deltrabajo experimental desarrolladoa lolargo de


estatesisdoctoral.Enprimerlugarseconectaelsistemaalabombadevacoysedeja
que se alcance un vaco aproximado de 5 mPa. Al mismo tiempo, las trampas se
sumergen en el nitrgeno lquido contenido en los Dewars. A continuacin, la
muestra,oelextractodelquesequieresepararlafraccinvoltil,seintroduceenel
embudo de adicin y se deja caer gota a gota sobre el matraz de dos bocas. Este
matraz se encuentra sumergido en un bao de agua y est sometido a agitacin
magnticaconstante,conloqueelmatraztambincuentaconunpequeoimnen
suinteriorquemuevelamuestrayayudaalaevaporacindelosvoltiles.

Tubo
encamisado Conexinala
bombadevaco

Embudode
adicin

Matrazde
dosbocas

TrampasdeN2 lquido

Piezaagujereada(proteccin
Baoconagitacin magntica contralassalpicaduras)

Figura3.7.EquipodelHighVacuumTransfer(HVT)[59]

Durante la adicin de la muestra se producen numerosas salpicaduras en el


interiordelmatrazy,aunqueestassalpicadurasllegaraintroducirseporlosagujeros
de la pieza que conecta dicho matraz con el tubo encamisado, nicamente los
voltiles son capaces de pasar a travs del gancho situado en su parte superior.
Finalmente, en la primera trampa se condensan los voltiles, que incluyen el
disolvente utilizado en la extraccin. La segunda trampa sirve de proteccin para la
bombadevaco.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
86 Captulo3

Sin embargo, el aparato anteriormente descrito tambin presenta algunos


inconvenientes[59]:

los compuestos aromticos con puntos de ebullicin ms altos pueden


condensarparcialmentedentrodelostubos,antesdealcanzarlastrampas;

es aconsejable utilizar diclorometano y ter dietlico, ya que los otros


disolventespuedencongelarseyobstruirlostubosytrampas;

los extractos con altas concentraciones de grasas saturadas pueden llegar a


taponarlallavedepasodelembudodeadicin;

y, adems, el equipo es sumamente frgil, ocupa mucho espacio y necesita


tiemposdefuncionamientobastantelargos.

Poreso,Engeletal.[59]desarrollaronunnuevoaparatodedestilacinen1999
(Figura 3.8), ms manejable, estable y seguro a la hora de trabajar con valores de
vacotanaltos,yconelobjetivodeextraermsrpidamentelosvoltilesdedistintas
matrices alimenticias. Es el denominado Solvent Assisted Flavor Evaporation (SAFE),
perocuyofuncionamientoesbsicamenteelmismoqueeldelHVT.

Entradadeagua

Conexinala
Embudode bombadevaco
adicin
TrampadeN2

Tubos Cuerpocentralencamisado
conectores

Matrazpararecoger
eldestilado
Matrazde
destilacin

TrampadeN2

Baoconagitacin
magntica

Figura3.8.EquipodelSolventAssistedFlavorEvaporation(SAFE)[58,59]
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 87

En el SAFE, tras aplicar el vaco (5 mPa), se deja gotear poco a poco sobre el
matrazdedestilacinlamuestracontenidaenelembudodeadicin.As,losvoltiles
(incluyendo el disolvente) son transferidos al cuerpo central encamisado, de donde
pasan a un matraz ms pequeo. Como este ltimo matraz est sumergido en una
trampadenitrgeno,eldestiladocondensa.Laotratrampadenitrgenoconlaque
cuentaelequiposeutilizacomoproteccindelabombadevaco.

AplicacindelDSEHVTenelanlisisdelaromadealimentos

Laextraccincondisolventes,yaseasobrematricesslidasolquidas,esunade
lastcnicasdeobtencindeextractosclsica,ampliamenteutilizadadesdelosinicios
delaQumica.Deahquesuusosobrealimentosparaconseguirextractosaromticos
est muy extendido, aunque ltimamente est perdiendo terreno frente a otro tipo
detcnicasmsrpidas,limpiasyrespetuosasconelmedioambiente.

Respecto al HighVacuum Transfer (o a su versin ms moderna del Solvent


Assisted Flavor Evaporation), tambin son numerosas sus aplicaciones en el campo
delanlisisdelaroma,yaquepermiteobtenerextractosconstituidosnicamentepor
voltiles,sinlainterferenciadeotroscompuestospresentesenlosalimentos.

De esta manera, estas dos metodologas, y ms concretamente la DSE unida al


HVT, se han utilizado en la obtencin de extractos aromticos de muy distintos
productos alimenticios: queso Cheddar [65], leche en polvo desnatada [66],
preparadosaromatizantesdeprotenasdesoja[67],sardinas[68],pistachos[69],etc.
Porsuparte,laDSEunidaalSAFEsehaaplicadosobrejamn[70],cacahuetes[71]o
huevasdeerizodemar[72],porejemplo.

En cualquier caso, los resultados son satisfactorios y los extractos aromticos


obtenidos han podido ser utilizados posteriormente para caracterizar del aroma de
esosproductos[65,67,70,71],determinardelefectoquealgunosprocesostrmicos
tienensobreloscompuestosresponsablesdelaroma[66]ocomprobarlafrescurade
losalimentos[68].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
88 Captulo3

Finalmente,comparandolasdostcnicasdeextraccindevoltilesexplicadasa
lo largo de este captulo de la tesis doctoral (SPME y DSEHVT), se ha podido
comprobarqueambassonadecuadasparaelanlisisdeloscompuestosresponsables
delaromadelosalimentos[69,73].PerosehavistoquelaSPME,ademsdeserms
rpida, sencilla y barata, presenta lmites de deteccin ms bajos, con lo que es
adecuada para la identificacin de aquellos compuestos que se encuentran en
concentracionestraza.Otraventajaquepresentaesque,graciasaquenoseutilizan
disolventes,noseproducelacoelucindelosmismosconlosanalitosdeinters,con
loqueestosnoquedanenmascarados.

En cualquier caso, ambas tcnicas son vlidas para obtener extractos


representativosdelaromadelalimentoquesequieraanalizar,ysucombinacincon
la cromatografa de gasesolfatometra (GCO) permite una completa caracterizacin
deloscompuestosaromticos.

3.3.LAGCOENELANLISISDELAROMADELOSALIMENTOS

Talcomosehaidoexponiendoalolargodeestatesisdoctoral,elaromadelos
alimentos es una parte fundamental de los mismos, considerado un importante
parmetrodecalidad,yaqueesresponsable,engranmedida,delaaceptacinoel
rechazo de estos productos por parte de los consumidores. La mayora de los
alimentos presenta un aroma sumamente complejo, en el que intervienen un gran
nmerodecompuestosdedistintanaturalezaqumicaconmuydiversaspropiedades
sensoriales.Adems,estacomplejidadaumentaporelefectomatrizdelalimentoen
el que se encuentran los odorantes, y por el hecho de que, muchos de estos
compuestos, aparezcan en concentraciones muy bajas. Por todo ello, y aunque a lo
largo de los ltimos aos se han producido numerosos avances en las tcnicas
analticas,elanlisisdelaromadelosalimentoscontinasiendounimportantereto.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 89

Las aplicaciones de la cromatografa de gasesolfatometra en el anlisis del


aroma de los alimentos son varias, aunque lo ms habitual es su empleo en la
caracterizacindelperfilaromticodelasmuestras.Deestemodo,sepuedellegara
determinar la importancia relativa que presentan los compuestos aromticamente
activosendelaromaglobaldeunalimento.Sinembargo,tambinhayqueteneren
cuenta otros usos de la GCO no menos importantes, como son la determinacin de
compuestos impacto y de offflavors, su empleo en el control de calidad o para
establecerunacorrelacinentredatossensorialeseinstrumentales.

Debido a que este campo de investigacin abarca varios mbitos, los estudios
relacionadosconlasaplicacionesdelaGCOenelanlisisdelaromadelosalimentos
son muy numerosos, sobre todo en lo que respecta a los ltimos aos. Por este
motivo, a continuacin slo se presentan a grandes rasgos las distintas aplicaciones
de esta tcnica, hacindose referencia a algunos de los trabajos existentes
nicamente a modo de ejemplo, ya que no se pretende presentar una revisin
bibliogrficaexhaustivasobreeltemaenestatesisdoctoral.

3.3.1.Caracterizacindelaroma

GranpartedelostrabajosenlosqueseemplealaGCOparaanalizarelaromade
los alimentos se centra en la identificacin de aquellos odorantes responsables del
aroma. En la mayora de los casos, adems, se persigue una jerarquizacin de los
mismos.Assepuedellegarasaberqucompuestossonlosmsimportantes,losque
originan el aroma del producto. Por este motivo existen estudios sobre la
caracterizacin del aroma de prcticamente todos los alimentos: desde bebidas
alcohlicas, como el vino [74, 75] o la cachaza y el ron [76], hasta bebidas no
alcohlicas, como el t [77], los zumos de frutas (78) o la leche desnatada en polvo
[66],pasandoporalimentostpicosdeladietamediterrnea,comoelaceitedeoliva
virgen[79,80],ascomodeaceitesdeotrasmateriasprimas(cacahuetes,avellanasy
semillas de calabaza) [81]. Entre los alimentos slidos que se han estudiado,
encontramosvariostiposdequeso:cheddarbritnico[65],quesoazulyotrosquesos
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
90 Captulo3

curados (cheddar, parmesano, pecorino y Grana Padano) [82], al igual que jamn
curadoconsal[70],filetesdecarnedevacuno[83],cangrejosalvapor[84]ohuevas
de erizo de mar [72]. Del mismo modo, se han caracterizado numerosos productos
vegetales, como los esprragos cocidos [85], las trufas [86], distintas variedades de
albaricoques[87],chocolatenegro[88],etc.Inclusohastapreparadosaromatizantes
deprotenasdesoja[67].

En algunos casos, estos estudios han ido encaminados nicamente a la


identificacin de los odorantes ms potentes presentes en un determinado tipo de
alimento[65,70,72,74,81,84],peroenotros,elobjetivoescaracterizarlatipicidad
queproporcionaunamateriaprima,variedad,especieozonadeproduccin[66,75,
7780,82,86,87].Deestemodo,enelcasodelacarnedevacuno,elperfilaromtico
obtenido ha permitido identificar diferencias en el mismo originadas por la distinta
alimentacin de los animales (convencional u orgnica) [83], y en el caso de los
esprragos cocidos, las diferencias detectadas presentan relacin con el genotipo
estudiado [85], al igual que los procesos tecnolgicos seguidos en la elaboracin
tambininfluyenenelaromadelproductofinalobtenido[88].

3.3.2.Determinacindecompuestosimpacto

El aroma de los distintos productos alimenticios depende, indudablemente, del


tipo de producto del que se trate, de la materia prima empleada y del proceso de
elaboracin seguido, as como de la zona geogrfica de produccin. Todos estos
factores son los que proporcionan la tipicidad, los que hacen que el aroma sea
caractersticoydistintoparacadaalimento,aunquepuedancoincidirvariosdeestos
factores.

Enmuchoscasos,estatipicidadestdirectamenterelacionadaconlapresencia
de compuestos responsables, por s solos, del olor propio e identificativo del
producto, los denominados compuestos impacto o compuestos clave. Por este
motivo, y sobre todo en aquellos alimentos que se consumen, no por su aporte
nutricional, sino por el placer que proporciona su ingesta (donde sus caractersticas
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 91

organolpticasadquierenmsprotagonismo),existeungrannmerodeestudiosen
losque secaracterizaelaroma de los alimentos con elobjetivo de determinar esos
compuestos que les confieren su identidad sensorial. Uno de los productos ms
estudiadosyanalizados,yquemejorejemplarizaestehecho,eselvino,yaquesehan
realizado trabajos para identificar los compuestos impacto en vinos de una misma
variedad [89], en vinos de distintas variedades [90] o en vinos procedentes de una
misma zona de produccin, tanto tintos [91] como blancos [92], e incluso se han
estudiado los compuestos con carcter impacto de distintas variedades de uvas
habitualmenteempleadasenvinificacin[93].

Estudios similares se han llevado a cabo sobre otros alimentos, como distintas
variedadesderepollos[94],coposdeavena[95],variostiposdelecitinasdesoja[96],
mantequilla derretida [97], salsas de pescado [98], etc. De hecho, gracias a estos
estudios, se ha podido determinar de manera concluyente la identidad de algunos
compuestos con carcter impacto en ciertos alimentos, atribuida hasta entonces
errneamenteaotrosodorantes.Eselcasodelaceiteobtenidoapartirdelapielde
las naranjas, cuyo olor se haba relacionado tradicionalmente con el valencene. Sin
embargo,graciasainvestigacionesmsrecientes,sehapodidosaberqueenrealidad
eseldodecanalelcompuestoclavedelaromadeesteproducto[99].

Pararealizarestostrabajosdemanerafiablesonindispensableslosestudiosde
reconstitucinyomisin,loquedificultayralentizalainvestigacin.Enestosensayos,
una vez caracterizado el aroma de la muestra y cuantificados los compuestos que
participanenelmismo,sepreparaunamezclacontodosestoscomponentes,enlas
concentracionesrealesenlasqueaparecenendichamuestra.Enunprimerpasose
comprueba, mediante el anlisis sensorial, que el olor de esta mezcla realmente
coincide con el del producto inicial. A continuacin, se van eliminando los distintos
componentesdelamezclaparaverculeselefectosensorialquecadaunodeellos
ejercesobreelaromaglobal.Sinembargo,enestetipodepruebasnosecontemplan
de manera directa los efectos aditivos, sinrgicos y antagnicos que se dan en las
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
92 Captulo3

mezclascomplejas,porloqueesmuydifcilevaluarelefectoquelasupresindeuno
delosodorantestienesobreelaroma[100,101].

3.3.3.Determinacindeoffflavors

Deformageneral,losoffflavorsuoloresanmalossonoloresdesagradables o
extraos que aparecen en un alimento, y que no se asocian con el aroma que
normalmentepresentaeseproducto.Suorigen,talcomoyasevioenelcaptulo2de
estatesis doctoral, es diverso: degradacin natural delalimento, contaminacin por
agentes externos, interaccin con el material de embalaje, etc. Incluso, a veces, se
desconocequlosorigina.Pero,encualquiercaso,lapresenciadeoffflavorssiempre
implicalaprdidadecompuestosimpactoolaaparicindeotrosnuevosquealteran
elaromaoriginaldelproductoencuestin.

Dadalagranimportanciaqueestosoloresanmalostienenenelaroma,debido
asuincidencianegativasobrelascaractersticasorganolpticasdelosalimentos,son
numerosos los trabajos desarrollados con el objetivo de determinar los compuestos
responsables de estas notas aromticas indeseables. Adems, cualquier alimento
puedesufriralgnprocesoquedesencadenelaformacindeestoscompuestos,por
esohayestudiosrealizadossobretodotipodeproductos:desdetrabajosenlosque
se han analizado los compuestos aromticos desagradables generados por la
contaminacin de los jamones ibricos durante su curado [102], hasta los que
analizan el origen de los olores a seta, tierra o moho en uvas afectadas por la
podredumbre[103].Asimismo,sehaidentificadolageosminacomoelcontaminante
responsable de las notas terrosas de algunos vinos [104]. Respecto al efecto de los
distintosprocesadosdealimentos,sehavistoqueenelcasodeloszumosdefrutas,
laluzesuno delosfactoresquefavorecenlaaparicindeestosoffflavors[105],al
igualqueelprocesodeenlatado[106],yaqueesteltimoincrementaelnmeroyla
concentracindecompuestosazufrados.

Enalgunoscasos,sinembargoestetipodecompuestosnotienensuorigenen
una contaminacin o un mal procesado de los alimentos, sino que los offflavors
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 93

aparecendeformanatural.Poresemotivotambinencontramosunltimogrupode
estudios que tienen como objetivo identificar los odorantes responsables de estos
oloresanmalosen,porejemplo,cacahuetes[71],truchas[107]oelhgadodecerdo
[108].

3.3.4.CorrelacinentrelaGCOyelanlisissensorialtradicional

Unadelasreasdeestudiomsinteresantescuandosetrabajaconelaromade
los alimentos es la que intenta correlacionar los datos obtenidos en la GCO con los
resultados que proporcionan los anlisis sensoriales descriptivos. La forma ms
sencilladehacerloconsisteenrelacionardirectamentelasdistintasfamiliasdeolores
percibidos en el puerto olfatomtrico con los descriptores sensoriales utilizados por
losanalistasenlassesionesdeanlisissensorial,metodologaquesehaaplicadoen
muestrastandiferentescomolosmejillonescocidos[109]oelcava[110].

Sin embargo, las muestras aromticas suelen ser muy complejas, y no es fcil
llevaracaboestascorrelaciones,porloque,normalmente,esnecesariorecurriralas
tcnicasquimiomtricas.Enalgunoscasos,laquimiometraaplicadaesrelativamente
sencilla,comopuedeserelmtododeregresinpormnimoscuadradosoelanlisis
de componentes principales [111115], pero en otros, las herramientas
quimiomtricas son ms complejas, como ocurre con el diseo de modelos de
prediccin [116] oelanlisis de proclsteres generalizados [117]. En cualquier caso,
gracias a estas tcnicas se han podido relacionar, por ejemplo, las propiedades
sensorialesdealgunosvinosconelperfilaromticoqueproporcionaunadeterminada
variedad de uva [111], o la calidad aromtica reconocida de ciertos vinos tintos
espaoles con la presencia de una serie de odorantes negativos y de otro grupo de
odorantesfrutalesydulces[112].Tambinsehalogradorelacionarlacalidaddelos
championes con aquellos compuestos olorosos responsables de ciertos atributos
sensoriales [113], mientras que en las percas se ha relacionado el tipo de cra que
hayan tenido (salvaje o en piscifactoras) con las distintas notas aromticas que
presentan [114]. Incluso se ha podido establecer una relacin entre la calidad
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
94 Captulo3

aromtica de la carne y las diferentes dietas con las que los corderos han sido
alimentados[115].Todasestasaplicacionessonslounospocosejemplosdeungran
campodeinvestigacin,perosuficientesparaproporcionarunaideadeloquepuede
llegaraconseguirsemedianteelusoconjuntodeestastcnicas.

3.3.5.Controldecalidad

En la actualidad, todos los productos alimenticios son sometidos a estrictos


controlesdecalidadconelobjetivodeasegurarsusalubridadyvalornutricional,as
como el mantenimiento de sus propiedades organolpticas. Estos controles se
suceden de forma continua, y no slo desde que se reciben las materias primas y
hasta el momento en que el alimento procesado llega al consumidor, sino tambin
durantelaobtencindelaspropiasmateriasprimas.

Dado que el aroma que presentan los alimentos es una de sus caractersticas
organolpticas ms importantes, ntimamente relacionada con la calidad, su anlisis
constituyeunodelospuntosclavedetodoelprocesodecontroldecalidad,ylaGCO
es una de las tcnicas ms adecuadas para llevarlo a cabo. Por este motivo, dicha
tcnicasehaempleado,porejemplo,enelanlisisdedistintasbebidasalcohlicasde
origen agrcola con diferentes calidades organolpticas [118]. En este trabajo se ha
podidocomprobarquelamayorcantidaddeinformacinacercadelacalidaddelos
productos se obtiene a travs del anlisis de sus odorantes ms intensos, y que el
trisulfito de dimetilo y la geosmina son los dos indicadores ms significativos de la
bajacalidadsensorialdeestasbebidas.Tambinseharelacionadolafrescuradelas
sardinas con algunos voltiles aromticos potentes, de manera que, cambios en la
concentracinylapercepcindeestosodorantesdanunaideabastanteacertadade
la calidad delproducto que llega al consumidor [68]. Asimismo, una de las etapas a
tenerencuentaenlaindustriaalimentaria,dadasugraninfluenciasobrelacalidad,
eselperiododealmacenamientodelasmateriasprimasylosalimentos.Deahque
existan numerosos estudios sobre loscambios producidos en elperfil aromtico de,
entre otros, el azafrn [119], las peras [120] o, incluso, la leche materna [121],
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 95

durante ese almacenamiento. Al igual que tambin son varios los trabajos que
analizanelefectoquelascondicionesdetemperatura,embalaje,etc.provocansobre
elaromadelosproductosduranteesteperiodo[122,123].

Por ltimo, a continuacin se adjunta un cuadro resumen (Tabla 3.2) con los
trabajosreferenciadosalolargodeestecaptuloyquehansidopublicadosdesdeel
ao2005.Comoyasehacomentadoanteriormente,noconstituyenenmodoalguno
una revisin bibliogrfica en profundidad sobre la aplicacin de la cromatografa de
gasesolfatometraenelanlisisdelaromadelosalimentos,aunquesproporcionan
unaideadelamagnitudyposibilidadesdeestecampodeestudio.

Preparacin
Alimento Objetivo demuestra Ao Ref.
Aceitedenaranja Determinarelpapeldelvalenceneenel Inyeccin 2005 [99]
aroma directa
Aceitedeoliva Caracterizarelaromadeaceitesdeoliva DH 2006 [80]
vrgenesdedistintasvariedades
Albaricoques Caracterizarelaromadedistintas HSSPME 2006 [87]
variedadesdealbaricoques
Arroz Desarrollarmodelosdeprediccinparalos DH 2008 [116]
descriptoressensorialesbasadosenlos
compuestosaromticos
Azafrn Analizarelperfilvoltilylascaractersticas USAEcon 2010 [119]
sensorialesduranteelalmacenamiento terdietlico
Bebidas Determinarqucompuestosson HSSPME 2009 [118]
alcohlicas responsablesdeldeteriorodelacalidad
sensorial
Cacahuetes Caracterizarlosoffflavorsresponsablesdel DSESAFE 2008 [71]
olorafrutasfermentadas
Cachazayron Caracterizarelaromadeambosproductos USAEcon 2006 [76]
paracompararlaspotenciasdesus Freon113
odorantes
Cangrejosde Identificarlosodorantesresponsablesdel SDE 2010 [84]
manglaralvapor aroma
Carnedecordero Relacionarelaromadelacarneconladieta DH 2010 [115]
asada seguidaporlosanimales
Cavas Relacionarlosperfilessensorial,voltily HSSPME/ 2010 [110]
aromtico LLE
Championes Relacionarlosdatossensorialese DSEHVT 2007 [113]
instrumentalesenproductosdedistintas
calidades
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
96 Captulo3

Coposdeavena Caracterizacindel(E,E,Z)2,4,6nonatrienal DSESAFE 2005 [95]


comocompuestoimpacto
Huevasdeerizode Identificarlosodorantesresponsablesdel DSESAFE 2010 [72]
mar aromaydelasdiferenciassensoriales
debidasalgneroylazonadeproduccin
Jamnamericano Determinarloscompuestos DSESAFEy 2008 [70]
aromticamenteactivos DH
Jamnibrico Caracterizarlosodorantespresentesen DH 2010 [102]
jamonesibricoscontaminadosdurantesu
curado
Lechematerna Determinarloscambiossensorialesenel LLESAFE 2010 [121]
perfilaromticoduranteel
almacenamientoa19C
Mantequilla Determinarlosefectosdelfroydeltipode DH 2007 [123]
embalajesobreloscompuestosaromticos
duranteelalmacenamiento
Peras Estudiarloscambiosenlacomposicin HSSPME 2006 [120]
voltilduranteelalmacenamiento
Percas Relacionarlascaractersticassensorialesy DH 2009 [114]
voltilesdemuestrasconcrasalvajeyen
cautividad
Pistachos Comparartcnicasdeobtencinde HSSPMEy 2010 [69]
extractosaromticosrepresentativos DSEHVT
Repollos Determinarloscompuestosimpacto SDE 2009 [94]
Salsadepescado Determinarloscompuestosimpacto HSSPME 2008 [98]
Snacksdepatata Comparartcnicasdeobtencinde HSSPME, 2009 [73]
extractosaromticosrepresentativos SAFEySDE
Truchas Identificarlosodorantesylosoffflavorsde MADSE 2009 [107]
extractosaromticos
Trufas Caracterizarelaroma DH 2010 [86]
Uvas(con Caracterizarlosoffflavorsprovocadospor DSE/LLE 2006 [103]
podredumbre) lapodredumbre
Uvas(variedad Identificarycuantificarloscompuestos DSESAFE 2010 [93]
Vitisvinifera) impacto
Vino Predecirlaspropiedadessensorialesdel DH 2005 [111]
vinoapartirdelosdatosdelaGCO
VinosChardonnay Determinarloscompuestosimpacto LLE 2006 [89]
Vinostintosde Determinarloscompuestos DH 2007 [75]
calidad aromticamenteactivoseidentificarqu
interaccionesentreodorantesson
responsablesdelosmaticesafrutados
Vinostintos Modelarlacalidaddelvinoenfuncinde DH 2009 [112]
espaoles losgruposdeodorantes
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 97

Zumodenaranja Compararloscompuestosaromticamente HSSPME 2006 [78]


exprimidoamano activosenzumosdedistintasvariedadesde
naranjas
Zumodemanzana Identificarlosoffflavorsinducidosporla HSSPME 2007 [105]
turbio luz
Zumodenaranja Identificarlosoffflavorsqueaparecenen Headspace 2007 [106]
zumosenlatados esttico

DH:DynamicHeadspace HSSPME:HeadspaceSolidPhaseMicroextraction
DSE:DirectSolventExtraction MADSE:Microwaveassisteddistillationsolventextraction
LLE:LiquidLiquidExtraction SAFE:SolventAssistedFlavorEvaporation
USAE:UltrasoundAssistedExtraction SDE:SimultaneousDistillationandExtraction

Tabla3.2.EjemplosdeaplicacionesdelaGCOenelanlisisdelaromadelosalimentosrealizadas
desde2005


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
98 Captulo3

BIBLIOGRAFA
[1] Maarse, H., editor. Volatile compounds in foods and beverages. New York: Marcel
Dekker,Inc.;1991.
[2] Baines, D., Knights, K. Applications I: Flavors. En: Rowe, D. J., editor. Chemistry and
technology of flavors and fragrances. Oxford: Blackwell Publishing Ltd; 2005, p. 274
304.
[3] Grosch, W. Determination of potent odourants in foods by Aroma Extract Dilution
Analysis(AEDA)andcalculationofOdourActivityValues(OAVs).FlavourFragr.J.1994;
9:147158.
[4] Mayol,A.R.,Acree,T.E.Advancesingaschromatographyolfactometry.En:Leland,J.
V.,Schieberle,P.,Buettner,A.,Acree,T.E.,editors.Gaschromatographyolfactometry.
Thestateoftheart.Washington:AmericanChemicalSociety;2001,p.110.
[5] Blank, I. Gas chromatographyolfactometry in food aroma analysis. En: Marsili, R.,
editor. Techniques for analyzing food aroma. New York: Marcel Dekker, Inc.; 1997, p.
293329.
[6] James, A. T., Martin, J. P. Gasliquid partition chromatography. A technique for the
analysisofvolatilematerials.Analyst1952;77:915932.
[7] Fuller, G. H., Steltenkamp, R., Tisserand, G. A. The gas chromatography with human
sensor:perfumermodel.AnnalsN.Y.Acad.Sci.1964;116:711724.
[8] Dravnieks, A., ODonnell, A. Principles and some techniques of highresolution
headspaceanalysis.J.Agric.FoodChem.1971;19:10491056.
[9] vanRuth,S.M.Methodsforgaschromatographyolfactometry:areview.Biomol.Eng.
2001;17:121128.
[10] Delahunty,C.M.,Eyres,G.,Dufour,J.P.Gaschromatographyolfactometry.J.Sep.Sci.
2006;29:21072125.
[11] Plutowska, B., Wardencki, W. Application of gas chromatographyolfactometry (GCO)
inanalysisandqualityassessmentofalcoholicbeveragesAreview.FoodChem.2008;
107:449463.
[12] Patton, S., Josephson, D. V. A method for determining significance of volatile
compoundsinfoods.FoodRes.1957;22:316318.
[13] Rothe,M.,Thomas,B.AromastoffedesBrotes.Z.Lebensm.Unters.Forsch.1963;119:
302310.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 99

[14] Acree, T., Barnard, J., Cunningham, D. A procedure for the sensory analysis of gas
chromatographiceffluents.FoodChem.1984;14:273286.
[15] Ullrich, F., Grosch, W. Identification of the most intense volatile flavour compounds
formedduringautoxidationoflinoleicacid.Z.Lebensm.Unters.Forsch.1987;184:277
282.
[16] Schieberle, P., Grosch, W. Evaluation of the flavour of wheat and rye bread crusts by
aromaextractdilutionanalysis.Z.Lebensm.Unters.Forsch.1987;185:111113.
[17] Kerscher,R.,Grosch,W.Comparativeevaluationofpotentodorantsofboiledbeefby
aromaextractdilutionandconcentrationanalysis.Z.Lebensm.Unters.Forsch.A1997;
204:36.
[18] Linssen, J. P. H., Janssens, J. L. G. M., Roozen, J. P., Posthumus, M. A. Combined gas
chromatography and sniffing port analysis of volatile compounds of mineral water
packedinpolyethylenelaminatedpackages.FoodChem.1993;46:367371.
[19] Pollien, P., Ott, A., Montigon, F., Baumgartner, M., MuozBox, R., Chaintreau, A.
Hyphenated headspacegas chromatographysniffing technique: screening of impact
odorants and quantitative aromagram comparisons. J. Agric. Food Chem. 1997; 45:
26302637.
[20] McDaniel, M. R., MirandaLopez, R., Watson, B. T., Micheals, N. J. Libbey, L. M. Pinot
noir aroma: a sensory/gas chromatographic approach. En: Charalambous, G., editor.
Flavorsandoffflavors.Amsterdam:ElsevierSciencePublisher;1990,vol.24,p.2336.
[21] daSilva,M.A.A.P.,Lundahl,D.S.,McDaniel,M.R.Thecapabilityandpsychophysicsof
Osme: a new GColfactometry technique. En: Maarse, H., van der Heij, D. G., editors.
Trendsinflavourresearch.Amsterdam:ElsevierSciencePublisher;1994,vol.35,p.191
209.
[22] Guichard, H., Guichard, E., Langlois, D., Issanchou, S., Abbott, N. GC sniffing analysis:
olfactive intensity measurement by two methods. Z. Lebensm. Unters. Forsch. 1995;
201:344350.
[23] Etivant, P. X., Callement, G., Langlois, D., Issanchou, S., Coquibus, N. Odor intensity
evaluation in gas chromatographyolfactometry by finger span method. J. Agric. Food
Chem.1999;47:16731680.
[24] dAcampora Zellner, B., Dugo, P., Dugo, G., Mondello, L. Gas chromatography
olfactometryinfoodflavouranalysis.J.Chromatogr.A2008;1186:123143.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
100 Captulo3

[25] LeGuen,S.,Prost,C.,Demaimay,M.Criticalcomparisonofthreeolfactometricmethods
fortheidentificationofthemostpotentodorantsincookedmussels(Mytilusedulis).J.
Agric.FoodChem.2000;48:13071314.
[26] van Ruth, S. M. Evaluation of two gas chromatographyolfactometry methods: the
detectionfrequencyandperceivedintensitymethod.J.Chromatogr.A2004;1054:33
37.
[27] vanRuth,S.M.,OConnor,C.H.Evaluationofthreegaschromatographyolfactometry
methods: comparison of odour intensityconcentration relationships of eight volatile
compoundswithsensoryheadspacedata.FoodChem.2001;74:341347.
[28] Chaintreau, A. Quantitative use of gas chromatographyolfactometry: the GCSNIF
method.En:Marsili,R.,editor.Flavor,fragrance,andodoranalysis.NewYork:Marcel
Dekker,Inc.;2002,p.333348.
[29] Pollien, P., Fay, L. B., Baumgartner, M., Chaintreau, A. First attempt of odorant
quantification using gas chromatographyolfactometry. Anal. Chem. 1999; 71: 5391
5397.
[30] Ferreira, V., Petka, J., Aznar, M., Cacho, J. Quantitative gas chromatography
olfactometry.Analyticalcharacteristicsofapanelofjudgesusingasimplequantitative
scaleasgaschromatographydetector.J.Chromatogr.A2003;1002:169178.
[31] Mistry, B. S., Reineccius, T., Olson, L. K. Gas Chromatographyolfactometry for the
determinationofkeyodorantsinfoods.En:Marsili,R.,editor.Techniquesforanalyzing
foodaroma.NewYork:MarcelDekker,Inc.;1997,p.265292.
[32] Reineccius,G.Choosingthecorrectanalyticaltechniqueinaromaanalysis.En:Voilley,
E., Etivant, P., editors. Flavour in food. Cambridge: Woodhead Publishing Limited;
2006,p.8197.
[33] Arthur, C. L., Pawliszyn, J. Solid phase microextraction with thermal desorption using
fusedsilicaopticalfibers.Anal.Chem.1990;62:21452148.
[34] Pawliszyn, J. Solid phase microextraction: theory and practice. New York: WileyVCH,
Inc.;1997.
[35] Kataoka,H.,Lord,H.L.,Pawliszyn,J.Applicationsofsolidphasemicroextractioninfood
analysis.J.Chromatogr.A2000;880:3562.
[36] Zhang,Z.,Yang,M.J.,Pawliszyn,J.Solidphasemicroextraction.Anal.Chem.1994;66:
844A853A.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 101

[37] Zhang, Z., Pawliszyn, J. Headspace solidphase microextraction. Anal. Chem. 1993; 65:
18431852.
[38] Mullet,W.M., Pawliszyn,J. Thedevelopmentofselectiveandbiocompatiblecoatings
forsolidphasemicroextraction.J.Sep.Sci.2003;26:251260.
[39] Augusto, F., Carasek, E., Gomes Costa Silva, R., Rivellino, S. R., Domingues Batista, A.,
Martendal, E. New sorbents for extraction and microextraction techniques. J.
Chromatogr.A2010;1217:25332542.
[40] Zhang, Z., Pawliszyn, J. Quantitative extraction using an internally cooled solid phase
microextractiondevice.Anal.Chem.1995;67:3443.
[41] Risticevic,S.,Niri,V.H.,Vuckovic,D.,Pawliszyn,J.Recentdevelopmentsinsolidphase
microextraction.Anal.Bioanal.Chem.2009;393:781795.
[42] Prosen,H.,ZupaniKralj,L.Solidphasemicroextraction.TrendsAnal.Chem.1999;18:
272282.
[43] Louch, D., Motlagh, S., Pawliszyn, J. Dynamics of organic compounds extraction from
waterusingliquidcoatedfusedsilicafibers.Anal.Chem.1992;64:11871199.
[44] Harmon, A. D. Solidphase microextraction for the analysis of flavors. En: Marsili, R.,
editor. Techniques for analyzing food aroma. New York: Marcel Dekker, Inc.; 1997, p.
81112.
[45] Plutowska, B., Wardencki,W. Aromagrams Aromatic profiles in the appreciation of
foodquality.FoodChem.2007;101:845872.
[46] Wardencki,W.,Michulec,M.,Curylo,J.Areviewoftheoreticalandpracticalaspectsof
solidphasemicroextractioninfoodanalysis.Int.J.FoodSci.Technol.2004;39:703717.
[47] Wilkes,J.G.,Conte,E.D.,Kim,Y.,Holcomb,M.,Sutherland,J.B.,Miller,D.W.Sample
preparationfortheanalysisofflavorsandoffflavorsinfoods.J.Chromatogr.A2000;
880:333.
[48] Mestres, M., Mart, M. P., Busto, O., Guasch, J. Simultaneous analysis of thiols,
sulphidesanddisulphidesinwinearomabyheadspacesolidphasemicroextractiongas
chromatography.J.Chromatogr.A1999;849:293297.
[49] Sala, C., Mestres, M., Mart, M. P., Busto, O., Guasch, J. Headspace solidphase
microextractionmethodfordetermining3alkyl2methoxypyrazinesinmustsbymeans
ofpolydimethylsiloxanedivinylbenzenefibres.J.Chromatogr.A2000;880:9399.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
102 Captulo3

[50] Riu, M., Mestres, M., Busto, O., Guasch, J. Determination of 2,4,6trichloroanisole in
wines by headspace solidphase microextraction and gas chromatographyelectron
capturedetection.J.Chromatogr.A2002;977:18.
[51] MateoVivaracho,L.,Ferreira,V.,Cacho,J.Automatedanalysisof2methyl3furanthiol
and 3mercaptohexyl acetate at ng L1 level by headspace solipphase microextraction
withonfibrederivatisationandgaschromatographynegativechemicalionizationmass
spectrometricdetermination.J.Chromatogr.A2006;1121:19.
[52] Vesely,P.,Lusk,L.,Basarova,G.,Seabrooks,J.,Ryder,D.Analysisofaldehydesinbeer
using solidphase microextraction with onfibre derivatization and gas
chromatography/massspectrometry.J.Agric.FoodChem.2003;51:69416944.
[53] Saison, D., De Schutter, D. P., Delvaux, F., Delvaux, F. R. Determination of carbonyl
compounds in beer by derivatisation and headspace solidphase microextraction in
combinationwithgaschromatographyandmassspectrometry.J.Chromatogr.A2009;
1216:50615068.
[54] Reineccius, G. A. Flavourisolation techniques. En: Berger, R. G., editor. Flavours and
fragrances. Chemistry, bioprocessing and sustainability. Berlin: Springer; 2007, p. 409
426.
[55] Da Costa, N. C., Eri, S. Identification of aroma chemicals. En: Rowe, D. J., editor.
Chemistryand technologyofflavors andfragrances.Oxford:BlackwellPublishingLtd.;
2005,p.1234.
[56] Parliment, T. Solvent extraction and distillation techniques. En: Marsili, R., editor.
Flavor,fragrance,andodoranalysis.NewYork:MarcelDekker,Inc.;2002,p.123.
[57] Belitz, H.D., Grosch, W., Schieberle, P. Food Chemistry. 3rd revised edition. Berlin:
Springer;2004.
[58] Grosch,W.Aromacompounds.En:Nollet,L.M.L.,editor.Handbookoffoodanalysis.
Physicalcharacterizationandnutrientanalysis.2ndedition,revisedandexpanded.New
York:MarcelDekker,Inc.;2004,p.717746.
[59] Engel, W., Bahr, W., Schieberle, P. Solvent assisted flavour evaporation a new and
versatile technique for the careful and direct isolation of aroma compounds from
complexfoodmatrices.Eur.FoodRes.Technol.1999;209:237241.
[60] Weurman,C.,Groenen,P.J.,vanGemert,L.J.ExperimentsonHighVacuumTransfer
infoododourresearch.Nahrung1970;14:607616.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 103

[61] Schieberle, P., Grosch, W. Photolyse von 13(S)Hydroperoxy9(Z), 11(E)


octadecadiensuremethylester in Gegenwart von Sauerstoff Analyse der
niedermolekularenReaktionsprodukte.FetteSeifenAnstrichm.1985;87:7680.
[62] Guth,H.,Grosch,W.3methylnonane2,4dioneAnintenseodourcompoundformed
duringflavourreversionofsoyabeanoil.FatSci.Technol.1989;91:225230.
[63] Sen, A., Laskawy, G., Schieberle, P., Grosch, W. Quantitative determination of
damascenoneinfoodsusingastableisotopedilutionassay.J.Agric.FoodChem.1991;
39:757759.
[64] Jung, H. P., Sen, A., Grosch, W. Evaluation of potent odorants in parsley leaves
(Petroselinum crispum (Mill.) Nym ssp. crispum) by aroma extract dilution analysis.
Lebensm.Wiss.Technol.1992;25:5560.
[65] Suriyaphan, O., Drake, M. A., Chen, X. Q., Cadwallader, K. R. Characteristic aroma
componentsofBritishFarmhouseCheddarcheese.J.Agric.FoodChem.2001;49:1382
1387.
[66] KaraglYceer,Y.,Drake,M.A.,Cadwallader,K.R.Aromaactivecomponentsofnonfat
drymilk.J.Agric.FoodChem.2001;49:29482953.
[67] Wu, Y.F. G., Cadwallader, K. R. Characterization of the aroma of a meatlike process
flavoring from soybeanbased enzymehydrolyzed vegetable protein. J. Agric. Food
Chem.2002;50:29002907.
[68] Triqui, R., Bouchriti, N. Freshness assessments of Moroccan sardine (Sardina
pilchardus): comparison of overall sensory changes to instrumentally determined
volatiles.J.Agric.FoodChem.2003;51:75407546.
[69] Acea, L., Vera, L., Guasch, J., Busto, O., Mestres, M. Comparative study of two
extractiontechniquestoobtainrepresentativearomaextractsforbeinganalysedbygas
chromatographyolfactometry:applicationtoroastedpistachioaroma.J.Chromatogr.A
2010;1217:77817787.
[70] Song,H.,Cadwallader,K.R.AromacomponentsofAmericancountryham.J.FoodSci.
2008;73:2935.
[71] Greene, J. L., Sanders, T. H., Drake, M. A. Characterization of volatile compounds
contributing to naturally occurring fruity fermented flavor in peanuts. J. Agric. Food
Chem.2008;56:80968102.
[72] Niimi, J., Leus, M., Silcock, P., Hamid, N., Bremer, P. Characterisation of odour active
volatile compounds of New Zealand sea urchin (Evechinus chloroticus) roe using gas
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
104 Captulo3

chromatographyolfactometryfinger span cross modality (GCOFSCM) method. Food


Chem.2010;121:601607.
[73] Majcher,M.,Jeln,H.H.ComparisonofsuitabilityofSPME,SAFEandSDEmethodsfor
isolation of flavor compounds from extruded potato snacks. J. Food Compost. Anal.
2009;22:606612.
[74] Mart,M.P.,Mestres,M.,Sala,C.,Busto,O.,Guasch,J.Solidphasemicroextractionand
gas chromatography olfactometry analysis of successively diluted samples. A new
approachofthearomaextractdilutionanalysisappliedtothecharacterizationofwine
aroma.J.Agric.FoodChem.2003;51:78617865.
[75] Escudero,A.,Campo,E.,Faria,L.,Cacho,J.,Ferreira,V.Analyticalcharacterizationof
the aroma of five premium red wines. Insights into the role of odor families and the
conceptoffruitinessofwines.J.Agric.FoodChem.2007;55:45014510.
[76] de Souza, M. D. C. A., Vsquez, P., del Mastro, N. L., Acree, T. E., Lavin, E. H.
Characterizationofcachaaandrumaroma.J.Agric.FoodChem.2006;54:485488.
[77] Kumazawa, K., Masuda, H. Identification of potent odorants in different green tea
varietiesusingflavordilutiontechnique.J.Agric.FoodChem.2002;50:56605663.
[78] Arena, E., Guarrera, N., Campisi, S., Nicolosi Asmundo, C. Comparison of odour active
compounds detected by gaschromatographyolfactometry between handsqueezed
juicesfromdifferentorangevarieties.FoodChem.2006;98:5963.
[79] Reiners,J.Grosch,W.Odorantsofvirginoliveoilswithdifferentflavorprofiles.J.Agric.
FoodChem.1998;46:27542763.
[80] Luna,G.,Morales,M.T.,Aparicio,R.Characterisationof39varietalvirginoliveoilsby
theirvolatilecompositions.FoodChem.2006;98:243252.
[81] Matsui, T., Guth, H., Grosch, W. A comparative study of potent odorants in peanut,
hazelnut,andpumpkinseedoilsonthebasisofaromaextractdilutionanalysis(AEDA)
and gas chromatographyolfactometry of headspace samples (GCOH). Fett/Lipid 1998;
100:5156.
[82] Frank, D. C., Owen, C. M., Patterson, J. Solid phase microextraction (SPME) combined
with gaschromatography and olfactometrymass spectrometry for characterization of
cheesearomacompounds.Lebensm.Wiss.u.Technol.2004;37:139154.
[83] Machiels, D., van Ruth, S. M., Posthumus, M. A., Istasse, L. Gas chromatography
olfactometry analysis of the volatile compounds of two commercial Irish beef meats.
Talanta2003;60:755764.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 105

[84] Yu, H.Z., Chen, S.S. Identification of characteristic aromaactive compounds in


steamedmangrovecrab(Scyllaserrata).FoodRes.Int.2010;43:20812086.
[85] Ulrich, D., Hoberg, E., Bittner, T., Engewald, W., Meilchen, K. Contribution of volatile
compoundstotheflavorofcookedasparagus.Eur.FoodRes.Technol.2001;213:200
204.
[86] Culler,L.,Ferreira,V.,Chevret,B.,Venturini.M.E.,SnchezGimeno,A.C.,Blanco,D.
Characterisation of aroma active compounds in black truffles (Tuber melanosporum)
and summer truffles (Tuber aestivum) by gas chromatographyolfactometry. Food
Chem.2010;122:300306.
[87] Guillot, S., Peytavi, L., Bureau, S., Boulanger, R., Lepoutre, J.P., Crouzet, J., Schorr
Galindo, S. Aroma characterization of various apricot varieties using headspacesolid
phasemicroextractioncombinedwithgaschromatographymassspectrometryandgas
chromatographyolfactometry.FoodChem.2006;96:147155.
[88] Counet, C., Callemien, D., Ouwerx, C., Collin, S. Use of gas chromatography
olfactometry to identify key odorant compounds in dark chocolate. Comparison of
samplesbeforeandafterconching.J.Agric.FoodChem.2002;50:23852391.
[89] Lorrain, B., Ballester, J., ThomasDanguin, T., Blanquet, J., Meunier, J. M., Le Fur, Y.
Selection of potential impact odorants and sensory validation of their importance in
typicalChardonnaywines.J.Agric.FoodChem.2006;54:39733981.
[90] Guth,H.Identificationofcharacterimpactodorantsofdifferentwhitewinevarieties.J.
Agric.FoodChem.1997;45:30223026.
[91] Aznar, M., Lpez, R., Cacho, J. F., Ferreira, V. Identification and quantification of aged
red wines from Rioja. GCOlfactometry, quantitative GCMS, and odor evaluation of
HPLCfraction.J.Agric.FoodChem.2001;49:29242929.
[92] Lpez, R., Ortn, N., PrezTrujillo, J. P., Cacho, J., Ferreira, V. Impact odorants of
different young white wines from the Canary Islands. J. Agric. Food Chem. 2003; 51:
34193425.
[93] Fan, W., Xu, Y., Jiang, W., Li, J. Identification and quantification of impact aroma
compoundsin4nonfloralVitisviniferavarietiesgrapes.J.FoodSci.2010;75:8188.
[94] Breme, K., Langle, S., Fernandez, X., Meierhenrich, U. J., Brevard, H., Joulain, D.
CharacterimpactodorantsfromBrassicaceaebyaromaextractdilutionanalysis(AEDA):
BrassicacreticaandBrassicainsularis.FlavourFragr.J.2009;24:8893.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
106 Captulo3

[95] Schuh, C., Schieberle, P. Characterization of (E,E,Z)2,4,6nonatrienal as a character


impactaromacompoundofoatflakes.J.Agric.FoodChem.2005;53:86998705.
[96] Stephan, A., Steinhart, H. Identification of character impact odorants of different
soybeanlecithins.J.Agric.FoodChem.1999;47:28542859.
[97] Peterson, D. G., Reineccius, G. A. Determination of the aroma impact compounds in
heatedsweetcreambutter.FlavourFragr.J.2003;18:320324.
[98] Pham,A.J.,Schilling,M.W.,Yoon,Y.,Kamadia,V.V.,Marshall,D.L.Characterizationof
fish sauce aromaimpact compounds using GCMS, SPMEOsmeGCO, and Stevens
powerlawexponents.J.FoodSci.2008;73:268274.
[99] Elston,A.,Lin,J.,Rouseff,R.Determinationoftheroleofvalenceneinorangeoilasa
directcontributortoaromaquality.FlavourFragr.J.2005;20:381386.
[100] Grosch, W. Evaluation of the key odorants of foods by dilution experiments, aroma
modelsandomission.Chem.Senses2001;26:533545.
[101] Jarauta,I.,Ferreira,V.,Cacho,J.F.Synergic,additiveandantagonisticeffectsbetween
odorantswithsimiliarodourproperties.Develop.FoodSci.2006;43:205208.
[102] Carrapiso, A. I., Martn, L., Jurado, ., Garca, C. Characterisation of the most odour
activecompoundsofbonetainteddrycuredIberianham.MeatSci.2010;85:5458.
[103] LaGuerche,S.,Dauphin,B.,Pons,M.,Blancard,D.,Darriet,P.Characterizationofsome
mushroom and earthy offodors microbially induced by the development of rot on
grapes.J.Agric.FoodChem.2006;54:91939200.
[104] Darriet, P., Pons, M., Lamy, S., Dubourdieu, D. Identification and quantification of
geosmin,anearthyodorantcontaminatingwines.J.Agric.FoodChem.2000;48:4835
4838.
[105] Hashizume,M.,Gordon,M.H.,Mottram,D.S.Lightinducedoffflavordevelopmentin
cloudyapplejuice.J.Agric.FoodChem.2007;55:91779182.
[106] Ruiz PerezCacho, P., Mahattanatawee, K., Smoot, J. M., Rouseff, R. Identification of
sulfurvolatilesincannedorangejuiceslackingorangeflavor.J.Agric.FoodChem.2007;
55:57615767.
[107] Selli, S., Prost, C., Serot, T. Odouractive and offodour components in rainbow trout
(Oncorhynchus mykiss) extracts obtained by microwave assisted distillationsolvent
extraction.FoodChem.2009;114:317322.
[108] Im,S.,Kurata,T.CharacterizationofoffflavorsinporcinelivercollectedbySDE.Food
Sci.Technol.Res.2003;9:338341.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lacromatografadegasesolfatometra(GCO) 107

[109] LeGuen,S.,Prost,C.,Demaimay,M.Evaluationoftherepresentativenessoftheodorof
cooked mussel extracts and the relationship between sensory descriptors and potent
odorants.J.Agric.FoodChem.2001;49:13211327.
[110] Torrens,J.,RiuAumatell,M.,Vichi,S.,LpezTamames,E.,Buxaderas,S.Assessmentof
volatile and sensory profiles between base and sparkling wines. J. Agric. Food Chem.
2010;58:24552461.
[111] Campo,E.,Ferreira,V.,Escudero,A.,Cacho,J.Predictionofthewinesensoryproperties
related to grape variety from dynamicheadspace gas chromatographyolfactometry
data.J.Agric.FoodChem.2005;53:56825690.
[112] Ferreira, V., San Juan, F., Escudero, A., Culler, L., FernndezZurbano, P., Saenz
Navajas, M. P., Cacho, J. Modeling quality of premium Spanish red wines from gas
chromatographyolfactometrydata.J.Agric.FoodChem.2009;57:74907498.
[113] Cho, I. H., Lee, S. M., Kim, S. Y., Choi, H.K., Kim, K.O., Kim, Y.S. Differentiation of
aroma characteristics of pinemushrooms (Tricholoma matustake Sing.) of different
grades using gas chromatographyolfactometry and sensory analysis. J. Agric. Food
Chem.2007;55:23232328.
[114] Frank, D., Poole, S., Kirchhoff, S., Forde, C. Investigation of sensory and volatile
characteristics of farmed and wild barramundi (Lates calcarifer) using gas
chromatographyolfactometry mass spectrometry and descriptive sensory analysis. J.
Agric.FoodChem.2009;57:1030210312.
[115] Resconi, V. C., Campo, M. M., Montossi, F., Ferreira, V., Saudo, C., Escudero, A.
Relationship between odouractive compounds and flavour perception in meat from
lambsfeddifferentdiets.MeatSci.2010;85:700706.
[116] Limpawattana,M.,Yang,D.S.,Kays,S.J.,Shewfelt,R.L.Relatingsensorydescriptorsto
volatilecomponentsinflavorofspecialtyricetypes.J.FoodSci.2008;73:456461.
[117] Le Fur, Y., Mercurio, V., Moio, L., Blanquet, J., Meunier, J. M. A new approach to
examinetherelationshipsbetweensensoryandgaschromatographyolfactometrydata
usinggeneralizedprocrustesanalysisappliedtosixFrenchChardonnaywines.J.Agric.
FoodChem.2003;51:443452.
[118] Plutowska, B., Wardencki, W. Headspace solidphase microextraction and gas
chromatographyolfactometry analysis of raw spirits of different organoleptic quality.
FlavourFragr.J.2009;24:177185.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
108 Captulo3

[119] Maggi, L., Carmona, M., Zalacain, A., Kanakis, C. D., Anastasaki, E., Tarantilis, P. A.,
PolissiouM.G.,Alonso,G.L.Changesinsaffronvolatileprofileaccordingtoitsstorage
time.FoodRes.Int.2010;43:13291334.
[120] Chen,J.L.,Wu,J.H.,Wang,Q.,Deng,H.,Hu,X.S.Changesinthevolatilecompounds
and chemical and physical properties of Kuerle fragrant pear (Pyrus serotina Reld)
duringstorage.J.Agric.FoodChem.2006;54:88428847.
[121] Spitzer,J.,Buettner,A.Characterizationofaromachangesinhumanmilkduringstorage
at19C.FoodChem.2010;120:240246.
[122] Jacobsson, A., Nielsen, T., Sjholm, I. Influence of temperature, modified atmosphere
packaging,andheattreatmentonaromacompoundsinbroccoli.J.Agric.FoodChem.
2004;52:16071614.
[123] Lozano, P. R., Miracle, E. R., Krause, A. J., Drake, M., Cadwallader, K. R. Effect of cold
storage and packaging material on the major aroma components of sweet cream
butter.J.Agric.FoodChem.2007;55:78407846.

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Lacromatografadegasescondetectorolfatimtrico:unaherramienta
esencialparaelanlisisdelaromadebebidasalcohlicas

CervezayMalta2009,XLVI(2),182,4962
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


LaCromatografadeGasesconDetectorOlfatimtrico:Unaherramientaesencialparael
AnlisisdelAromadeBebidasAlcohlicas

LauraAcea,OlgaBusto,MontserratMestres,JosepGuasch

GrupdeQumicaAnalticaEnolgicaidelsAliments.
DepartamentdeQumicaAnalticaiQumicaOrgnica.
CampusSescelades.FacultatdEnologia.
UniversitatRoviraiVirgili.43007Tarragona

Resumen

Aunquelasprimerasaplicacionesdelacromatografadegasescondetectorolfatimtrico(GCO)al
anlisisdelaromasellevaronacabohacecasi50aos,hasidoenlaltimadcadacuandosehan
intensificado los estudios sobre la actividad aromtica y la contribucin de los distintos
componentesalaromadediversasbebidasalcohlicasutilizandoestatcnica.Elhechodeaadira
uncromatgrafodegasesunpuertoolfatimtricoesloquepermitequeconlaGCOseconsigala
separacin de los constituyentes de un extracto aromtico y que estos puedan ser evaluados
sensorialmente a su salida de la columna cromatogrfica. De esta manera, con el detector
olfatimtrico es posible hacer una valoracin tanto cualitativa como cuantitativa de los distintos
componentes aromticos del extracto que se quiera analizar y, con el detector instrumental, se
puede,adems,identificarlosycuantificarlos.

En este artculo se describen las distintas tcnicas olfatimtricas desarrolladas para obtener una
estimacin de la importancia sensorial de los diferentes compuestos en el aroma global de una
muestra, y se comentan sus ventajas e inconvenientes. Se presenta tambin una revisin general
sobre las aplicaciones de la tcnica en el campo de las bebidas alcohlicas, ya sea para la
caracterizacinaromtica,ladeterminacindecompuestosconcretosoparaelcontroldecalidad.

Palabras clave: aroma, compuestos voltiles, bebidas alcohlicas, anlisis sensorial, cromatografa
degasesolfatimetra
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
112 CervezayMalta(2009)


Abstract

Althoughthegaschromatographyolfactometry(GCO)hasalreadybeenappliedforover40yearsto
the aroma analysis, it has not been until last decade when the researchers have intensified their
studies regarding the aromatic activity and the contribution of the different components to the
aromaofvariousalcoholicbeverages.Qualitativeandquantitativeodourevaluationofthedifferent
components of a sample is possible thanks to the presence of a special attachment to gas
chromatograph socalled olfactometric port. This port is connected in parallel to conventional
detectorsinsuchawaythattheanalytesreachbothdetectorssimultaneously.Therefore,withthe
instrumental detectors it is possible the identification and also the quantification of the different
aromaticcompoundsdetectedontheolfactometricport.

Keywords:aroma,volatilecompounds,alcoholicbeverages,sensoryanalysis,gaschromatography
olfactometry


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 113


1.Introduccin

Enelcampodelaalimentacinytambineneldelasbebidasalcohlicas,elaromaesunadelas
propiedades sensoriales decisivas para la seleccin y aceptacin de muchos productos. Para que
esta percepcin sensorial tenga lugar es necesario que las sustancias responsables del aroma
lleguenalasfosasnasalesdelconsumidor.Ahesdondeinteraccionarnconreceptoresprotenicos
de las membranas celulares demanera que, tras una cadena de reacciones qumicas, se obtendr
informacinsobrelacalidadycantidaddelaromapercibido.Aspues,loscomponentesdelaroma
deunalimentoobebidatienenqueservoltilesparaquelleguenhastalanariz,yaseaporvanasal
directacuandoloacercamosalanarizoporvaretronasalenelmomentodeseringeridos.Sin
embargo,teniendoencuentaqueexistenmuchassustanciasvoltilesinodoras,resultaevidenteque
lavolatilidadesunacondicinnecesariaperonosuficienteparaqueunasustanciahuela,porloque
habrquetenerencuentaotrosfactorestalescomolaestructuradelamolcula,laconcentraciny
entornoenquestaseencuentraylasensibilidaddelconsumidor[13].

=O

2,2,3,3-tetrametilbutano biciclooctano alcanfor

Figura1.Estructurasdeolorsimilar

En un compuesto aromtico, la relacin estructuraolor viene determinada por la presencia de un


grupo osmforo y la geometra de la molcula. Es decir, es necesario un grupo qumico capaz de
impresionarnuestrossentidosyunadisposicinadecuadadelostomosdelamolculaparaqueel
compuesto aromtico incida en un sitio concreto de nuestra pituitaria, de manera que pueda
percibirse uno u otro olor. Cada uno de estos parmetros tiene un peso especfico ms o menos
importantedependiendodelasustanciaodorante.Asporejemplo,el2,2,3,3tetrametilbutanoyel
biciclooctano poseen un olor muy parecido al del alcanfor, lo cual sugiere que lo que tiene una
importancia decisiva en este aroma no son los grupos funcionales, sino la forma compacta y casi
esfricadelamolcula(Figura1).Encambio,compuestoscomoelamoniaco(NH3)oelsulfurode
hidrgeno (H2S) presentan un olor extremadamente intenso, que no puede explicarse a partir de
consideracionesdetipoestrico.Elquedominaenestecasoeselgrupofuncional[2].

Otro factor a tener en cuenta es que es necesario un nmero mnimo de molculas o una
determinadaconcentracindeunasustanciaparaqueelsentidodelolfatoseacapazdepercibirla
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
114 CervezayMalta(2009)


o, dicho de otro modo, para llegar a lo que se denomina el umbral de percepcin. Determinar el
valor de este parmetro no siempre es tarea fcil puesto que cada individuo presenta una
sensibilidad olfativa propia y, adems, un mismo olor puede percibirse de manera muy distinta
dependiendo del entorno en el que se encuentre. De hecho, en nuestra vida cotidiana, muy
raramenteencontramosoloressimplesyaquecasitodosellosson,enrealidad,mezclascomplejas
de distintas sustancias odorferas. Sin embargo, hay que decir tambin que nuestro sentido del
olfatoeslimitadoalahoradeidentificaroloresporloque,inclusoenlasmezclasmssimplessino
estamos debidamente entrenados o no tenemos un don innato no solemos percibir aromas
distintos sino que lo identificamos como una unidad [3]. Esto se debe a que, con la evolucin, el
hombre ha ido perdiendo la necesidad primaria del olfato para su subsistencia, lo cual ha ido en
detrimentodeestesentido.Adems,talycomosedetallamsadelante,estasmuestrascomplejas
tienen efectos adicionales sobre los aromas individuales de manera que un aroma complejo no
puede considerarse como la suma aritmtica de los aromas que lo componen. Las interacciones
entre los distintos componentes pueden dar lugar a intensificacin de una nota aromtica o a su
atenuacin dependiendo de las concentraciones a las que se encuentren, de la matriz que los
contengaydelascondicionesambientalesenlasquesepercibaesearoma.

As pues, de manera consciente algunas vecese inconsciente la mayora de ellas, la llegada de un


odorantealolfatonosllevaahacerunavaloracincualitativa,cuantitativaeinclusoafectivadela
sensacin aromtica percibida [13]. Estos tres parmetros, conocidos tambin como las tres
dimensiones de la sensibilidad aromtica, son los que determinarn la calificacin de cualquier
sustanciatalycomoseexplicaacontinuacin.

1.1.SensibilidadAromtica

Resultacuriosoquecuandoalquererdescribiralgnolornotengamosunosdescriptoresdefinidosy
concretoscomosocurreenelcasodelosdemssentidos.Aspues,parapodervalorarlavertiente
cualitativadelasensibilidadaromtica,sesuelenutilizardescriptoresmsomenosampliosymso
menosdiferenciados(floral,especiado,afrutado,etc.),loscualessueleniracompaadosdeunoo
msmaticesenfuncindelasensibilidadaromticadelapersonaquepercibeelolorytambinde
lacomplejidaddelaroma.Dehecho,aunqueexistealgncompendiosobreellxicodelaroma[4],
engeneral,sloencamposmuyconcretos,dondeelaromaesunavariablemuyimportante,sehan
conseguidoterminologasadecuadasyespecficas.steeselcasodelvinoolacervezaparalosque
afinalesdelossetentaprincipiosdelosochenta,sepropusounaterminologaestandarizadadesus
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 115


respectivos aromas que, debido a su representacin grfica, se conoce como la rueda de los
aromasdelvino[5]odelacerveza[6].

Por otro lado, cabe destacar que, independientemente de que podamos definirlo, cuando
percibimos un olor nuestra memoria reactiva recuerdos, provoca emociones e, incluso, impulsa
acciones. As, por ejemplo, reaccionamos ante olores repulsivos o ftidos, que pueden llegar a
provocarnosnuseas,debidoaqueestosactancomomediodedefensaoderepulsinantecosas
quepuedenserpeligrosasparanosotrosaunquelacostumbrehaidodisminuyendoelusodeestas
advertencias. Contrariamente, existe toda una serie de olores que nos resultan extremadamente
agradablesyque,muchasveces,nostrasladaneneltiempoamomentosespecialesdenuestravida.
Estas respuestas se dan porque en la percepcin olfativa, aparte de la etapa qumica donde los
receptores envan seales hacia nuestro cerebro, hay otra psquica en la que nuestra memoria,
activada por el reconocimiento del olor en el cerebro, recuerda todo el contexto emocional en el
quesepercibiaquellasensacin.Todaestapartedelapercepcinaromticaqueestrelacionada
con la psicologa de cada individuo es lo que constituye la vertiente afectiva de la sensibilidad
aromticayeslaqueexplicaquecadapersonaapreciedemaneradiferenteunmismoolor[2,3].

Respecto a la medida de la dimensin cuantitativa del aroma, al igual que la medida de las otras
dimensiones de la sensibilidad aromtica, resulta un tanto subjetiva puesto que slo los mtodos
fisiolgicos que utilizan el aparato olfativo humano pueden darnos una medida de sta. Estos
mtodostienenencuentaqueesterganoenvaestmulosalcerebroparavalorarycuantificarlas
sensacionespercibidasapartirdelacantidaddesustanciaquelellega.Sinembargo,conelfinde
minimizarlasubjetividadqueimplicaestavaloracinsensorial,sehandefinidodosparmetrosque,
enestecontexto,resultandegranimportancia.Sonlosdenominadosumbralesdepercepciny
valoresdearoma[1].

El umbral de percepcin, tal y como se ha comentado anteriormente, hace referencia a aquella


cantidad de compuesto oloroso que resulta suficiente para reconocerlo por su olor y que
depender, en gran medida, de la complejidad de la matriz y del entorno en que se encuentre el
compuesto odorante. A ttulo de ejemplo, la Tabla 1 proporciona las concentraciones de los
umbralesolfativosdealgunoscompuestosendistintasmatrices[79].Losdistintosvaloresmuestran
cmoinfluyelamatrizenlaactividadaromticadelosodorantes.Deestemodo,mientrasquepara
percibirelolorarosasdel2feniletanoldisueltoenaguaesnecesariaunaconcentracinde1ppm,
parapercibirloenelairesenecesitaunaconcentracincasiunmillndevecesmspequea.Con
esto resulta obvio que para determinar la importancia sensorial de un compuesto individual en el
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
116 CervezayMalta(2009)


aromatotaldeunproducto,nonosvaleconsaberslosuconcentracinsinoquetambinnoses
necesarialainformacinreferenteasuumbraldepercepcin.

Compuesto Descriptor Umbralolfativo(mg/L)

Aire Agua OtrasMatrices

cidoactico vinagre 60106 2250 175(1)


6 3
2,3butadiona mantequilla 1510 1010 66103(1)

Acetaldehdo picante,rancio 41106 20103 1,2(2)


9 6
2isobutil3metoxipirazina pimientoverde 210 510 2106(2)

2furfuriltiol asado 70106 5106 0,4106(4)

Hexanal herbceo 35106 5103 0,35(1)


6 3
Sotoln especiado 1510 210 2,1103(3)

Linalool floral 0,5106 6103 70103(3)

Metional patata 0,1106 0,1103 0,5103(2)

2feniletanol rosas 15106 1 125103(3)

Vainillina vainilla 0,8106 25103 5103(3)

Tabla 1. Umbral olfativo de distintas sustancias en diferentes matrices. (1) cerveza; (2) disolucin
hidroalcohlica;(3)dispersinsobrecelulosa;(4)carne

Fruto de esta necesidad en el anlisis sensorial se propuso el concepto de valor de aroma de una
sustancia odorfera, el cual se define como el cociente entre la concentracin de la sustancia y su
umbraldepercepcinolfativo. Deestemodo,seconsideraqueunasustancianoparticiparenel
aromadelproductoevaluadosisuvalordearomaesmenorquelaunidad,ysqueloharcuando
dichovalorseamayorqueuno.Estoexplicaelporqusustanciasconumbraldedeteccinmuybajo
puedencontribuirenormementealaromadeunalimentoobebida,aunestandoaconcentraciones
tambin muy bajas, mientras que otras sustancias a concentraciones altas no contribuirn al olor
portenerunumbraldepercepcinelevado.Noobstante,hayquetenerencuentaquelosvalores
de aroma tienen que considerarse aproximaciones en la cuantificacin de las intensidades
aromticas,yaqueensuclculonoseconsideranefectossinrgicosoantagnicos,loscualessonde
difcilevaluacin.

Lasprimerasnocionesclarassobreesteparticularseobtuvieroninvestigandomezclas.Conellasse
demostr que, en el caso de componentes con notas aromticas similares, las intensidades son
aditivas, pero que la intensidad de la mezcla suele ser menor que la suma de las intensidades
individuales. Sin embargo, en las sustancias olorosas que se diferencian claramente por su nota
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 117


aromtica, se encontr que el perfil aromtico de una mezcla slo es la suma de los perfiles
aromticosdeloscomponentescuandolasintensidadessonsimilares[1],yaquesino,predominala
msintensa,suprimiendoelresto.

Adems, tampoco podemos olvidar que dado que, normalmente, los aromas que percibimos no
pertenecen a un compuesto aislado sino que forman parte de una matriz ms o menos compleja,
cuando se habla del carcter aromtico de una sustancia, tambin hay que tener en cuenta las
interaccionesconlosotrosconstituyentesdeesamatriz.Porello,yattulodeejemplo,enelcasode
losalimentossonimportanteslasinteraccionesconlpidos,protenasycarbohidratosyaqueestos
afectan,entreotrascosas,alaretencindesustanciasvoltilesenelalimento,loquedisminuyesu
concentracinenlafasegaseosa.Consecuentemente,estasinteraccionesafectanalaintensidady
calidad del aroma que percibimos. Otro punto a tener en cuenta es la modificacin que pueden
sufrirlassustanciasaromticasdependiendodelascondicionesdelmedioenelcualseencuentran,
comopuedenserelpH,lapolaridad,lapresenciadeoxgeno...Todaestacomplejidadhacequelos
investigadoresdeestecampolesigandedicandomuchosesfuerzos.

1.2.Sustanciasaromticasconcarcterimpacto

Deentretodaslassustanciasaromticas,merecenunaatencinespecialaqullasqueproporcionan
a un producto la esencia caracterstica de su olor. Son los denominados compuestos clave (key
substances)ocompuestosconcarcterimpacto.Estonosignificaqueestassustanciasseanlasque
se encuentran en mayor concentracin, sino que son las que tienen un valor de aroma ms
importante.

EnlaTabla2sepresentanalgunosejemplosdeestoscompuestos,enunaseleccindealimentos,
junto con el descriptor del olor del compuesto qumico [1, 2, 913]. En algunos casos, tal y como
muestranlosprimerosejemplosdelaTabla2,eselolordelcompuestoconcarcterimpactoelque
proporciona bsicamente la identidad sensorial al alimento en cuestin. Es decir, las setas huelen
como huelen debido a la presencia de la 1octen3ona en su aroma. Sin embargo, tal y como
muestran los ltimos ejemplos de la Tabla 2, tambin se consideran compuestos con carcter
impacto aqullos que son responsables de notas aromticas caractersticas en perfiles aromticos
complejos de manera que, aunque no se perciba su olor claramente, contribuyen de manera
decisivaalaromaglobal.Enestecaso,elaromadelalimentoquepercibimossedebealapresencia
devarioscompuestosconcarcterimpacto.stesera,porejemplo,loqueocurreconlapresencia
delageosmina,quehueleatierrayhumedad,enelaromadelaremolacha.Aunquelaremolacha
noslohueleatierraohumedad,suaromatieneunacomponenteimportantequenosrecuerdaa
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
118 CervezayMalta(2009)


estasnotasaromticasporloque,aunquelageosminanohuelearemolacha,estclaroqueesun
compuestoquetienecarcterimpactoenestealimento.

Compuesto Descriptor Alimento

Neral/geranial Limn Limn

2trans6cisnonadienal Pepino Pepino

1octen3ona Champin Setas

2trans4cisdecadionatodeetilo Pera Pera

2isobutil3metoxipirazina Pimientoverde Pimientoverde

2propenil2propenetiosulfinato Ajo Ajo

Furaneol Caramelo Fresas,pia

Geosmina Terroso Remolacha

4fenil2butanona Caramelo Frambuesa

2heptanona Quesoazul Leche

Z3hexenal Papel Tomate

4mercapto4metil2pentanona Boj VinoSauvignon

Benzaldehdo Almendrasamargas Almendras

E2nonenal Pesado,pepino Cortezadelpan

Tabla2.Ejemplosdecompuestosaromticosconcarcterimpacto

1.3.AnlisisdelAroma

Como ya se ha dicho, el aroma de una sustancia puede ser ms o menos complejo. En el caso
concreto de las bebidas alcohlicas, esta complejidad resulta evidente puesto que su aroma est
compuestoporungrannmerodesustanciasqueseencuentranenconcentracionesmuydistintas
desdeg/Lang/L,pertenecientesafamiliasqumicasdiferentescidos,steres,lactonas,fenoles,
etc.yconpropiedadesfsicasyqumicasdiversaspolaridad,volatilidad,etc..

La complejidad de estas muestras aromticas y las bajas concentraciones de algunos de sus


componentes (incluso hasta los 1010 g/L) hacen que su anlisis dependa del desarrollo de las
tcnicasanalticasy,msconcretamente,delacromatografadegases(CG).Enestecampo,eluso
de sistemas de deteccin, ya sean especficos o universales, ha hecho que la mayor parte de la
investigacin realizada sobre la composicin del aroma se haya centrado ms en el anlisis de los
compuestos voltiles que en el anlisis del aroma en s. Adems, cuando la investigacin se ha
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 119


dirigido hacia los componentesaromticos, lo ha hecho centrndose no tanto en el aromaglobal,
sinoenlaidentificacindecompuestosresponsablesdeolorescaractersticosyespecficos.Porello,
hoy en da, ha cobrado especial inters la investigacin que tiene como objetivo determinar el
nmero,tipoeimportanciarelativadelosodorantesquerealmenteparticipanenelaromadeun
producto. Dentro de este contexto toma especial relevancia el uso de la cromatografa de gases
acopladaaundetectorolfatimtricouolfatomtrico,comootrosautoresprefierendenominarlo,
lacualpermitelaevaluacinsensorialdeloscompuestosqueeluyendelacolumnacromatogrfica
pormediodelanarizhumana.

2.GCO

La cromatografa de gases con deteccin olfatimtrica o GCO (acrnimo del ingls Gas
ChromatographyOlfactometry),sebasaenlaevaluacinsensorialdeloscompuestosqumicosque
eluyendelacolumnacromatogrficaconelobjetivodedeterminarculesdestoshuelen,esdecir,
cules son activos aromticamente hablando. Para ello se utiliza como detector la nariz de una
personaadecuadamenteentrenada,demaneraqueseacapazdepercibir,describirycuantificarla
intensidad aromtica de los compuestos que eluyen, separados, de la columna cromatogrfica. La
determinacindelolordelosdistintosanalitosesposiblegraciasalapresenciadeuncomplemento
especial en el cromatgrafo llamado puerto olfatimtrico, el cual se conecta en paralelo a un
detector qumico convencional (generalmente un detector de ionizacin de llama FID o un
espectrmetrodemasasMS).Deestemodo,cuandoinyectamosunamuestra,eleluatosedividede
talmaneraquealcanzaambosdetectoressimultneamente,permitiendorelacionarlainformacin
qumica que aportan los detectores convencionales con la informacin sensorial que aporta el
detectorolfatimtrico(figura2).Hayquedestacarqueresultaespecialmentetillacombinacindel
detectorolfatimtricoconelespectrmetrodemasas,yaqueconstesepuedellegaraidentificar
culessonloscompuestosvoltilesaromticamenteactivos.

DesdelaprimeravezqueseuslanarizhumanacomodetectorcromatogrficoporpartedeFullery
sus colaboradores en el ao 1964 [14], han sido varias las mejoras que se han llevado a cabo. La
mayora de ellas han ido dirigidas a solventar los problemas de reproducibilidad debidos en gran
medida a la olfaccin de un efluente de gas seco y caliente. Para evitar este problema se suele
mezclar aire humidificado con el efluente caliente, de forma que se reduce significativamente la
deshidratacin nasal, la cual puede afectar de manera importante a la capacidad olfativa del
individuoquerealizaelanlisisolfatimtrico.Sinembargo,aunqueenlamayoradelasaplicaciones
delaGCOlosanalistasestnperfectamenteentrenadosyfamiliarizadosconlatcnica,nopodemos
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
120 CervezayMalta(2009)


olvidar que sta presenta unas limitaciones inherentes al uso de la nariz humana que tambin
pueden repercutir sobre la reproducibilidad. Ejemplos de estas limitaciones son el cansancio, la
anosmiaylasaturacindelolfatodelanalista,ascomolascondicionesfsicasyambientalesenlas
que se lleva a cabo el anlisis, lo cual alarga bastante el tiempo de anlisis en general. Adems,
tambin hay que tener en cuenta que el orden de elucin, el carcter aromtico y la intensidad
percibidaparaundeterminadocompuestopuedenafectardirectamentealaintensidadconquese
percibeelqueeluyeinmediatamentedespus.Esteefectopuedecorregirsefcilmentemodificando
elordendeelucindeloscompuestosmediantelavariacindeparmetroscromatogrficoscomo
latemperaturaolapresin,einclusovariandoeltipodecolumnacromatogrfica.

extracto

Inyector Detector Puerto


Qumico Olfatimtrico

------- Cono olfativo


Aire humidificado
HORNO GC

Sistema de aire
caliente
Agua

Pared del horno

Entrada de aire caliente

Columna capilar
HORNO GC
Columna capilar


Figura2.Esquemadeuncromatgrafodegasescondetectorolfatimtrico

La singularidad de la tcnica de la GCO ha hecho que se haya convertido en una herramienta


esencialparaelanlisisylacaracterizacindelaroma.Unodeloscamposdemayoraplicacinesel
de los alimentos y las bebidas. Los estudios sobre la caracterizacin del aroma de distintos
productos, la contribucin de compuestos voltiles especficos a un aroma determinado o la
identificacindelacausadealgunosoloresdesagradablessonlosmsusuales.Entodosloscasos
existendistintosfactoresquedeterminanlacalidaddelosdatosobtenidosutilizandoestatcnica,
como las condiciones cromatogrficas empleadas, el diseo del puerto olfatimtrico o el
entrenamientosensorialylasensibilidaddelosanalistas,yaquetodoellocondicionardemanera
importantelapercepcindelosaromas.

Desdeun punto devista ms analtico, para que la caracterizacin del aroma resulte exitosa, sta
depender tambin de la tcnica de pretratamiento que se utilice para aislar los compuestos
voltilesdelamuestradelrestodelamatriz.Elgrannmerodecompuestosvoltilesnormalmente
presentes en los alimentos y bebidas, las diferencias en sus propiedades fsicas y qumicas y, en
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 121


muchos casos, los bajos niveles de concentracin en los que se encuentran, hacen que su
aislamientodemanerarepresentativaseaunretoimportante.

Sin embargo, la representatividad del extracto no es un trmino absoluto, sino que depende del
objetivo de la investigacin. As, si el estudio est centrado en un compuesto concreto o en una
familiadecompuestos,elrequisitomsimportantequedebecumplirelextractoespresentaruna
elevada recuperacin de los compuestos de inters. Sin embargo, si el objetivo es, por ejemplo,
comparar el aroma de dos muestras diferentes, para que el extracto resulte adecuado deber
contener todos los compuestos importantes del aroma del alimento en cuestin y en unas
proporciones adecuadas. En este ltimo caso, una manera de comprobar la representatividad del
extracto consiste en llevar a cabo estudios sensoriales, mediante tests triangulares o descriptivos,
conelfindecompararelaromadelextractoobtenidoconeldelproductooriginal[14,15].

En general, no existe ninguna tcnica ideal para la extraccin de los compuestos voltiles de los
alimentosobebidas.Dehecho,latcnicautilizadacondicionardemaneradecisivalosresultados
obtenidos. La eleccin del mtodo de extraccin depende tanto del tipo de muestra como de los
objetivos que se pretendan conseguir y, casi siempre, supone un compromiso [16, 17]. De esta
manera,sisecomparanlastcnicasdeespaciodecabezaconlasdeextraccintotaldelamuestra
(extraccinlquidolquido,extraccinenfaseslida,destilacin,destilacinextraccinsimultnea),
puedepensarsequelasprimerasaportanunainformacinmsreal,yaqueelespaciodecabezaes
lafraccinquelanarizdetectacuandoolemoslamuestra.Sinembargo,todoesterazonamientoes
terico ya que, en la prctica, se ha comprobado que la tcnica del espacio de cabeza esttico
presentabajasensibilidadyquelatcnicadelespaciodecabezadinmico,aunquepermitellegara
lmites de deteccin muy bajos, puede comportar problemas como la generacin de artefactos o
efectosdememoria,debidosacompuestosquequedanfuertementeretenidosenlatrampayque
pueden aparecer en anlisis posteriores. Por otro lado, las tcnicas de extraccin que utilizan
disolventes orgnicos suelen favorecer la extraccin de los compuestos ms afines al disolvente
empleado, lo cual puede ser una ventaja cuando se pretende la extraccin de unos determinados
componentes del aroma, pero que tambin puede constituir un problema cuando no se persigue
esta selectividad. Este mismo problema lo podemos encontrar cuando se trabaja con tcnicas de
extraccin en fase slida, slo que en este caso el factor limitante es el absorbente utilizado.
Respecto a las tcnicas que requieren un aporte de temperatura, como ocurre con la destilacin,
hay que tener en cuenta que este parmetro puede ocasionar el deterioro de la muestra o la
aparicin de artefactos [1517]. Y, as, podramos seguir enumerando las distintas ventajas e
inconvenientesdelasdiferentestcnicasdeseparacindeloscomponentesvoltiles.Noobstante,
teniendoencuentaqueelresultadodecualquierestudioenelqueseutilicelaGCOdependerdela
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
122 CervezayMalta(2009)


representatividad del extracto, resulta obvio que habr que invertir un tiempo sustancial en la
comparacin de las distintas tcnicas para elegir la o las puesto que se puede utilizar una
combinacindevariasdeellasquemayorrepresentatividadaromticaproporcionen.

Una vez se ha obtenido un extracto aromtico representativo de la muestra que se pretende


analizar,conlatcnicadelaGCOseposeeunaherramientaquepermiteidentificarloscompuestos
qumicosdedichoextractoquepresentanolor.Sinembargo,enelanlisisdelaromanobastacon
estosinoque,adems,esnecesariodeterminarlaimportanciarelativadecadaunodelosoloresen
el aroma global de la muestra. Con este fin se han desarrollado diferentes tcnicas olfatimtricas
queseexponenseguidamente.Aunquetodasellaspresentanventajas,hayquedecirquetambin
presentaninconvenientes,loquedemuestraqueelproblemanoestdefinitivamenteresuelto.

3.Tcnicasolfatimtricas

Elprimerintentodeevaluarlacontribucinsensorialdeuncompuestoalaromadeunasustancia
fue llevado a cabo en el ao 1963, antes del desarrollo de la GCO, cuando Rothe y Thomas
calcularon la relacin entre la concentracin del compuesto en la muestra y su umbral de
percepcinsensorial[18].Aestarelacinladenominaronvalordearoma.Segnestateora,taly
como ya se ha introducido en el apartado 1.1, aquellos compuestos que presenten un valor de
aromasuperioralaunidadinfluirnenelaromadelasustanciaencuestin.Estamaneradeevaluar
la importancia sensorial de los compuestos voltiles requiere, por lo tanto, la cuantificacin y la
determinacindelumbraldepercepcinsensorialdecadaunodeloscompuestosodorantesdela
muestra,locualsuponeunainversindetiempoconsiderable.

Conelobjetivodeobtenerunaestimacindelaimportanciasensorialdelosdiferentescompuestos
enelaromadeunamuestradeunamaneramssencilla,sehanidodesarrollandodistintastcnicas
olfatimtricas.Enfuncindeltipodemedidaqueseutiliza,stassepuedenclasificaren:tcnicasde
dilucin,tcnicasdetiempointensidad,tcnicasdeintensidadposteriorytcnicasdefrecuenciade
deteccin.Acontinuacinsedescribentodasellas,indicandosusventajasysusinconvenientes.

3.1.Tcnicasdedilucin

Estas tcnicas consisten en analizar mediante la GCO un extracto del aroma de la sustancia de
inters para determinar a qu tiempos de retencin aparecen olores. Posteriormente, se llevan a
cabo diluciones sucesivas del extracto, normalmente con el mismo disolvente orgnico utilizado
parasuobtencin,quetambinseanalizanolfatimtricamente.Amedidaqueaumentaladilucin
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 123


del extracto van detectndose menos olores en su anlisis mediante la GCO, hasta llegar a una
dilucin en la que ya no se percibe ningn olor. Para cada compuesto se determina su factor de
dilucin como la ltima dilucin a la que se ha detectado su olor. Cuanto mayor es el factor de
dilucindeuncompuesto,mayoressucontribucinalaromadelasustanciaencuestin.Deesta
maneraseobtieneunaclasificacinjerarquizadadeloscompuestosolorosossegnsuimportancia
aromtica.

Las dos tcnicas de dilucin principales son el CHARM (Combined Hedonic Aroma Response
Measurements), desarrollada por Acree y colaboradores [19], y el AEDA (Aroma Extract Dilution
Analysis)desarrolladaporGroschycolaboradores[20,21].

Figura3.Cromatograma(izquierda)yaromagrama(derecha)obtenidossimultneamentecondetectoresFIDy
OlfatimtricoalaplicarlatcnicaAEDAaunextractodelaromadeunacervezaPilsner[22].

LatcnicaAEDAeslamssencilladelasdos,yaqueenstaelanalistaslotienequeconcentrarse
en la deteccin de los olores y en la descripcin de los mismos. El resultado se expresa como el
factordedilucinque,comoyasehadicho,eslamximadilucinalaqueansedetectaelolor.La
representacinde los factoresde dilucin frente el tiempo deretencin (o frente a los ndices de
Kovats) se denomina aromagrama. En la figura 3 se muestra un ejemplo de aromagrama
correspondiente al anlisis de un extracto del aroma de una cerveza utilizando esta tcnica [22].
Comosepuedeobservar,enlapartederechadelafiguraseespecificanlosvaloresdelosfactores
dedilucinparalosdistintosoloresdetectados.Enlaparteizquierda,sepresentaelcromatograma
queseobtienesimultneamenteconundetectorFID.Deestemodopuedeversedemaneragrfica
loqueyasehacomentadosobreelhechodequeunagrancantidaddeuncompuestovoltil(locual
darlugaraunasealcromatogrficaimportante)notieneporquimplicarunagranimportancia
sensorialenunalimento(loquesetraducirenunvalordelfactordedilucinelevado).
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
124 CervezayMalta(2009)


EnloquealatcnicaCHARMserefiere,elanalista,ademsdedescribirelolorquedetectatiene
quesealarelmomentoenelqueempiezaeloloryelmomentoenelquetermina.Estoseconsigue
con un dispositivo conectado a un sistema informtico en el que el analista tiene que apretar un
botncuandodetectaelolor,mantenindolopresionadohastaquedichoolorcambiaodesaparece.
Deestamaneraelsistemainformticoregistraelintervalodetiempoqueduracadaolor.Eneste
caso, adems del factor de dilucin, para la construccin del aromagrama tambin se tiene en
cuenta la duracin del olor, lo cual hace que tenga un aspecto ms parecido a un cromatograma
[23].

La figura 4 muestra de manera esquemtica cmo se construyen los aromagramas con la tcnica
CHARM. En el anlisis de cada dilucin, el intervalo del tiempo de retencin de cada olor se
representamedianteunasealcuadrada.Eldiagramafinalseconstruyesuperponiendolasseales
cuadradasparacadadilucinanalizada.ElreadeestasealseconocecomoelvalorCHARM,yesel
queseutilizaparacuantificarlapotenciaaromtica,mientrasquelaalturacorrespondealfactorde
dilucin[17].

Valordedilucin
1
respuesta

1/27
0
1 Algoritmo
1/9
0 (anchura,nmerodediluciones) 3
aprox.sumatorio
1
1/3 1
0
tiempo 0

ndicederetencin

Figura4.EsquemadelaconstruccindelosaromagramasCHARM.

Comoyasehacomentadoconanterioridad,laobtencindelextractoaromticoesunodelospasos
mscrticosdelosmtodosolfatimtricospuestoquetienequeextraersedemanerarepresentativa
un gran nmero de compuestos voltiles de diferente naturaleza qumica. Adems, teniendo en
cuentaqueestoscompuestossuelenhallarseaconcentracionesbajas,enlamayoradeloscasos,es
necesario concentrar el extracto. Este proceso puede comportar prdidas importantes de algunos
compuestos olorosos que falsearn los resultados finales, ya que la potencia aromtica de estos
compuestosseversubestimadaenelanlisisolfatimtrico.Conelobjetivodeevitaresteproblema
se desarroll la tcnica AECA (Aroma Extract Concentration Analysis), una tcnica que
conceptualmente puede considerarse de dilucin, pero en la que en vez de analizarse por GCO
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 125


sucesivasdilucionesdelextracto,loqueseanalizansonsucesivasconcentracionesdelmismo[24].
Esdecir,enelAEDAseanalizanporGCOdilucionesdeunextractoquesehaobtenidoextrayendo
loscompuestosvoltilesdelamatrizyconcentrndolos,mientrasqueenelAECAseanalizaporGCO
el extracto obtenido aislando los compuestos de la matriz, pero sin someterlos a un proceso
posteriordeconcentracin.Despus,mediantelaeliminacindeldisolvente,sevaconcentrandoel
extractodemanerasucesivayencadapasodeconcentracinseanalizaunaalcuotadelamuestra
por GCO. De esta manera se determinan tambin los olores que pueden perderse durante el
procesodeconcentracin.

Tal y como se ha expuesto, en la mayora de los mtodos descritos que utilizan las tcnicas de
dilucin, el extracto de la muestra que se analiza es lquido y sus diluciones se realizan con un
disolvente orgnico adecuado. Sin embargo, se han desarrollado algunos mtodos en los que el
extracto analizado no es un lquido, por lo que han tenido que buscarse alternativas para poder
trabajar con diluciones de las muestras. As, Guth y Grosch propusieron una nueva modalidad del
AEDA combinando la tcnica del espacio de cabeza con la GCO [25]. En este caso la dilucin se
obtenainyectandovolmenesdecrecientesdelespaciodecabezaenelcromatgrafodegases.Por
otrolado,Deiblerycolaboradoresdesarrollaronotromtodoenelqueutilizabanlamicroextraccin
enfaseslidaoSPME(acrnimodelinglsSolidPhaseMicroextraction)comotcnicadeextraccin
yconseguanelefectodeladilucin,paracalcularlosvaloresCHARM,utilizandofibrasdediferente
grosorydediferenteslongitudes[26].Estamismatcnicadeextraccinenfaseslidatambinha
sido utilizada para la caracterizacin del aroma del vino. En este caso se aplic una variante de la
tcnicadedilucinAEDAqueconsisteendeterminarlosfactoresdedilucinapartirdelosanlisis
olfatimtricosdelosextractosdesucesivasdilucionesdelapropiamuestra[27].

Las tcnicas AEDA y CHARM son tcnicas que nos proporcionan una idea aproximada de la
contribucin de los compuestos al aroma de una sustancia, pero en ningn caso los resultados
puedenconsiderarsedemaneracategrica.Dehecho,lainterpretacindelosdatosobtenidostras
aplicar la GCO es una etapa crtica, ya que estas tcnicas estn basadas en los umbrales de
percepcin sensorial de los compuestos voltiles en el aire y no en la propia muestra. Esto es as
porque,cuandosellevanacabolosanlisisolfatimtricos,loscompuestosolorososdelextractoson
separados cromatogrficamente de manera que se evalan individualmente a su salida de la
columna cromatogrfica. Sin embargo, el comportamiento y tambin la volatilidad de los
compuestosenlosalimentosdependendesusolubilidadenlamatriz,ascomodelasinteracciones
conloscomponentesdelamatrizquenosonvoltiles.Porestemotivo,enmuchoscasosseutilizan
estastcnicascomounpasoprevioaladeterminacindelosvaloresdearoma[28].Deestemodo,
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
126 CervezayMalta(2009)


sesimplificamuchoeltrabajoyaqueslosedeterminaelvalordearomadeaquelloscompuestos
quehandadocomoresultadounapotenciaaromticaimportanteenelanlisisolfatimtrico.

Unavezdeterminadosculessonloscompuestosconunimpactosensorialimportanteenelaroma
deunamuestraesnecesariollevaracaboestudiosderecombinacinparaverificarlos resultados
obtenidos [17]. Estos estudios consisten en elaborar una muestra sinttica a partir de la
combinacin de los compuestos con importancia sensorial a las concentraciones en que se
encuentranenlamuestrarealy,medianteunpaneldecatadores,determinarcuntosepareceel
aromadelamuestrasintticaalaromadelamuestrareal.Despus,medianteestudiosdesupresin
que consisten en evaluar de manera consecutiva las muestras sintticas, pero eliminando un
determinadocompuesto,puedeconocerseelpapelrealquejuegaestecompuestoenelaromadela
sustanciaanalizada.

Las tcnicas de dilucin, como cualquier otra tcnica, presentan una serie de inconvenientes y,
muchosdeellosprovienendelhechodenocumplirlasleyespsicofsicasdelapercepcinaromtica.
Estastcnicasasumenquelarespuestaaunestmuloolfativoeslinealconladilucinyquetodos
loscompuestostienenlamismapendientederespuestacuandoaumentasuconcentracin[29].Sin
embargo, estas asunciones se contradicen con la ley psicofsica de Stevens que muestra que la
relacinentrelaintensidadaromticaylaconcentracinesexponencial:

I=k(CT)n

Enestaecuacin,Ieslaintensidadaromtica,Ceslaconcentracin,Teselumbraldepercepcin
sensorial, k es una constante de proporcionalidad que depende de cada compuesto y n es otra
constantequepuedevariarentre0.3y0.8.Segnestaley,doscompuestosqueseencuentrenala
mismaconcentracinyquetenganunosumbralesdepercepcinsensorialmuyparecidos,peroque
presentenexponentes(n)diferentes,presentarnintensidadesdeolormuydistintasyporlotanto
nocontribuirndelamismaformaalaromaglobaldelasustancia.

Otroinconvenientedelastcnicasdedilucineslagrancantidaddetiempoquerequieren,yaque
el estudio de una muestra puede durar varios das. Hay que tener en cuenta que se tienen que
analizarolfatimtricamenteelextractodelamuestraylasdilucionesquesehagandelmismohasta
quenosepercibaningnolory,enmuchoscasos,elnmerodedilucionesnecesariasparallegara
estepuntopuedeserimportante.Porotraparte,debenhacerserepeticionesdelosanlisisdecada
dilucin.Atodoestohayqueaadirqueelnmerodeanlisisolfatimtricosquepuederealizarun
analistaenundaeslimitadodebidoalosproblemasolfativosquelepuedecausarelhechodeestar
oliendounefluentedegasescalienteduranteuntiempodemasiadoprolongado[3,15,29].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 127


Apesardelosinconvenientescitadosparalastcnicasdedilucin,stassonhastaelmomentolas
ms utilizadas para llevar a cabo una estimacin de la contribucin sensorial de los diferentes
compuestos voltiles al aroma de los alimentos, debido principalmente a su sencillez en el
procesamiento de la seal y a que no requieren instrumentacin sofisticada, sobretodo la tcnica
AEDA.Adems,lacomponentedesubjetividadporpartedelanalistaqueexisteenotrastcnicas,
lascualesseexplicanacontinuacin,noexisteenlastcnicasdedilucin,yaqueenstaselanalista
slotienequeindicarsipercibeonounolor,yenelcasodelCHARMindicar,adems,elmomento
enquesteempiezayacaba[17,29].

3.2.Tcnicasdetiempointensidad

Estastcnicassebasanenlaevaluacindelaintensidaddelolor.McDanielycolaboradoresfueron
losprimerosendesarrollarunatcnicadetiempointensidadalaquedenominaronOSME[30,31].
Este nombre deriva de la palabra griega que significa olor. En esta tcnica el analista utiliza un
dispositivoconsistenteenuncursorquesemueve150mmlongitudinalmenteyqueestconectado
aunsistemainformticoconelquesesealalaintensidaddelolorenunrangode0a15.Adems
seregistraeltiempoderetencinyladescripcindelolor.Larepresentacindelasintensidadesde
los olores frente el tiempo de retencin se denomina osmeograma y proporciona una
representacin grfica de la importancia sensorial de los compuestos en el aroma global de la
sustancia. El anlisis pueden realizarlo varios analistas (los investigadores que los desarrollaron
utilizancuatro)yconeltratamientoqueserealizaalosdatosobtenidosportodosellos,elaspecto
final que presenta el osmeograma es muy semejante al de un cromatograma. En la figura 5 se
muestranlosperfilesaromticosdeunextractodelaromadeunabebidaalcohlicaprocedentede
la fermentacin de anacardos, utilizando la cromatografa de gases con detector de ionizacin de
llama(FID)enlapartesuperior,yutilizandolacromatografadegasescondeteccinolfatimtricay
latcnicaOSMEenlaparteinferior[32].

Aunque en general las intensidades de los olores detectados a la salida de la columna


cromatogrfica presentan una buena correlacin con la concentracin de los compuestos
responsables de los olores, sorprendentemente los investigadores que utilizan esta tcnica
interpretan las diferencias entre osmeogramas basndose en las frecuencias de deteccin de los
olores(tcnicaqueseexplicamsadelante),ynoenlaestimacindelasintensidadesqueesloque
establece la tcnica OSME. Algunos autores atribuyen este hecho a que esta tcnica presenta
demasiadasdificultades,yaqueseobservaunagrandiscrepanciaentrelosdiferentesanalistastanto
enelnmerodecompuestosdetectadoscomoenlacalidaddesusolores[33,34]
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
128 CervezayMalta(2009)

Figura5.Perfilesaromticosdeunabebidaalcohlicaprocedentedelafermentacindeanacardosutilizandola
GCFID(arriba)ylaGCOconlatcnicaOSME(abajo)[32].

ConelpropsitodesolucionarestaslimitacionesdelatcnicaOSME,ungrupodeinvestigadoresdel
Institut National de la Recherche Agronomique(INRA) de Dijon desarroll otra tcnica de tiempo
intensidad a laque llamaron Finger Span Cross Modality Matching (FSCM) [3436]. Esta tcnica se
diferenciadelOSMEenelmododeevaluarlaintensidad.EnelFSCMelanalistasealalaintensidad
del olor que percibe separando el dedo pulgar y otro dedo, que puede ser el ndice o el corazn,
medianteundispositivo.Cuantomayoresladistanciaentrelosdosdedos,msintensoeselolor.
Esta forma de evaluar la intensidad de un estmulo olfativo haba sido descrita en estudios
psicofsicosrealizadosaladcadadelossesentaydelossetenta[36].Eldiagramaqueseobtieneen
la representacin de las intensidades frente el tiempo de retencin es muy similar a un
osmeograma. Mediante el uso de soluciones sintticas se ha comprobado que existe una relacin
logartmicaentrelosvaloresdealturadepicodeestediagramaylaconcentracindelcompuesto
responsabledelestmulo.

La ventaja que presenta el FSCM frente al OSME es que la medida de intensidad de los olores es
muchomsrpida,yaquelosanalistasslotienenquesepararlosdedosdemaneraintuitivayno
tienenqueperdertiempobuscandoconelcursorlaintensidadcorrespondiente.Hayqueteneren
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 129


cuentaque,lamayorpartedelasveces,laduracindelosoloresoscilaentreunoypocossegundos,
porloquelarapidezenlamedidaesunfactorclave[35].

Comparandolastcnicasdetiempointensidadconlastcnicasdedilucin,dadoquelasprimerasse
basanenlaevaluacindelaintensidaddelolor,susprincipiosnoestnendesacuerdoconlasleyes
psicofsicasdelapercepcinolfativacomopasabaconlastcnicasdedilucin.Encuantoaltiempo
que requieren para caracterizar aromticamente una muestra, tambin presentan claras ventajas
respecto a las tcnicas de dilucin, ya que en este caso slo es necesario realizar el anlisis del
extracto de la muestra. No obstante, en la determinacin de la importancia aromtica de los
diferentescompuestos,paralastcnicasdetiempointensidadexisteunacomponenteimportante
de subjetividad por parte del analista a la hora de medir las intensidades de los olores, la cual es
muchomenor,pornodecirprcticamenteinexistente,enlastcnicasdedilucin.

3.2.1.Tcnicasdeintensidadposterior

Estastcnicas,delmismomodoquelastcnicasdetiempointensidaddescritas,consistenenmedir
laintensidaddelolor.Ladiferenciaresideenque,enestecaso,elanalistaevalalaintensidaddel
olor percibido una vez que el compuesto ya ha eluido de la columna cromatogrfica [3]. Por esta
razn,algunosautoreslasclasificanenungrupodiferentealasanteriores[29].Parallevaracaboel
anlisis olfatimtrico utilizando las tcnicas de intensidad posterior, el panel de analistas debe
puntuarlasintensidadesenunaescalapreviamentefijada.Lamediadelosvaloresdeintensidadde
todoslosanalistaseslamedidadeintensidadqueseledaacadaolor,conlocual,altrabajarcon
valoresmediosdeunpaneldeanalistas,sereducelasubjetividaddemaneraconsiderable.Algunos
delostrabajosquesehanrealizadoutilizandoestatcnicamuestranquelasintensidadesevaluadas
conellapresentanunabuenacorrelacinconlaconcentracindeloscompuestosresponsablesde
losolores,porloquelastcnicasdeintensidadposteriorsepuedenutilizarconfinescuantitativos
[37,38].

3.3.Tcnicasdefrecuenciadedeteccin

En este tipo de tcnicas, la medida de la intensidad aromtica de un determinado compuesto se


basaenelnmerodeanalistasquehandetectadosuolor[39,40].Elanlisisolfatimtricoesllevado
a cabo por un panel de analistas que, mediante un sistema informatizado, registran el tiempo de
retencinalquesedetectanoloresascomosuduracin.Elaromagramaseconstruyeconlosdatos
obtenidos de todos los miembros del panel, de manera parecida a como se construyen los
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
130 CervezayMalta(2009)


aromagramas CHARM. La figura 6 muestra de manera esquemtica cmo se construyen los
aromagramas de la muestra analizada a partir de los olfatogramas de cada analista. En el grfico
final,laalturadepicocorrespondealnmerodeanalistasquehandetectadounoloraesetiempo
de retencin, mientras que el rea est relacionada con el tiempo de duracin de los olores.
Despusdenormalizara100(olordetectadoportodoslosmiembrosdelpanel),laalturadelpico
resultanteindicalafrecuenciadedeteccindeeseolorporpartedelpanel.Laalturayelreadel
pico se denominan NIF (Nasal Impact Frequency) y SNIF (Surface of Nasal Impact Frequency),
respectivamente[41].

OLFATOGRAMAS
INDIVIDUALES
AROMAGRAMA
1-

1- NIF %

1-
100% -

1-

1-

1-

tiempo
tiempo

Figura6.Tcnicasdefrecuenciadedeteccin.EsquemadelaconstruccindeunaromagramaNIFapartirdelos
olfatogramasdecadaanalista.

Aligualquelastcnicasdetiempointensidad,lastcnicasdefrecuenciadedeteccincumplenlas
leyes psicofsicas de la percepcin aromtica. Adems, como el anlisis lo realiza un nmero
importantedeanalistas,permiteaplicartestsestadsticosalosdatosobtenidos.

Aunquesehacomprobadoquelastcnicasdefrecuenciadedeteccinpuedenutilizarseconfines
cuantitativos [42], dado que requieren un gran nmero de anlisis olfatimtricos, los mismos
autoresdeltrabajorecomiendanutilizarlassolamenteencasosenlosqueseadifcilutilizarotrotipo
dedeteccin(concentracindelosanalitosdeintersenlamuestrainferioralasensibilidaddelos
detectoresqumicos,coelucindecompuestos,etc).

4.AplicacindelaGCOalanlisisdebebidasalcohlicas

Comoyasehacomentadoalolargodelartculo,elobjetivomsusualdelaaplicacindelaGCOen
todos los mbitos y, de manera concreta, en el anlisis de las bebidas alcohlicas, es la
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 131


caracterizacin delperfilaromticodeunamuestraparapoderdeterminarlaimportanciarelativa
de los compuestos aromticamente activos en el aroma global. Sin embargo, no podemos olvidar
otrosobjetivosqueestaranmsrelacionadosconladeterminacindecompuestosimpactooconel
controldecalidad.Enlatabla3semuestrandistintasaplicacionesdelaGCOadiferentestiposde
muestras.

4.1.Caracterizacindelaroma

Aunque en la bibliografa existen numerosos trabajos sobre la determinacin de la composicin


voltildedistintasbebidasalcohlicas,cuandonoscentramosenlarelacinentreestacomposicin
voltil y las propiedades organolpticas del producto analizado, el nmero de estudios es
considerablementemenor,aunquenadadesdeable.Dehecho,anconsiderandoladificultadque
entraaelhechodetrabajarconundetectorhumano,encontramosestudiossobrecaracterizacin
de aromas de cervezas [22, 43, 44], vinos [27, 33, 4550], whiskys [51, 52], tequila [53, 54],
champagne [55], cava [56], ron [57] e incluso de algunos licores chinos [5860]. En la mayora de
estos estudios lo que se pretende es una jerarquizacin de la contribucin de los distintos
componentes odorantes en el aroma global para obtener lo que sera una huella digital nica e
irrepetible del aroma del producto analizado. Adems, dado que las bebidas alcohlicas
caractersticas de una regin o elaboradas con un procedimiento concreto, generalmente se
caracterizanporsutipicidad,elusodelaGCOparadeterminareldistintoperfilaromticodecada
zonaovariedadresultadegranayudayeficacia.Sinembargo,hayotrosestudiosquevanmsally
utilizan esta huella digital para hacer comparaciones, por ejemplo, de cervezas con o sin lpulo, y
establecer similitudes y diferencias para llegar a determinar el efecto que tiene este distinto
tratamientosobreelaromafinal[61],oparadiferenciarelaromadetequilascondistintostiempos
de permanencia en barrica [54]. En otros casos lo que se pretende con estas caracterizaciones es
llegar a obtener lo que sera el aroma base de un producto determinado. ste es el caso, de un
estudiodedistintosvinostintosjvenesapartirdeloscuales sedemostrqueelaromabasedel
vino tinto se debe a la presencia de unos 20 compuestos, los cuales le proporcionan un aroma
bsico frutal, graso/lctico y alcohlico, constituido principalmente por cidos grasos, alcoholes y,
sobretodo,steres.Juntoaestoscompuestosaparecenotroscuyosoloresnopredominan,peros
enriquecenelaromaconnotassutilesflorales,lactnicasofenlicas[45].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
132 CervezayMalta(2009)


4.2.Determinacindecompuestosimpacto

La complejidad aromtica de las bebidas alcohlicas se halla directamente relacionada con su


procedencia yaquesta condicionar tanto lamateria prima utilizada ensuelaboracin como las
tecnologas empleadas. La tipicidad que aportan estos factores es la que permite que cada zona
geogrfica ofrezca unos productos significativamente distintos a los de otras zonas aunque la
materiaprimaolatecnologautilizadasseanlasmismas.

Muchas veces, esta tipicidad propia de cada regin, marca, denominacin de origen, etc. est
relacionadaconlapresenciadedeterminadoscompuestosconcarcterimpacto.Deahelqueno
sean pocos los estudios en los que se lleva a cabo una caracterizacin del aroma con el fin de
determinarculesdeloscomponentesdelaromaglobaltienenestecarcterimpactoqueconfiere
al producto final la esencia caracterstica de su aroma. De este modo, Fritsch y colaboradores
estudiaronloscompuestosconcarcterimpactodeunacervezaPilsnerdelazonadeBaviera[22],
Aznar y colaboradores determinaron los de vino de la Rioja [62], Ferrari y colaboradores, los del
coac [63] y Poisson y colaboradores hicieron lo propio con el whisky [52]. Aunque, en general,
estoscompuestospuedentenermuydistintanaturalezaqumica,sesabequehayalgunasfamilias
de compuestos qumicos que poseen alguna propiedad aromtica que los hace especialmente
interesantes. ste es el caso de los compuestos azufrados muchos de los cuales, incluso a niveles
traza,poseenolorescaractersticos,porloquehansidoobjetodeestudiodemaneraespecfica,por
ejemplo,encerveza[64],vino[65]ochampagne[66].

La dificultad en la investigacin de los compuestos impacto se asocia a la complejidad de los


estudios de omisin, los cuales son imprescindibles en este mbito. Los ensayos de omisin
consistenenireliminandounoaunolosdistintoscomponentesdeunamezcla(lacualseelabora
conloscompuestosdeterminadosenlacaracterizacindelaromaenlasmismasconcentracionesen
las que estn en la muestra) con el objetivo de determinar cul es el efecto sensorial que la
eliminacin de un componente tiene sobre el aroma global. Sin embargo, en mezclas aromticas
complejascomolasbebidasalcohlicas,laeliminacindeunodesuscomponentesnosueleejercer
unefectosignificativosobreelaromaglobal.Elloocurreporquesonvariosloscomponentesque,de
manera aditiva, sinrgica o antagnica, actan sobre cada descriptor aromtico, de forma que la
eliminacindeunodeelloscausaunefectopobre,difcilmentereconocibleyevaluable[67].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 133


4.3.Determinacindeoffflavours

Paralaaceptacindeunabebidaalcohlicay,engeneraldecualquiersustanciaquetengaolor,tan
importanteeslapresenciadearomascaractersticosdelproductoencuestincomolaausenciade
oloresanmalos.Laterminologainglesadenominaaestosoloresquenoseasocianalproductoen
elqueseencuentranoffflavours.Agrandesrasgospuededecirsequelosoloresextraosprovienen
delaprdidadeuncompuestoconcarcterimpacto,deuncambioenlaconcentracindeunao
ms sustancias, o bien de la modificacin de la composicin de los componentes individuales del
aroma,yaseaapartirdelosproductosnaturales,yaseaporcontaminacin[1].

Dado el impacto queestos compuestospueden tener sobreel aroma final, no esdeextraar que
variosinvestigadoreshayanfocalizadolainvestigacinhaciasudeterminacin.Deestamanera,en
estudiosrelacionadosconelvinoutilizandolatcnicadelaGCOsehaidentificadoycuantificadola
geosminacomouncompuestoconoloratierraquecontaminalosvinos[68],sehancaracterizado
algunoscompuestosconolorasetasytierraenuvas[69],ytambinsehaidentificadounapirazina
comoresponsabledeoloresamohoentaponesdevino[70].Enelcampodelacervezatambinse
haaplicadoconxitolatcnicadelaGCOparallevaracaboelestudiodedistintosoffflavours[71
73], algunos de los cuales relacionados con olores a moho [74]. En este estudio tambin se
proponen algunas medidas para prevenir la presencia de los compuestos estudiados (geosmina,
metilisoborneol,pirazinasycloroanisoles).Cabedestacarque,comoyasehadicho,laprocedencia
de estos offflavors no siemprees conocida, por lo que algunos trabajos sobrecerveza se centran
sobretodo en los factores responsables de la aparicin de estos offflavours, como puede ser la
exposicinalaluz[44].

4.4.CorrelacinentreGCOyevaluacionessensorialesconvencionales

Otrocampodeestudiomuyinteresanteparalasbebidasespirituosaseselquetienecomoobjetivo
principalelllegaracorrelacionarlosresultadosobtenidosmediantelaGCOconlosresultadosdelos
anlisis sensoriales convencionales. As por ejemplo, encontramos trabajos que consiguen una
correlacin en unos casos mejor que en otros utilizando como mtodo de anlisis sensorial un
simpletesttriangular(enestetestloscatadoresdebenencontrarculdelastresmuestrasquese
lesdaesdistintaalasotrasdos)[57,7577].Otrosautorescomparanlosresultadosutilizandoun
mtodo dotro [78] y hay algunos trabajos en los que se correlacionan los resultados de la GCO
conlosdeunsimpleanlisissensorialdescriptivodelamuestraanalizada[57].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
134 CervezayMalta(2009)


No obstante, cuando se trabaja con muestras aromticamente complejas como es el caso de las
bebidas alcohlicas, muchas veces estas correlaciones no resultan tan obvias, por lo que hay que
recurriratcnicasquimiomtricasadecuadas.Eselcasodeunestudioconvinosespaolesrealizado
por Campo y colaboradores [75] en el que utilizan el mtodo de mnimos cuadrados, al igual que
otrotrabajoconvinoscalifornianosdelavariedadChardonnaydeLeeycolaboradores[47].Porotro
lado,Furycolaboradoresllevaronacabounestudiomuyexhaustivodelarelacinentreelanlisis
sensorial y los resultados de la GCO de seis vinos utilizando para ello anlisis de proclsteres
generalizados[79].

4.5.Controldecalidad

De manera general, podemos afirmar que las bebidas alcohlicas son un producto que, por sus
caractersticas,basangranpartedesuvaloraadidoenlacalidadorganolpticay,porlotanto,en
su aroma. Adems, en ltima instancia, y a diferencia de otros alimentos que tienen ms
propiedades nutritivas, las bebidas alcohlicas tienen que complacer mayoritariamente a los
sentidos,yaquesuobjetivoprincipalesproporcionarsatisfaccinalconsumidor,porloquesunivel
de calidad estar determinado por su degustacin. Por ello, no es de extraar que el anlisis
sensorial, y tambin la GCO, participen con peso especfico en el control de calidad de estos
productos.

Como en cualquier otro campo, para obtener un producto de calidad es necesario un control de
todo el proceso desde la entrada de la materia prima hasta la salida del producto final. As por
ejemplo,esimportantequelasfrutas,bayas,granos,etc.utilizadosenlaproduccindelasdistintas
bebidas alcohlicas no presenten ningn tipo de defecto, como puede ser podredumbre o moho,
puesto que esto se podra traducir en la generacin de metabolitos indeseados que, en algunos
casos,podrandarlugaracompuestosconaromasindeseablesconlmitesdedeteccinmuybajos
[15,68].LaposibilidadqueofrecelaGCOdeidentificarestetipodecompuestos,tantoenlamateria
prima como durante la fermentacin, resulta de gran interspara la industriade este campo.Por
otro lado, existen tambin estudios que utilizan la GCO para estudiar la formacin del aroma de
distintasbebidasbajolainfluenciadealgnfactorcomo,porejemplo,elpH[80],eltiempo[54,80]
olaluz[44].

Otroparmetroaromticoquetienegranintersenelcontroldecalidaddelasbebidasalcohlicas
es el seguimiento de algn compuesto aromtico que aumente o disminuya su concentracin
cuando la calidad organolptica de la bebida en cuestin se ve degradada. A ttulo de ejemplo, la
determinacin del incremento del contenido en aldehdos como el metional durante el
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 135


almacenamiento de la cerveza puede ser un indicador del envejecimiento, pero tambin de la
disminucin de sus propiedades organolpticas [81]. De manera similar, un seguimiento de la
formacindedicarbonilospuedeayudaradeterminarsilascondicionesdealmacenamientosonlas
adecuadas[82],delmismomodoquelaintensidaddelolordeltrisulfurodedimetiloesunindicador
delestadodemadurezdelamisma[80].

Uncampointeresantequesehaabiertorecientementedentrodelcontroldecalidadutilizandola
GCOeslaidentificacindeloscompuestosresponsablesdequeelaromaperduremstiempoen
boca(aftertaste).ConesteobjetivosedesarrolllatcnicaBucalOdourScreeningSystem(BOSS),la
cualutilizalaStirBarSorptiveExtraction(SBSE)comotcnicaparaextraerelaromaquequedaen
bocaunavezsehaingeridolamuestra.Estatcnicasehaaplicadoconxitoenladeterminacinde
loscompuestosresponsablesdelaftertastedeunvinoChardonnay[83].

Paraconcluir,y considerandolosbuenosresultadosquesehanobtenidohastaelmomento, pero


teniendoencuentatambinlasmuchasincgnitasquequedanporresolverenelcampodelanlisis
delaromadelasbebidasalcohlicas,hayquedecirquelaaplicacindelatcnicadelaGCOeneste
mbitosiguesiendodegraninters.Porello,algunosdelosltimosestudiosvandirigidoshaciala
mejora de la tcnica, ya sea utilizando diferentes puertos olfativos, aumentando su sensibilidad,
incrementando su repetitividad, etc. Parte de esta mejora est directamente relacionada con la
obtencindeextractosmsrepresentativos,empleandotcnicasquerequieranpocamanipulacin
delamuestra,aunquetampocosepuedeolvidarquetambinesnecesarioseguirinvestigandopara
mejorarlastcnicasdecuantificacinutilizadasenlaGCO.



Laura Acea Muoz

Tabla3.AplicacionesdelatcnicadelaGCOalaromadedistintasbebidasalcohlicas

Bebida Referencia
N Ao Tipodeestudio TcnicadeExtraccin TcnicaOlfatimtrica
Alcohlica Bibliogrfica

1 1991 Cerveza Caracterizacindelaroma Extraccincondiclorometano AEDA Schieberle[43]


2 1991 Cerveza Offflavors Extraccincondiclorometano AEDA Schieberle[72]
ISBN:9788469432341/DL:T. 1040-2011

3 1996 Tequila Caracterizacindelaroma Extraccincondiclorometano AEDA Benn[53]


4 1998 Vino Determinacindecompuestosazufradosconcarcter ExtraccinsobrepHMB Frecuenciade Bouchilloux[65]
impacto deteccin
5 2000 Vinostintosjvenes Determinacindelabasearomticadelosvinostintos Desmixturizacinyposterior AEDA Ferreira[45]
jvenes extraccinconFren113
6 2000 Champagne Caracterizacindelaroma Desmixturizacinyposterior AEDA Escudero[55]
extraccinconFren113
7 2001 Cerveza Determinacindelosaromasprocedentesdellpulo SPE AEDA Lermusieau[77]
8 2001 ScotchWhisky Determinacindealgunoscompuestosimpacto SPME Tiempointensidad Connor[51]
9 2001 Tequila Determinacindecompuestosimpactoentequilascon Extraccincondiclorometano CHARM Lpez[54]
distintostiemposdepermanenciaenbarril
10 2001 VinoRioja DeterminacindecompuestosclaveenvinodelaD.O. SPE AEDA Aznar[62]
Rioja
11 2002 Brotesdebamb Determinacindecompuestosaromticamenteactivos SPME OSME Fu[58]
fermentados
12 2002 Coac Caracterizacindelaromadelcoacjoven Extraccinconisooctano NIF Lablanquie[84]
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

13 2002 VinoGarnacha CaracterizacindelaromadelvinoGarnacha SPE AEDA Ferreira[46]


14 2002 Whisky Determinacindeloscompuestosresponsablesdela Extraccincondiclorometano Frecuenciade Wanikawa[85]
notaverdeenwhiskys deteccin
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

15 2003 Vino Caracterizacindelaromadevinoscalifornianos ExtraccinconFren113 Frecuenciade Lee[47]


deteccin
16 2003 Cerveza Aromadelpuloencerveza ExtraccinconFren113 CHARM Murakami[73]
17 2003 Cerveza Aromadecervezaenvejecida SPME CHARM Murakami[73]
18 2003 VinoGarnacha Caracterizacindelaroma SPME AEDA Mart[27]
19 2003 Calvados Caracterizacindelaroma Extraccinconpentano AEDA Guichard[87]
20 2004 Vino Caracterizacindelaromadevinosdecalidad SPE TiempoIntensidad Cullere[48]
21 2004 Coac Determinacindecompuestosclavedelaroma Extraccincondiclorometano NIF Ferrari[63]

Laura Acea Muoz

22 2004 Cerveza Determinacindemetionalyfenilacetaldehdocomo Extraccincondiclorometano Frecuenciade SoaresdaCosta[81]


indicadoresdelaestabilidaddelaromadecervezas deteccin
23 2005 LicorchinoYanghe Caracterizacindelaroma SPME AEDA Fan[59]
Daqu
24 2005 Sake Estudiodelaevolucindelaromaduranteel SBSE AEDA Isogai[92]
envejecimiento
25 2005 CervezaPilsner Determinacindeloscompuestosimpacto Extraccincondiclorometano AEDA Fritsch[22]
ISBN:9788469432341/DL:T. 1040-2011

26 2005 VinoPinotNoir Caracterizacindelaroma Extraccincondiclorometano AEDA Fang[49]


27 2005 Cerveza EfectodelpHyeltiempoenelaromadelacerveza Extraccincondiclorometano AEDA GuyotDeclerck[80]
28 2006 Cerveza Comparacindelaromadecervezasconysinlpulo Extraccincondiclorometano CHARM Kishimoto[61]
29 2006 Vino CaracterizacindeVinoSauternes SPE AEDA Bailly[50]
30 2006 Zumodeanacardos Determinacindeloscompuestosimpactodelaroma Purgaytrampa OSME Garruti[32]
fermentado
31 2006 VinoMerlotyVino Comparacindelosaromas SPME Tiempointensidad Grbz[88]
CabernetSauvignon
32 2006 Vinodepalma Caracterizacindeloscompuestosimpacto Extraccincondiclorometano AEDA Lasekan[90]
33 2006 Ron Caracterizacindelaroma ExtraccinconFren113 CHARM Souza[57]
34 2007 Vino Identificacindesulfanilalcoholesconcarcterimpacto ExtraccinsobrepHMB Frecuenciade Sarrazin[86]
deteccin
35 2008 Vinospostreycava Caracterizacindelaroma Purgaytrampa Mezcladefrecuencia Campo[56]
eintensidad
36 2008 Vinodenaranja Caracterizacindelaroma Extraccincondiclorometano Tiempointensidad Selli[89]
37 2008 BourbonWhisky Determinacindecompuestosimpacto Extraccincondiclorometano AEDA Poisson[52]
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

38 2000 Brandy(distintas Comparacindelaroma SPMEyextraccinconFren Tiempointensidad Ebeler[91]


variedadesdeVitis 113
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

vinfera)
39 2008 CervezaPilsner Formacindedicarbonilosaromticosduranteel SPME Tiempointensidad Bravo[82]
almacenamiento

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
138 CervezayMalta(2009)


BIBLIOGRAFA

[1] H.D. Beliz, W. Grosch. En Qumica de los alimentos, 2 edicin, Cap. V. Ed. Acribia S.A.,
Zaragoza(1997)
[2] C.Fisher,T.R.Scott.EnFlavoresdelosalimentos.BiologayQumica,Cap.III.Ed.AcribiaS.A.,
Zaragoza(2000)
[3] C.M.Delahunty,G.Eyres,J.P.Dufour.J.Sep.Sci.,29(2006)21072125
[4] Gail,V.C.;Brenda,G.L(2001).EnAroma&FlavourLexiconforSensoryEvaluation.ASTMDS66
[5] A.C.Noble,R.A.Arnold,B.M.Masuda,S.D.Pecore,J.O.Schmidt,P.M.Stern.Am.J.Enol.Vitic.,
35(2)(1984)107109
[6] C.Meilgaard,D.S.Reid,andK.A.Wyborski.J.Am.Soc.Brew.Chem.,40(1982)119128
[7] F.Sauvageot.EnLesarmesalimentaires,CapII.Ed.Lavoisier,Tec&Doc.Paris(1992)
[8] M. Rychlik, P. Schieberle, W. Grosch. En Compilation of odor thresholds, odor qualities and
retention indices. Deutsche Forschungsanstalf fr Lebensmittelchemie and Institut fr
LebensmittelchemiederTeschnischen.UniversittMnchen(1998)
[9] H. Maarse. En Volatile compounds in food and beverages. H. Maarse (ed), TNOCIVO Food
AnalysisInstitute,MarcelDekker,Inc.NewYork(1991)
[10] H. Guth, W. Grosch. En Flavor chemistry. R. Teranishi, Wick EL, I. Hornstein (eds.). Kluwer
Academic/Plenum,NewYork(1999)377386
[11] P.Schieberle,P.Pfnuer.EnFlavorchemistry.R.Teranishi,WickEL,I.Hornstein(eds.).Kluwer
Academic/Plenum,NewYork(1999)147153
[12] S.LeGuen,C.Prost,M.Demaimay.J.Agric.FoodChem.,48(4),(2000)13071314
[13] A.Hinterholzer,P.Schieberle.Flav.Frag.J.,13(1)(1998)4955
[14] G.H.Fuller,R.Steltenkamp,G.A.Tisserand.Ann.N.Y.Acad.Sci.,116(1964)711724
[15] B.Plutowska,W.Wardencki.FoodChem.,107(2008)449463
[16] H.Guth,W.Grosch.Lebensm.Wiss.Technol.,23(1990)513520
[17] B.S.Mistry,T.Reineccius,L.K.Olson.EnTechniquesforanalyzingfoodaroma.R.Marsili(ed.).
MarcelDekkerInc.,NewYork(1997)265292
[18] M.Rothe,B.Thomas.Z.Lebensm.Unters.Forsch.,119(1963)302310
[19] T.E.Acree,J.Barnard,D.G.Cunningham.FoodChem.,14(1984)273286
[20] F.Ullrich,W.Grosch.Z.Lebensm.Unters.Forsch.,184(1987)277282
[21] P.Schieberle,W.Grosch.Z.Lebensm.Unters.Forsch.,185(1987)111113
[22] H.T.Fritsch,P.Schieberle.J.Agric.FoodChem.,53(2005)75447551
[23] I.Blank.EnTechniquesforanalyzingfoodaroma.R.Marsili(ed.).MarcelDekkerInc.,NewYork
(1997)293331
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 139


[24] R.Kerscher,W.Grosch.Z.Lebensm.Unters.Forsch.,204(1997)36
[25] H.Guth,W.Grosch.FlavourFraganceJ.,8(1993)173178
[26] K.D.Deibler,L.H.Lavin,T.E.Acree.J.Agric.FoodChem.,4(1999)16161618
[27] M.P.Mart,M.Mestres,C.Sala,O.Busto,J.Guasch.J.Agric.FoodChem.,51(2003)78617865
[28] W.Grosch.FlavourFraganceJ.,9(1994)147158
[29] S.M.vanRuth.BiomolecularEngineering,17(2001)121128
[30] M.R.McDaniel,R.MirandaLpez,B.T.Watson,N.J.Micheals,L.M.Libbey.EnFlavorsandoff
flavors.G.Charalambous(ed.).ElsevierSciencePublishersB.V.,Amsterdam(1990)2336
[31] M.daSilva,D.S.Lundahl,M.R.McDaniel.EnTrendsinFlavourResearch.H.MaarseandD.G.
vanderHeij(eds.).ElsevierSciencePublishersB.V.,Amsterdam(1994)191209
[32] D.S.Garruti,M.R.Franco,M.A.daSilva,N.S.Janzantti,G.L.Alves.LWTFoodSci.Tech.,39
(2006)373378
[33] R.MirandaLpez,L.M.Libbey,B.T.Watson,M.R.McDaniel.J.FoodSci.,57(1992)985993
[34] P.X. Etievant, G. Callement, D. Langlois, S. Issanchou, N. Coquibus. J. Agric. Food Chem., 47
(1999)16731680
[35] H.Guichard,E.Guichard,D.Langlois,S.Issanchou,N.Abbott.Z.Lebensm.Unters.Forsch.,201
(1995)344350
[36] P.X. Etivant. En Analysis of taste and aroma. J.F. Jackson and H.F. Linskens (eds.) Springer
Verlag,BerlinHeidelberg(2002)223237
[37] S.M.vanRuth,C.H.OConnor.FoodChem.,74(2001)341347
[38] V.Ferreira,J.Petka,M.Aznar,J.Cacho.J.Chromatogr.A,1002(2003)169178
[39] J.P.H.Linssen,J.L.Janssens,J.P.Roozen,M.A.Posthumus.FoodChem.,8(1993)17
[40] P. Pollien, A. Ott, F. Montigon, M. Baumgartner, R. MuozBox, A. Chaintreau.J. Agric. Food
Chem.,45(1997)26302637
[41] A.Chaintreau.EnFlavor,Fragance,andOdorAnalysis.R.Marsili(ed.).MarcelDekkerInc.,New
York(2002)333348
[42] P.Pollien,L.B.Fay,M.Baumgartner,A.Chaintreau.Anal.Chem.,71(1999)53915397
[43] P.Schieberle.Z.Lebensm.Unters.Forsch.,193(1991)558565
[44] D.Komarek,K.Hartmann,P.Schieberle.EnFlavourResearchattheDawnofthe Twentyfirst
Century.J.L.LeQurandP.X.tivant(eds.)Tec&DocEditions.Paris,2003,650653
[45] V.Ferreira,R.Lpez,J.Cacho.J.Sci.FoodAgric.,80(2000)16591667
[46] V.Ferreira,N.Ortn,A.Escudero,J.Cacho.J.Agric.FoodChem.,50(2002)40484054
[47] S.J.Lee,A.C.Noble.J.Agric.FoodChem.,51(2003)80368044
[48] L.Culler,A.Escudero,J.Cacho,V.Ferreira.J.Agric.FoodChem.,52(2004)16531660
[49] Y.Fang,M.Qian.FlavourFraganceJ.,20(2005)2229
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
140 CervezayMalta(2009)


[50] S.Bailly,V.Jerkovic,J.MarchandBrynaert,S.Collin.J.Agric.FoodChem.,54(2006)72277234
[51] J.Connor,K.Reid,G.Richardson.EnGasChromatographyOlfactometry:TheStateoftheArt.
J.V. Leland and P. Schieberle (eds.) ACS Symposium Series 782. American Chemical Society:
WashingtonDC,2001,113121.
[52] L.Poisson,P.Schieberle.J.Agric.FoodChem.,56(2008)58135819
[53] S.M.Benn,T.L.Peppard.J.Agric.FoodChem.,44(1996)557566
[54] M. Lopez, J. Dufour. En Gas ChromatographyOlfactometry: The State of the Art. J.V. Leland
and P. Schieberle (eds.) ACS SymposiumSeries 782. American Chemical Society: Washington
DC,2001,6272.
[55] A.Escudero,M.Charpentier,P.Etievant.Sci.Aliment.,20(2000)331347
[56] E.Campo,J.Cacho,V.Ferreira.J.Agric.FoodChem.,56(2008)24772484
[57] M.D.C.A.Souza,P.Vasquez,N.L.Mastro,T.E.Acree,E.H.Lavin.J.Agric.FoodChem.,54(2006)
485488
[58] S.Fu,Y.Yoon,R.Bazemore.J.Agric.FoodChem.,50(2002)549554
[59] W.Fan,M.C.Qian.J.Agric.FoodChem.,53(2005)79317938
[60] W.Fan,M.C.Qian.J.Agric.FoodChem.,54(2006)26952704
[61] T.Kishimoto,A.Wanicawa,K.Kono,K.Shibata.J.Agric.FoodChem.,54(2006)88558861
[62] M.Aznar,R.Lpez,J.Cacho,V.Ferreira.J.Agric.FoodChem.,49(2001)29242929
[63] G.Ferrari,O.Lablanquie,R.Cantagrel,J.Ledauphin,T.Payot,N.Fournier,E.Guichard.J.Agric.
FoodChem.,52(2004)56705676
[64] C. Vermeulen, S. Bailly, S. Collin. En Flavour Science. Recent Advances and Trends. W.L.P.
BredieandM.A.Petersen(eds.)ElsevierB.V.,2006,245248
[65] P.Bouchilloux,P.Darriet,R.Henry,V.LavigneCruge,D.Dubourdieu.J.Agric.FoodChem.,46
(1998)30953099
[66] T.Tominaga,G.Gimbertau,D.Dubourdieu.J.Agric.FoodChem.,51(2003)10161020
[67] W.Grosch.Chem.Senses,26(2001)533545
[68] P.Darriet,M.Pons,S,Lamy,D.Dubourdieu.J.Agric.FoodChem.,48(2000)48354838
[69] S. La Guerche, B. Dauphin, M. Pons, D. Blancard, P. Darriet. J. Agric. Food Chem., 54 (2006)
91939200
[70] R.F.Simpson,D.L.Capone,M.A.Sefton.J.Agric.FoodChem.,52(2004)54255430
[71] S.Sakuma,H.Amano,M.Ohkochi.J.Am.Soc.Brew.Chem.,58(2000)2629
[72] P.Schieberle.Z.Lebensm.Unters.Forsch.,193(1991)558565
[73] A.A.Murakami,H.Goldstein,A.Navarro,J.R.Seabrooks,D.S.Ryder.J.Am.Soc.Brew.Chem.,
61(2003)2332
[74] M.J.McGarrity,C.McRoberts,M.Fitzpatrick.MBAATQ,40(2003)4447
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
GCO:esencialparaelanlisisdebebidasalcohlicas 141


[75] E.Campo,V.Ferreira,A.Escudero,J.Cacho.J.Agric.FoodChem.,53(2005)56825690
[76] Y.Kotseridis,A.Razungles,A.Bertrand,R.Baumes.J.Agric.FoodChem.,48(2000)53835388
[77] G.Lermusieau,M.Bulens,S.Collin.J.Agric.FoodChem.,49(2001)38673874
[78] A.Escudero,B.Gogorza,M.A.Melus,N.Ortn,J.Cacho,V.Ferreira.J.Agric.FoodChem.,52
(2004)35163524
[79] Y.Fur,V.Mercurio,L.Moio,J.Blanquet,J.M.Meunier.J.Agric.FoodChem.51(2003)443452
[80] C.GuyotDeclerck,N.Franois,C.Ritter,B.Govaerts,S.Collin.Foodqualityandpreference,16
(2005)157162
[81] M.SoaresdaCosta,C.Gonalves,A.Ferreira,C.Ibsen,P.GuedesdePinho,A.C.Silva.J.Agric.
FoodChem.,52(2004)79117917
[82] A.Bravo,J.Herrera,E.Scherer,Y.JuNam,H.Rbsam,J.Madrid,C.Zufall,R.RangelAldao.J.
Agric.FoodChem.,56(2008)41344144
[83] A.Buettner.J.Agric.FoodChem.,52(2004)23392346
[84] O.Lablanquie,G.Snakkers,R.Cantagrel,G.Ferrari.Anal.Chim.Acta.,458(2002),191196
[85] A.Wanikawa,K.Hosoi,T.Kato,K.Nakagawa.Flav.Frag.J.,17(2002)207211
[86] E. Sarrazin, S. Shinkaruk, T. Tominaga, B. Bennetau, E. Frrot, D. Dubourdieu. J. Agric. Food
Chem.,55(2007)14371444
[87] H.Guichard,S.Lemesle,J.Ledauphin,D.Barillier,B.Picoche.J.Agric.FoodChem.,51(2003),
424432
[88] O.Grbz,J.M.Rouseff,R.L.Rouseff.J.Agric.FoodChem.,54(2006)39903996
[89] S.Selli,A.Canbas,V.Varlet,H.Kelebek,C.Prost,T.Serot.J.Agric.FoodChem.,56(2008)227
234
[90] O.Lasekan,A.Buettner,M.Christlbauer.FoodChem.,105(2006)1523
[91] S.Ebeler,M.Terrien,C.Butzke.J.Sci.FoodAgric.,80(2000)625630
[92] A.Isogai,H.Utsunomiya,R.Kanda,H.Iwata.J.Agric.FoodChem.,53(2005)41184123

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 4
El vinagre de vino con
DOP Vinagre de Jerez
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 145

4.1.ELVINAGRE

Desde la antigedad, el vinagre aparece en casi todas las culturas,


independientementedelapocayzonageogrficadondestassedesarrollaran,bien
como condimento, conservador de alimentos o ingrediente de los mismos, como
bebida, como desinfectante o como base de remedios sencillos frente a diversas
enfermedades [1]. Y aunque la palabra vinagre deriva etimolgicamente del latn
vinumacre,ymsconcretamentedelalocucinfrancesavinaigreovinoagrio,su
origen no debe circunscribirse exclusivamente al vino, dado que puede obtenerse a
partirdecualquiersustratoamilceosusceptibledeserfermentado[2].

4.1.1.Definicin

SegnlaFAO/OMS(CodexAlimentarius,1985),elvinagreesunlquidoaptopara
elconsumohumano,queseobtienedeformaexclusivaapartirdemateriasprimasde
origen agrcola que contengan almidones y/o azcares, por un doble proceso de
fermentacin,alcohlicayactica.Debecontenercantidadesdeterminadasdecido
actico y puede presentar otros ingredientes adicionales (hierbas, especias, sal), lo
que ser regulado por la Comisin del Codex Alimentarius. Estos ingredientes
opcionales se aaden con objeto de obtener un aroma peculiar y caracterstico de
cadatipodevinagre.

De acuerdo con la Reglamentacin TcnicoSanitaria espaola [3], la


denominacingenricadevinagredefineallquidoaptoparaelconsumohumano
resultante de la doble fermentacin alcohlica y actica de productos de origen
agrario que contengan azcares o sustancias amilceas. Los vinagres debern
presentarunvalordeacideztotal,expresadoengramosdecidoacticopor100mL
a 20 C, no inferior a 50 g/L, excepto para el vinagre de vino, que deber ser, al
menos,de60g/L.Estareglamentacinexcluyelosvinagresdevinoqueseamparen
endenominacionesdeorigen,especficasodecalidadreconocidas,queseregirnpor
sunormativaespecfica,cualquieraqueseasumbito.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
146 Captulo4

4.1.2.Tiposdevinagre

Puesto que prcticamente cualquier sustrato que presente carbohidratos


fermentables puede convertirse en vinagre y que el proceso de fermentacin
alcohlica y posterior acetificacin ha sido llevado a cabo por muy distintas
civilizaciones a lo largo de los siglos, existe una gran variedad de vinagres. Por este
motivo,losvinagrespuedenclasificarseenfuncindelamateriaprimaodelproceso
deelaboracinempleados[2,4,5].

Enaquellospasessintradicinenolgicaodondeelcultivodelavidesdifcilo
minoritario, los vinagres mayoritarios son los vinagres de frutas (dtiles, pia, coco,
ciruelas, etc.), de sidra (con larga tradicin en el Reino Unido y Estados Unidos), de
malta,decerealesodemelazas,ascomolosvinagresdearrozysake(ampliamente
extendidosenChinayJapn)yelvinagredealcohol.Esteltimoseelaboraapartirde
lafermentacinacticadeunadisolucinacuosadeetanol,elcualdebeprocederde
lafermentacinalcohlicademateriasagrcolas,seguidadedestilacin.Sinembargo,
elvinagrequeenEstadosUnidosseconocecomowhitedistilledvinegar,seelabora
apartirdecualquieralcohol,inclusoelsinttico,aunquepreviamentedesnaturalizado
(generalmenteconacetatodeetilo).

Excepcionesaestosvinagresdeorigenagrcolasonelvinagredesuerodeleche,
elvinagredemielyelvinagresintticooartificial.Elprimeroempleaelsueroresidual
obtenido tras la elaboracin del queso, y que debe ser pasteurizado antes de las
fermentaciones alcohlica y actica por su alta contaminacin con bacterias cido
lcticas.Elsegundoseobtieneapartirdelamieldiluida,lacualessumamentericaen
azcares. Por su parte, el vinagre sinttico se elabora con una disolucin acuosa
diluida de cido actico no biognico (obtenido a partir del acetileno o del cido
piroleosodelamadera)alaqueseaadenaromatizantes(vinagrevnico,destilado
devinosfermentados).


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 147

Hasta 1993, la legislacin alimentaria espaola [3] no contemplaba ninguno de


losvinagres anteriormente descritos, ya que, segn la reglamentacin vigente hasta
entonces [6], el trmino vinagre, sin ms calificativo, era sinnimo de vinagre
vnico,elnicoqueestabaautorizado.

Hoy en da, en Espaa y el resto de pases vincolas, la materia prima ms


comnmenteutilizadaenlaelaboracindevinagreeslauva,definindoseelvinagre
devinocomoelproductoobtenidoexclusivamenteporfermentacinacticadelvino.
De tal manera que, cuando se habla de vinagre, se hace referencia al vinagre de
vino.

4.1.3.Mtodosdeelaboracindelvinagredevino

En el proceso de obtencin del vinagre se produce una primera fermentacin


alcohlica por parte de las levaduras vnicas, las cuales transforman los azcares de
las uvas en etanol. Posteriormente, se produce una fermentacin actica de dicho
alcohol por las bacterias acticas, la cual genera el cido actico caracterstico del
productofinal.

Peromuchoantesdequesetuvieraconocimientodelosmicroorganismosque
participan en el proceso fermentativo, el hombre ya conoca y empleaba el vinagre.
De hecho, existen referencias a la obtencin del vinagre de dtiles en la cultura
babilnica(5000aosantesdeCristo)[7].Losmtodosdeelaboracinempleadosen
la antigedad eran empricos, artesanales y fundamentalmente familiares, y
consistan en permitir el lento contacto de un sustrato alcohlico con el aire. En el
casodelvinagredevino,bsicamenteconsistanendejarlosresiduosdeunbuenvino
enuntoneldemaderadurantebastantetiempo,enpresenciadelaviejamadredel
vinagre(restosdevinagresanteriores).

Hoyenda,desdeelpuntodevistatecnolgico,existendosmtodosclaramente
diferenciadosalahoradeproducirvinagre:losmtodosdeacetificacinconcultivo
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
148 Captulo4

sumergido (rpidos) y los mtodos tradicionales de acetificacin con cultivo


superficial(lentos)[2,7,8].

4.1.3.1.Mtodosdeacetificacinconcultivosumergidoomtodosrpidos

Estos mtodos se caracterizan por la presencia de un cultivo de bacterias


acticas sumergido en el seno del lquido a fermentar, sin la presencia de ningn
materialporosoosoporte,yporlaintroduccinconstantedepequeasburbujasde
aire(solooenriquecidoconoxgeno)atravsdelabiomasa[9,10].

En ellos, el proceso de la acetificacin es muy rpido (2530 horas) y los


rendimientos de la transformacin del alcohol en cido actico son muy elevados
(entre 9598%), gracias a la mayor poblacin bacteriana que se logra por la gran
disponibilidaddeoxgenoexistente.Parallevarlosacabosenecesitanacetificadores,
toneles de acero inoxidable que cuentan con una turbina de aireacin e
intercambiadoresdecalor,dadoqueelprocesodeacetificacinesmuyexotrmico.
Deestamanerapuedecontrolarselatemperaturaentornoalos30C,elvalorptimo
dedesarrollodelasbacteriasacticas[10,11].Comopuntofinalalaproduccin,el
vinagre obtenido por mtodos rpidos debe someterse a diversos tratamientos
tecnolgicos,comolaclarificacinyelfiltrado,paraconseguirunamayorestabilidad
yunaadecuadasalubridaddelproducto[2,10,11].

El principal problema que presentan los mtodos de acetificacin rpidos es la


prdida de componentes voltiles por el suministro continuo de aire, pero cuya
carencia puede paralizar la acetificacin dado el carcter aerobio de las bacterias
acticas[12].Porestemotivosehanllegadoaproponerfermentadorescerradoscon
sistemasderecirculacindeaire[13].

Gracias a estos mtodos de produccin se logra una gran uniformidad del


producto,ascomounaacetificacindegrandesvolmenesdealcoholenmuypoco
tiempo y ocupando pequeos volmenes de instalacin. De igual modo, estos
mtodospermitentrabajarcondispositivosautomticosqueregulanelcontroldela
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 149

aireacin(presinparcialdeoxgeno),latemperaturaylosciclosdecargaydescarga.
De manera que es as como se obtienen de forma rpida los vinagres comerciales
actuales(demenorprecio)que,despus,puedenenvejecerseonoenmadera.

4.1.3.2.Mtodosdeacetificacinconcultivosuperficialomtodoslentos

Enestosmtodos,lasbacteriasacticasseencuentranencontactodirectoconel
oxgenodelaire,bienporqueestnsituadasenlainterfaselquido/gasobienporque
estn fijadas a soportes materiales como virutas. En cualquier caso, el proceso de
acetificacin es lento, dada la limitada disponibilidad de oxgeno, lo que permite un
envejecimientosimultneo.

Unodeestosmtodos,ydelosmsantiguosenlaelaboracindevinagres,esel
mtododeOrleans.Empleatonelesde200400Ldecapacidad,colocadostumbados
en filashorizontalesy superpuestas.En losextremos de losfondos de cada barril, y
porencimadelcentrodelmismo,haydosagujerosdeunos5cmqueserellenancon
estopa.Estospermitenelpasodelaire,peronolaentradadelasmoscasdelvinagre.
El lateral superior presenta otro orificio que se tapa con un tapn de corcho y por
dondepenetrauntubodevidriorectoquecasillegahastaelfondodellquido.Asse
puede renovar el sustrato sin alterar el velo bacteriano situado en la superficie. Se
tratadeunprocedimientoesttico,dondeellquidoaacetificaresunamezcladevino
debajogradoalcohlicoconun20%devinagreturbio[7].

OtrodeestosmtodoseselmtodoluxemburgusoprocesoMichaelis.Enlse
emplea una cuba o tonel giratorio, colocado sobre un caballete. En el interior del
tonelhayunfalsofondoconnumerososypequeosagujeros,ylapartemenorest
rellenaconvirutasdemadera.Dichotoneltambincuentaconunorificioestrechoen
uno de sus costados, obturado con un tapn, y que sirve para su vaciado. Tras
introducir el vino en la barrica, sta se va girando peridicamente hasta que la
acetificacin se completa,momento enelqueelvinagre elaborado se sustituye por
porcionesigualesdevino[2].
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
150 Captulo4

El mtodo de Schtzenbach tambin es un mtodo lento, y en l se emplean


tonelesogeneradoresverticalesdemaderadeencinaconundoblefondo.Sobreel
primerfondo,queestagujereado,secolocanvariascapasdevirutasdemadera,de
encinaodehaya,impregnadasdevinagredebuenacalidad.Sobreelbordesuperior
del tonel o generador hay un diafragma perforado, con los orificios obturados con
algodn, por el que percola el vino desde la parte superior a la inferior a intervalos
regulares. De esta manera, el vino se pone en contacto ntimo con las virutas de
madera a la vez queburbujea elaire que existe entreellas, mientras queelvinagre
obtenido se extrae por la parte inferior. El sistema se contina hasta la
transformacincompletadelvinoenvinagre,volviendoareconducirelvinoenfase
de acetificacin desde la parte inferior hasta la superior mediante un bombeo
adecuado[2].

Porltimo,cabedestacardosmtodosdeacetificacinlentosresponsablesdela
obtencindedosvinagresartesanalesdegrancalidadyreconocimientointernacional,
que adems cuentan con la distincin de Denominacin de Origen Protegida por
parte de la Unin Europea: el Vinagre Balsmico Tradicional [14] y el Vinagre de
Jerez[15].

ElVinagreBalsmicoTradicional(VBT)seproduceenlasregionesitalianasde
Modena y Reggio Emilia a partir de mosto de uva. Dicho mosto se cuece a presin
atmosfrica por exposicin directa al calor hasta que se alcanza una reduccin de
volumen del 2030% [5, 16]. En este primer paso tienen lugar las reacciones de
Maillardentrelosaminocidosylosazcaresreductoresquesernlasresponsables
delacaramelizacinylaformacindenumerososcompuestoscongranimpactoenel
coloryelaromadelproductofinal[17].Trasunafermentacinalcohlicaparcial,el
lquidosetraspasaaunconjuntodebarricas,normalmenteentre5y7,dediferentes
maderasytamaodecreciente.Cadaaosesacaunpequeovolumendelabarrica
mspequea,queserellenaconelvinagredelabarricainmediatamentemayor[18].
Este procedimiento, denominado rincalzo, se lleva a cabo con cada barrica, de
manera que la ltima y ms grande es la que recibe el nuevo mosto cocinado en
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 151

sustitucindelvinagreretirado.Deestaforma,cadabarricacontieneunamezclade
vinagresdedistintosaos.Laedaddelproductoseincrementaaldisminuireltamao
delabarrica.

ParaqueelVBTpuedaserlegalmenteconsideradocomotal,debepresentarun
envejecimiento mnimo de 12 aos (entonces es etiquetado como Affinato). Si el
envejecimiento llega a los 25, entonces puede etiquetarse como Stravecchio. En
cualquiercaso,lacaractersticaprincipaldeesteproductoeselequilibrioqueselogra
entre el cido actico tpico de cualquier vinagre, que proporciona la sensacin
punzante,ylasnotasdulcesqueaportaelmostoinicialnofermentado.

En cuanto al Vinagre de Jerez, su elaboracin, caractersticas y atributos se


describen con ms detalle en los siguientes apartados, al haber sido este producto
objetodeestudiodelapresentetesisdoctoral.

4.2.ELVINAGREDEJEREZ

SegnEstrabn,ungegrafogriegodelsigloIa.C.,losfenicioscultivabanvias
en la zona de Jerez ya en el ao 1100 a. C., distribuyndose sus vinos por todo el
Mediterrneo[19].Dadoelcarcterespontneodelprocesodeacetificacin,puede
asegurarsequeelVinagredeJerezyaexistaporaquelentonces,aunquenofuehasta
el siglo I d. C. cuando Columela, un agrnomo nacido en Cdiz [7], dej constancia
escritadelaexistenciadeesteproductoporprimeravez.

Lascondicionesclimatolgicasdelazona,juntoadeterminadoselementosdela
elaboracin y crianza tradicionales del vino de Jerez, provocaron el que, en muchas
ocasiones,seelevaralaacidezvoltildelaspartidasdevinodeformaespontnea.Es
decir, por accin de las bacterias acticas, los vinos acababan convirtindose en
vinagres. Para no estropear el resto de la produccin, estos vinos picados se
aislaban en bodegas independientes, donde eran sometidos al mismo sistema de
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
152 Captulo4

envejecimientoquelosvinos.Lasparticularidadesdeestemtodo,juntoconeltipo
de barricas empleadas y el microclima de las bodegas, daban lugar a una serie de
transformacionesenlosvinagresquelesconferanunascaractersticasorganolpticas
especiales.De este modo surgieron unos vinagres de gran calidadqueempezarona
comercializarsebajolaDenominacindeOrigen(DO)VinagredeJerezapartirdela
aprobacindesuprimerreglamentoen1995[20].Desdeelao2000,elpatrimonioy
las funciones de su Consejo Regulador pasaron a integrarse en el de las DD.OO.
JerezXrsSherry,ManzanillaSanlcardeBarramedayVinagredeJerez[21].Y
en 2009 se ha concedido la proteccin nacional transitoria a la Denominacin de
OrigenProtegida(DOP)VinagredeJerez[15].

ElcomnmentedenominadoMarcodeJerez(Figura4.1)comprendelazonade
produccindelasmencionadasDD.OO.JerezXrsSherry,ManzanillaSanlcarde
BarramedayVinagredeJerez,extendindoseporochomunicipiosdelaprovincia
de Cdiz (Jerez de la Frontera, El Puerto de Santa Mara, Sanlcar de Barrameda,
Chiclana, Chipiona, Puerto Real, Rota y Trebujena), as como un municipio de la
provinciadeSevilla(Lebrija).Encuantoalazonadecrianza,staestrestringidaa
JerezdelaFrontera,SanlcardeBarramedayElPuertodeSantaMara.

Crdoba
Jan

Huelva
Sevilla
Granada
Almera
Mlaga

Cdiz

Figura4.1.SituacingeogrficadelMarcodeJerez

Solamentelasbodegasdeestosmunicipiospodrnrealizarelenvejecimientoyla
posterior expedicin de los vinagres amparados por la DOP Vinagre de Jerez, los
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 153

culessernlosnicosquepodrn(ydebern)llevarlaetiquetadeladenominacin
deorigenparagarantizarsuorigen(Figura4.2).

Figura4.2.EtiquetadelaDenominacindeOrigenVinagredeJerez

En cuanto a las variedades de uva autorizadas para el elaborar el Vinagre de


Jerez, son todas variedades blancas: Palomino de Jerez, Palomino Fino, Moscatel y
PedroXimnez,siendolaprimeramayoritariaencuantoaproduccin.

Deformageneral,elVinagredeJerezseobtieneapartirdevinosdeJerezque
sufren una acetificacin. Esta acetificacin puede ser por cultivo superficial en
barricas de madera (mtodo de Orleans) o por cultivo sumergido, pero siempre
seguidadeunenvejecimientoenbotas(barricas)derobleocastaoquepreviamente
hayan contenido vinos de Jerez, lo que se conoce como botas envinadas. Este
envejecimiento obligatorio puede llevarse a cabo por el mtodo esttico de la
aada o por el dinmico de criaderas y soleras, mucho ms extendido [22, 23]
(Figura4.3).

Enamboscasossedisponenvariasfilas(entre3y8)debotassuperpuestascon
capacidad inferior a 1000 litros, aunque la barrica tradicional para este
envejecimientoesladenominadabotajerezana,de500litrosyrobleamericano.Enel
sistema dinmico, la fila ms cercana al suelo se denomina solera y es la que
contiene el vinagre de ms edad, mientras que sobre ella se encuentran las
criaderas en orden creciente hasta llegar a la ltima fila, que es la denominada
sobretabla (Figura 4.3). De la solera se extrae el producto ya acabado en una
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
154 Captulo4

operacindenominadasaca,ydelacriaderainmediatamentesuperiorsereponeel
volumenextradoenloquesedenominaroco,yassucesivamentehastallegarala
sobretabla,queesdondeseaadeelvinooelvinagremsjoven.Comoelvolumen
extradonuncapuedesuperarunterciodelvolumentotaldelabotayellquidoque
se saca de una criadera se reparte entre todas las botas de la escala siguiente, el
producto final es una mezcla de diversas campaas, consiguindose una calidad
homognea,contrariamentealoquepasaconelsistemaesttico(Figura4.3),enel
quecadavinagreenvejeceenunasolabarrica.

MOSTO VINIFICACIN

VINO

ENVEJECIMIENTO ENVEJECIMIENTO
ESTTICO DINMICO

Sobretabla

2criadera

1criadera

Solera

SUELO

Figura4.3.SistemadeenvejecimientoestticoydinmicodelVinagredeJerez

Elnmeroylaperiodicidaddelassacasyrocosdependendelasbodegasy
hacenqueseadifcildeterminarconexactitudlaedaddeundeterminadovinagre.Por
esoelreglamentodistinguetrestiposenfuncindesuenvejecimiento[15]:

VinagredeJerez,conunenvejecimientomnimode6meses

VinagredeJerezReserva,apartirde2aosdeenvejecimiento
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 155

VinagredeJerezGranReserva,conmsde10aosdeenvejecimiento

Todosellosdebenpresentar,comomnimo,unaacideztotalenacticode70g/L
(80 g/L para los Gran Reserva) y un extracto seco de 1,30 gramos por litro y grado
actico (2,3 para los Gran Reserva). Al ser productos obtenidos por mtodos
tradicionales,elreglamentopermiteuncontenidoenalcoholresidualdehastael3%
envolumen.

Comoresultadodeesteparticularsistemadeenvejecimiento,sonnumerososlos
fenmenos que tienen lugar durante el prolongado contacto entre el vinagre y la
maderadelasbotas[15,23]:

unacesinpaulatinadelospolifenolesdelamaderahaciaelvinagre[24],los
cuales permiten estabilizar el color a la vez que influyen en el flavor y la
astringencia;

unaprdidadeaguaatravsdelosporosdelamadera(merma)queprovoca
una concentracin de los distintos compuestos qumicos, lo que, a su vez,
influyeenelaromaeincrementaelextractosecoylassalesmineralesy,por
tanto,elcontenidoencenizasdelvinagre;

diversas reacciones de condensacin, de polimerizacin, de Maillard o de


esterificacin entre compuestos del sustrato a envejecer y compuestos
extrados de la madera que, por ejemplo, incrementan el nmero y la
concentracindesteres(enespecialdelacetatodeetilo,congraninfluencia
enlascaractersticassensorialesdelvinagre);

distintasreaccionesdeoxidacinreduccin,responsablesdelageneracinde
compuestoscomolavainillinayelsiringaldehido.

Deestaforma,elconjuntodetodosestosprocesoseselresponsabledelagran
madurezycomplejidadaromticaycromtica,caractersticasdelosvinagresdeJerez.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
156 Captulo4

4.3.ELAROMADELVINAGREDEJEREZ

Como se ha visto en anteriores captulos, el aroma de cualquier producto se


debealaexistenciadedeterminadoscompuestosvoltiles,capacesdeinteraccionar
con nuestro sistema olfativo, y que tienen su origen, tanto en la materia prima
utilizada,comoenelprocesodeelaboracinseguido.

Respecto a los distintos tipos de vinagres, el anlisis del aroma comenz a


mediados del siglo pasado, aunque inicialmente se bas nicamente en la
determinacin individual de ciertos compuestos voltiles (metanol, acetaldehdo,
acetona o diacetilo, as como distintos steres y alcoholes superiores) [2]. Hasta la
aparicin de la cromatografa de gases no pudo separarse y cuantificarse de forma
conjuntalafraccinvoltilmayoritariadelvinagre.As,aunquesuprimeraaplicacin
en 1962 sobre vinagre de malta [25] se limit a la deteccin de etanol,
posteriormente, esta tcnica se utiliz con objetivos ms complejos. Entre ellos,
comprobarquediversasmuestrasdevinagredevinoydefrutascontenandistintos
acetatos, diacetilo, acetona y varios alcoholes, mientras que el vinagre destilado
solamentecontenaacetatodeetilocomocomponentevoltil[26].Tambinseaplic
estatcnicaparaidentificarhasta25compuestosvoltilesenelespaciodecabezade
diferentes tipos de vinagre (de vino, de sidra, de malta y de alcohol) [27], y para
realizar un estudio de la composicin voltil en las distintas etapas fermentativas,
paraloqueseanalizzumodemanzana,sidrafermentadayvinagredesidra[28].Ya
en1972seaplicporprimeravezlacromatografadegasesespectrometrademasas
paraidentificarlosvoltilesdedistintasmuestrasdevinagredestilado,demanzana,
demaltaydevinotinto[29].

Dado que cada producto presenta una composicin voltil nica, la fraccin
voltildedistintosvinagrestambinhasidoutilizadaparadiferenciaryclasificarestos
productos[3032].Estopermitelucharcontralosfraudesyasegurarlaautenticidady
calidaddelosproductos.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 157

En cuanto al anlisis del aroma del Vinagre de Jerez, hasta 1987 no se llev a
cabo un primer estudio acerca de la fraccin voltil de los denominados, por aquel
entonces, vinagres andaluces [33]. En l se detectaron 15 compuestos voltiles,
entre los que se encontraban mayoritariamente el acetato de etilo, el acetato de
metilo,eldietilacetal,elmetanolyel3metil1butanol.

Desde aquel momento, se han realizado distintos estudios para intentar


identificar los compuestos que constituyen la fraccin voltil del Vinagre de Jerez,
empleandoparaellolacromatografadegasesydiversastcnicasdeextraccin[34
37].Dadalaimportanciaquetieneelprocesodeenvejecimientoquesehadeseguir
paraobteneresteproducto,tambinsehaanalizadolaevolucindelperfilvoltilde
estosvinagresalolargodedichoproceso,tantosiseproducedeformanormal[38]
comosiesaceleradomedianteelusodevirutasdemadera[39].

Sin embargo, todos los estudios previamente descritos iban encaminados


nicamente hacia la identificacin de los compuestos voltiles, pero no de los
compuestosaromticamenteactivos,quesonaqullosquerealmentecontribuyenal
aroma del Vinagre de Jerez, ya que en ninguno de estos trabajos se empleaba la
cromatografa de gasesolfatometra (GCO). Precisamente, fue esta ausencia de
informacin sobre el tema fue lo que decidi a nuestro grupo de investigacin a
iniciarestalneadeestudio.Dehecho,hastaelmomentodecomenzaratrabajaren
esta tesis doctoral, nicamente se haba utilizado la tcnica de la GCO para
determinar los compuestos aromticos ms potentes en dos vinagres de vino tinto
[40].

Deestemodo,enelao2007seobtuvieronlosprimerosresultadosdelanlisis
delaromadelVinagredeJerezmediantelaaplicacindelacromatografadegases
olfatometra[41].Enestetrabajoinicialseproponaunaprimerajerarquizacindela
contribucindelosodorantesalaromadeesteproducto,emplendosecomotcnica
de extraccin y concentracin la microextraccin en fase slida sobre el espacio de
cabeza. Aunque ms tarde se han publicado otros trabajos en los que tambin se
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
158 Captulo4

utilizalaGCOparaanalizarelaromadelVinagredeJerez,lastcnicasdeextraccin,
ascomolasdedeteccindelosodorantesutilizadas,sondistintasalasempleadasen
nuestrasinvestigaciones[42,43].Sinembargo,hasidoeneltrabajoqueseexponeen
elartculoqueseincluyeacontinuacin,yquehasidoenviadoalarevistaJournalof
AgriculturalandFoodChemistry[44]parasupublicacin,cuandosehanconseguido
la identificacin y cuantificacin ms exhaustivas de los odorantes del Vinagre de
Jerezrealizadashastaelmomento.Enesteestudiosedetalla,nosloelprocesode
optimizacindelmtododeextraccindelosvoltilesdelVinagredeJerezmediante
microextraccinenfaseslidasobreelespaciodecabeza,sinotambinelanlisisde
loscompuestosaromticosporcromatografadegasesolfatometra,suidentificacin
ylacuantificacindelosmspotentes,juntoconelclculodesusvaloresdearoma.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 159

BIBLIOGRAFA
[1] Mazza, S., Murooka, Y. Vinegars through the ages. En: Solieri, L., Giudici, P., editors.
VinegarsoftheWorld.Miln:Springer;2009,p.1739.
[2] Guzmn Chozas, M. El vinagre. Caractersticas, atributos y control de calidad. Madrid:
DazdeSantos;1998.
[3] Presidencia del Gobierno (1993). Real Decreto 2070/1993 de 26 de noviembre, Boletn
OficialdelEstadonm.293de8dediciembre,porelqueseapruebalareglamentacin
tcnicosanitariaparalaelaboracinycomercializacindelosvinagres.
[4] Solieri,L.,Giudici,P.Vinegarsoftheworld.En:Solieri,L.,Giudici,P.,editors.Vinegarsof
theWorld.Miln:Springer;2009,p.116.
[5] Llaguno Marchena, C. Definicin y tipos de vinagre. En: Llaguno, C., Polo, M. C.,
coordinadoras. El vinagre de vino. Madrid: Consejo Superior de Investigaciones
Cientficas;1991,p.133145.
[6] PresidenciadelGobierno(1973).Decreto3024/1973de23denoviembre,BoletnOficial
del Estado de 4 de diciembre, sobre Reglamentacin para la elaboracin, circulacin y
comerciodelvinagredevinoydeorujo.
[7] Llaguno Marchena, C. Antecedentes histricos. En: Llaguno, C., Polo, M. C.,
coordinadoras. El vinagre de vino. Madrid: Consejo Superior de Investigaciones
Cientficas;1991,p.123.
[8] Tesfaye, W., Morales, M. L., GarcaParrilla, M. C., Troncoso, A. M. Wine vinegar:
technology, authenticity and quality evaluation. Trends Food Sci. Technol. 2002; 13: 12
21.
[9] Conner, H. A., Allgeier, R. J. Vinegar: its history and development. Adv. Appl. Microbiol.
1976;20:81133.
[10] GarcaGarca, I., SantosDueas, I. M., JimnezOt, C., JimnezHornero, J. E., Bonilla
Venceslada,J.L.Vinegarsengineering.En:Solieri,L.,Giudici,P.,editors.Vinegarsofthe
World.Miln:Springer;2009,p.97120.
[11] OrmaecheaLanda,A.R.Procesoindustrialdeelaboracindelvinagre.En:Llaguno,C.,
Polo, M. C., coordinadoras. El vinagre de vino. Madrid: Consejo Superior de
InvestigacionesCientficas;1991,p.4968.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
160 Captulo4


[12] Nieto,F.J.Algunosaspectosdelatecnologadelafermentacinactica.En:Llaguno,
C., Polo, M. C., coordinadoras. El vinagre de vino. Madrid: Consejo Superior de
InvestigacionesCientficas;1991,p.6996.
[13] deOry,I.,Romero,L.E.,Cantero,D.Maximumyieldaceticacidfermenter.Comparative
fedbatch and continuous operation studies at pilot plant scales. Bioprocess Eng. 1999;
21:187190.
[14] CouncilRegulation(EC),No.813/2000,April17,2000,OfficialJournalL100,20/04/2000,
pp.00050006.
[15] Resolucinde24demarzode2009,BoletnOficialdelEstadonm.90de13deabril,por
la que se concede la proteccin nacional transitoria a la Denominacin de Origen
ProtegidaVinagredeJerez.
[16] Zeppa,G.,Giordano,V.,Gerbi,V.,Meglioli,G.Characterizationofvolatilecompoundsin
threeacetificationbatteriesusedfortheproductionofAcetoBalsamicoTradizionaledi
ReggioEmilia.Ital.J.FoodSci.2002;14:247266.
[17] Piva, A., di Mattia, C., Neri, L., Dimitri, G., Chiarini, M., Sacchetti, G. Heatinduced
chemical,physicalandfunctionalchangesduringgrapemustcooking.FoodChem.2008;
106:10571065.
[18] Giudici,P.,Gullo,M.,Solieri,L.TraditionalBalsamicVinegar.En:Solieri,L.,Giudici,P.,
editors.VinegarsoftheWorld.Miln:Springer;2009,p.157177.
[19] MerinoSierra,F.J.,FernndezRebollo,R.M.VinagresandalucesconDenominacinde
Origen. En: Garca Garca, I., editor y coordinador. Segundas Jornadas de I+D+I en la
Elaboracin de Vinagres. Crdoba: Servicio de Publicaciones de la Universidad de
Crdoba;2006,p.265283.
[20] Consejera de Agricultura y Pesca (1995). Orden de 20 de febrero, Boletn Oficial de la
Junta de Andaluca nm. 38 de 9 de marzo, por el que se aprueba el Reglamento de la
DenominacindeOrigenVinagredeJerezydesuConsejoRegulador.
[21] Consejera de Agricultura y Pesca (2000). Orden de 22 de febrero, Boletn Oficial de la
JuntadeAndalucanm.33de18demarzo,porelqueseapruebaelReglamentodela
DenominacindeOrigenVinagredeJerez.
[22] Quirs, J. M. Elaboracin de vinagre de calidad en Jerez. Quad. Vitic. Enol. Univ. Torino
1990;14:115123.
[23] Tesfaye, W., Morales, M. L., GarcaParrilla, M. C., Troncoso, A. M. Jerez Vinegar. En:
Solieri,L.,Giudici,P.,editors.VinegarsoftheWorld.Miln:Springer;2009,p.179195.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
ElvinagredevinoconDOPVinagredeJerez 161

[24] Garca Parrilla, M. C., Heredia, F. J., Troncoso, A. M. Sherry wine vinegar: phenolic
compositionchangesduringaging.FoodRes.Int.1999;32:433440.
[25] Morgantini, M. The use of gas chromatography for the analysis of vinegars. I.
Concentrationofethanol.Boll.Lab.Chim.Prov.(Bologna)1962;13:117121.
[26] Suomalainen,H.,Kangasperko,J.Aromasubstancesofvinegarfermentation.Z.Lebensm.
Unters.Forsch.1963;120:353356.
[27] Aurand,L.W.,Singleton,J.A.,Bell,T.A.,Etchells,J.L.Volatilecomponentsinthevapors
ofnaturalanddistilledvinegars.J.FoodSci.1966;31:172177.
[28] Kahn,J.H.,Nickol,G.B.,Conner,H.A.Analysisofvinegarbygasliquidchromatography.
J.Agric.FoodChem.1966;14:460465.
[29] Kahn,J.H.,Nickol,G.B.,Conner,H.A.Identificationofvolatilecomponentsinvinegarsby
gaschromatographymassspectrometry.J.Agric.FoodChem.1972;20:214218.
[30] Natera, R., Castro, R., GarcaMoreno, M. V., Hernndez, M. J., GarcaBarroso, C.
Chemometric studies of vinegars from different raw materials and processes of
production.J.Agric.FoodChem.2003;51:33453351.
[31] Casale, M., Armanino, C., Casolino, C., Cerrato Oliveros, C., Forina, M. A chemometrical
approach for vinegar classification by headspace mass spectrometry of volatile
compounds.FoodSci.Technol.Res.2006;12:223230.
[32] DurnGuerrero,E.,CastroMejas,R.,NateraMarn,R.,PalmaLovillo,M.,GarcaBarroso,
C. A new FTIR method combined with multivariate analysis for the classification of
vinegarsfromdifferentrawmaterialsandproductionprocesses.J.Sci.FoodAgric.2010;
90:712718.
[33] Troncoso Gonzlez, A. M., Guzmn Chozas, M. Volatile components in Andalusian
vinegars.Z.Lebensm.Unters.Forsch.1987;185:130133.
[34] Blanch,G.P.,Tabera,J.,Sanz,J.,Herraiz,M.,Reglero,G.Volatilecompositionofvinegars.
Simultaneous distillationextraction and gas chromatographicmass spectrometric
analysis.J.Agric.FoodChem.1992;40:10461049.
[35] Natera Marn, R., Castro Mejas, R., Garca Moreno, M. V., Garca Rowe, F., Garca
Barroso, C. Headspace solidphase microextraction analysis of aroma compounds in
vinegar.Validationstudy.J.Chromatogr.A2002;967:261267.
[36] Durn Guerrero, E., Natera Marn, R., Castro Mejas, R., Garca Barroso, C. Stir bar
sorptive extraction of volatile compounds in vinegar: validation study and comparison
withsolidphasemicroextraction.J.Chromatogr.A2007;1167:1826.
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
162 Captulo4


[37] Chinnici, F., Durn Guerrero, E., Sonni, F., Natali, N., Natera Marn, R., Riponi, C. Gas
chromatographymass spectrometry (GCMS) characterization of volatile compounds in
quality vinegars with protected European geographical indication. J. Agric. Food Chem.
2009;57:47844792.
[38] Morales,M.L.,Tesfaye,W.,GarcaParrilla,M.C.,Casas,J.A.,Troncoso,A.M.Evolution
of the aroma profile of Sherry wine vinegars during an experimental aging in wood. J.
Agric.FoodChem.2002;50:31733178.
[39] Morales,M.L.,Benitez,B.,Troncoso,A.M.Acceleratedagingofwinevinegarswithoak
chips:evaluationofthewoodflavorcompounds.FoodChem.2004;88:305315.
[40] Charles, M., Martin, B., Ginies, C., Etievant, P., Coste, G., Guichard, E. Potent aroma
compoundsoftworedwinevinegars.J.Agric.FoodChem.2000;48:7077.
[41] Acea, L. Estudio olfatimtrico del aroma del vinagre con Denominacin de Origen
VinagredeJerez[DiplomadeEstudiosAvanzados].Tarragona:UniversitatRoviraiVirgili;
2007.
[42] Callejn, R. M., Morales, M. L., Troncoso, A. M., Silva Ferreira, A. C. Targeting key
aromatic substances on the typical aroma of Sherry vinegar. J. Agric. Food Chem. 2008;
56:66316639.
[43] Callejn,R.M.,Morales,M.L.,SilvaFerreira,A.C.,Troncoso,A.M.Definingthetypical
aromaofSherryvinegar:sensoryandchemicalapproach.J.Agric.FoodChem.2008;56:
80868095.
[44] Acea, L., Vera, L., Guasch, J., Busto, O., Mestres, M. Chemical characterization of
commercial Sherry vinegar aroma by headspace solidphase microextraction and gas
chromatographyolfactometry.J.Agric.FoodChem.2011(enviadoparasupublicacin).

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

ChemicalcharacterizationofcommercialSherryvinegararoma
byheadspacesolidphasemicroextractionand
gaschromatographyolfactometry

Artculoenviadoparasupublicacinenlarevista
JournalofAgriculturalandFoodChemistry(2011)
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

ChemicalCharacterizationofCommercialSherryVinegarAromabyHeadspaceSolid
PhaseMicroextractionandGasChromatographyOlfactometry

LauraAcea,LucianoVera,JosepGuasch,OlgaBusto,MontserratMestres

ResearchGroupofAnalyticalChemistryofWineandFood
DepartmentofAnalyticalChemistryandOrganicChemistry
CampusSescelades.FacultatdEnologiadeTarragona
UniversitatRoviraiVirgili.43007Tarragona(Spain)

ABSTRACT

The sensorial representativeness of the headspace solidphase microextraction (HSSPME) aroma


extract from commercial Sherry vinegars has been determined by direct gas chromatography
olfactometry (DGCO). The extracts obtained under the optimal conditions were used to
characterize the aroma of these vinegars by means of GCO and aroma extract dilution analysis
(AEDA).Amongthe37differentodorantsdetermined,13ofthemwereidentifiedforthefirsttime
in Sherry vinegars: 2 pyrazines (3isopropyl2methoxypyrazine, 3isobutyl2methoxypyrazine), 2
sulphur compounds (methanethiol, dimethyltrisulphide), 1 insaturated ketone (1octen3one), 1
norisoprenoid (damascenone), 1 ester (ethyl transcinnamate) and 6 aldehydes (2 and 3
methylbutanal,octanal,nonanal,(E)2nonenaland(E,E)2,4decadienal).Thedeterminationofthe
odourthresholdsinahydroaceticsolutiontogetherwiththequantitativeanalysiswhichwasalso
performed using the simple and fast SPME technique allowed obtaining the odour activity values
(OAV) of the aromatic compounds found. Thus, a first pattern of their sensory importance on
commercialSherryvinegararomawasprovided.

KEYWORDS: Sherry vinegar; key odorants; odour activity values; headspace solidphase
microextraction;gaschromatographyolfactometry


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
166 JournalofAgriculturalandFoodChemistry(2011)

1.INTRODUCTION

Mankindhaveproducedvinegarssincetheearlydaysofagricultureuntiltoday,allalongtheworld
anddifferentcultures,andtheyhaveemployedthemasfoodingredientsandpreservatives,flavour
enhancers and also, as ordinary remedies against illness (1). Vinegars are the result of a twostep
fermentationprocessoveralmostanyfermentablecarbohydratesource(fruits,honey,cereals,etc.).
Firstly,duringalcoholicfermentation,yeaststransformsugarsintoethanolwhichisthenconverted
intoaceticacidduringthesecondfermentationbyaceticacidbacteria.

One of the most commonly used vinegars in the Mediterranean basin and central Europe is wine
vinegar,agrapederivedproductwhichcanbeproducedbytwodifferentmethods:aquickprocess
involvingasubmergedcultureofaceticacidbacteriaandaslow,surfacecultureone(2).Thefirst
method,wheretherapidfermentationisforcedthankstoacontinuousoxygenation,providesmost
commercialvinegars,whilethesecondprocess,thatrequiresseveralmonthstoreachtheoptimum
aceticaciddegree,producestraditionalandhighqualityvinegars.

VinagredeJerezorSherryvinegarwithProtectedDenominationofOrigin(P.D.O.)(3)isoneofthose
traditionalandselectedvinegars,highlyappreciatedingastronomyduetoitsuniquechemicaland
organolepticproperties.Itsfermentationprocesstakesplaceinwoodbarrelsand,astheaceticacid
bacteria grow on the airliquid interface, the oxygen availability is limited what slows down the
wholeprocess.Moreover,thecriaderasysolerasproductionsystemfollowed(4),whichconsists
on a dynamic ageing, allows acetification and ageing to occur simultaneously, so the product
obtainedpresentsaveryspecialchemicalcompositionandagreatsensorycomplexity.

Winevinegarsaremainlyemployedduetotheirorganolepticpropertiesand,amongthem,flavour
plays a relevant role as it is closely related to quality. Indeed, it is one of the first attributes
perceived by consumers and it will have a great influence on the acceptance or rejection of the
product. Wine vinegar aroma, as the characteristic aroma of any food commodity, is due to
numerous volatile and heterogeneous chemicals at very different concentrations, ranging from
several mg L1 to a few ng L1 (5). These volatile compounds have been studied and reported by
different authors (6, 7), including a first attempt to analyze volatile components in Andalusian
vinegars (8). But it has not been since the last decade that Sherry vinegar volatiles have been
thoroughlyanalyzed(913).

However, although all the odorants must be volatile to reach the nostrils and interact with the
appropriatereceptorslocatedontheolfactoryepithelium(14),notallthevolatilesareodouractive.
To determine these compounds among the whole volatile fraction of complex mixtures such as
foods,gaschromatographyolfactometry(GCO)isthemostappropriateanalyticaltool,asitprovides

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 167

instrumentalandsensoryanalysissimultaneously(15,16).ThankstoGCO,theelutedanalytesare
perceived at the same time by the human nose and a conventional detector, like the Flame Ionic
Detector(FID)ortheMassSpectraDetector(MSD),whichturnsthistechniqueintoapowerfulone
infoodaromacharacterization.

This technique is the one used by the few researchers that have focused their attention on the
compoundsthatreallycontributetowinevinegararoma.Thus,Charlesetal.(17)carriedoutafirst
determinationoftheodouractivecompoundsintworedwinevinegarsbyGCObasedondetection
frequency.Someyearslater,Callejnetal.usedtheGCOtechniquetoscreentargetingcompounds
with an impact on the perceived quality of Sherry vinegars (18) and to identify substances
responsible for aromatic notes associated with some selected descriptors of the Sherry vinegar
aroma (19). All these studies reported an important number of aromatic components that, in all
cases, had been isolated by liquidliquid (LL) extraction with dichloromethane. However, in the
studiesrelatedtoSherryvinegar,theauthorsdidnotemploythataromaticextractobtainedwithLL
extractiontoperformthequantificationofthearomaticcompounds.Toachievethispurpose,they
usedthreedifferenttechniquestoextractandconcentratethearomaticcompoundswhichmakes
theproposedprocedureverylaborious,timeconsuming,andquitetedious.

Among all the sampling techniques, the headspace solidphase microextraction (HSSPME) has
showntobefastandsimplebecauseitallowsextractingandconcentratingthevolatilesinasingle
stepwithaverylittlesamplehandling(20).Moreover,ithasalsodemonstratedtobereliableonthe
analysisoffoodaromacompounds(21)aswellasonthecharacterizationofthearomaofdifferent
commoditieswhenapplyinganapproachtoAEDAdevelopedinourlaboratory(22,23).

Therefore,theaimofthisstudywastocharacterizethecommercialSherryvinegararomabyGCO
and HSSPME, with a previous optimization of the HSSPME conditions to get a representative
extract.TheapproachtotheAEDAappliedallowedustoobtainafirsthierarchicalclassificationof
themostpotentodorantspresentinthesamplesconsidered.Finally,toconfirmthecontributionof
themostimportantodorantsidentified,alsotheirodouractivityvalues(OAV)werecalculated.

2.MATERIALSANDMETHODS

2.1.Samples

Eight commercial Sherry vinegars labelled as P.D.O. Vinagre de Jerez were purchased in a
specializedlocalshop.Accordingtothecurrentlegislation(3),allofthempresentedasixmonths
ageing in wood barrels, and their acetic degree and pH value were 7% (w/v) and approx. 2.90,

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
168 JournalofAgriculturalandFoodChemistry(2011)

respectively. Their sensory evaluation showed a similar aromatic profile but some of them
presentedahighercomplexity so,wedecidetochoosethethreeoneswiththegreatestaromatic
richness.ThisgreaterrichnesswascorroboratedwiththehighestGCOresponse(bothinnumberof
odorantsandintensityoftheodoursperceived).

2.2.Reagentsandchemicals

The chemical standards of the aroma compounds were supplied by SigmaAldrich (Madrid, Spain)
andLancaster(Bischheim,France).TheirCASnumbersarespecifiedinTable1andtheirpuritywas
above 90% in all cases. 4methyl2pentanol (Fluka, Madrid, Spain) was employed as internal
standardandpurewaterwasobtainedfromaMilliQpurificationsystem(Millipore,Bedford,USA).
Acetic acid (HPLC grade), NaOH and NaCl (both reagent grade) were purchased from Scharlab
(Barcelona,Spain).

Topreparethestockstandardsolutions(employedbothfortheodourthresholddeterminationand
thecalibrationgraphselaboration)andtodilutethesamplesontheAEDAstudy,weusedanacetic
acid water solution at 7% (w/v) with pH adjusted to 2.9 in order to get a similar matrix to real
samples. To avoid odour interferences, this hydroacetic solution was filtered employing an
EmporeTM extraction disk with activated carbon (3M Bioanalytical Technologies, Minnesota, USA).
ThecleanedhydroaceticsolutionwasanalyzedbyHSSPMEandGCOandtheabsenceofodoursin
thisanalysiscorroboratedtheeffectivenessofthiscleaningprocedure.

Thedifferentstockstandardsolutionswerestoredat4C.

2.3.SPME

The SPME holder for manual sampling and the polydimethylsiloxane (PDMS) 100 m, Carboxen
Polydimethylsiloxane (Carboxen/PDMS) 75 m and StableFlex DivinylbenzeneCarboxen
Polydimethylsiloxane (DVB/CAR/PDMS) 50/30 m fibres used in this study were purchased from
Supelco (Bellefonte, USA). All the fibres were conditioned before use and thermally cleaned
betweenanalysesbyinsertingthemintotheGCinjectionportatthetemperaturerecommendedby
theproducer.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 169

2.4.Headspacesolidphasemicroextraction(HSSPME)

Theoptimumconditionsthatallowedextractingthehighestnumberandintensityofodorantswere
achievedbyplacing10mLofsampleintoa20mLglassvialwith3.5gofNaClandalittlemagnetic
stir bar (as the extraction was carried out under constant magnetic stirring), being the
sample/headspace ratio 1:1. After tightly capping the vial with a silicon septum under nitrogen
atmosphere, it was preequilibrated for 15 min at 50 C in a thermostatic bath. Then, the SPME
devicewasmanuallypushedthroughthevialseptumandthefibrewasexposedtotheheadspace
vialfor2hoursat50C.Afterwards,thefibrewaspulledintotheneedleassemblyandtheSPME
devicewasremovedfromthevial.Finally,itwasinsertedintotheinjectionportoftheGCFIDfor
thermaldesorptionoftheanalytesat270Cfor1mininthesplitlessmode.

2.5.Gaschromatographyanalysis

2.5.1.GCFIDandGCO

Samples were analyzed on a HewlettPackard (HP, Palo Alto, USA) 6890 gas chromatograph
equipped with a flame ionization detector (FID) and an olfactory detector. To carry out the
chromatographic separations, a Chrompack (Varian, Middelburg, The Netherlands) CPWAX 57CB
(50mx0.25mmi.d.,0.2mfilmthickness)fusedsilicacapillarycolumnwasemployedandtheoven
temperaturewasprogrammedasfollows:40C(2min),5Cmin1to220C(22min).Toverifythe
identityofthecompounds,anHP5(AgilentTechnologies,USA)(30mx0.32mmi.d.,0.25mfilm
thickness) fused silica capillary column was used with the following oven temperatures: 40 C (5
1 1
min),3.5Cmin to120C,10Cmin to210C(10min).Inbothcases,heliumwasthecarriergas
ataconstantflowrateof1mLmin1,thesplitsplitlessinjectionportoperatedinthesplitlessmode
at270Cfor1minandthetemperatureoftheFIDwassetat250C.

GCO analyses were carried out using an olfactory detector commercialized by SGE International
(Ringwood, Australia) that presented an outlet splitter system (ODOI) which provided a
continuouslyvariablerangeofsplitratiosthankstoamicrocontrolvalve(OSS2).Thechosensplit
ratiofortheolfactometricanalysiswas1:10(FID:sniffingport).Twodeactivatedanduncoatedfused
silicacapillariesofthesamelengthandwidthwereusedastransferlinesbetweenthevalveandthe
detectors.Inaddition,theolfactorydetectorcontrolmoduleincorporatedaheatedtransfersection
from the GC oven to the glass detection cone, what kept the unit at a suitable temperature to
transfer the volatiles to the detection cone without losses due to condensation. Furthermore, the


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
170 JournalofAgriculturalandFoodChemistry(2011)

glass cone is purged with humidified air to prevent nasal mucous membranes from drying out in
ordertomaintainolfactorysensitivity.

Timingandodourdescriptionswererecordedbytwotrainedsniffers(replacedat15minintervalsto
avoidfatigue)aftereachsampleinjection.Eachtrainedresearcheranalyzedeachextractintriplicate
andthreedifferentfibreswereemployedtotakeintoaccounttheefficiencyvariabilityoftheSPME
StableFlexfibres.

2.5.2.GCMS

A HewlettPackard (HP, Palo Alto, USA) 6890 gas chromatograph coupled to an HP5973 mass
selectivedetector(MSD)wasusedtoperformtheGCMSanalyses.Themassspectrometeroperated
intheelectronimpactionizationmode(70eV)andthemassrangewasfrom35to300amu,while
interface, source and quadrupole temperatures were 200 C, 230 C and 150 C, respectively.
Separationwasachievedunderthesameoperatingconditionsmentionbeforeandusingthesame
columnsasintheGCFIDandGCOanalyses.Thesplitsplitlessinjectionportoperatedinthesplitless
modeat270Cfor1min.

2.6.AromaExtractDilutionAnalysis(AEDA)

TheAromaExtractDilutionAnalysis(AEDA)involvesstepwisedilutionofthearomaticextractwitha
solvent followed by an evaluation of each dilution by GCO, what leads to a hierarchically
classification of the most odouractive compounds based on the flavour dilution (FD) factors.
However, the usual AEDA cannot be used when dealing with the SPME technique because no
physicalextractisobtained.Astheanalytesareretainedonthefibreanditisnotpossibletodilute
them, an approach to the AEDA developed in our laboratory (22) was applied. It consists of
successively dilutions (1:4) of the Sherry vinegar samples with a hydroacetic solution before
performing the SPME. Dilutions were carried out until no odorant was detected by sniffing the
highest dilution. Two experienced sniffers performed the AEDA experiments in triplicate and their
responsetotheindividualcompoundsdidnotdifferbymorethan2FDfactors.

2.7.Compoundsidentification

Theodorantsperceivedintheolfactometricstudywereidentifiedbycomparisonwiththereference
compounds(analyzedunderidenticalconditions)onthebasisofthefollowingcriteria:odourquality
detected at the sniffing port, mass spectra obtained and retention indices (RI) determined on the


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 171

two stationary phases of different polarity employed (CPWAX 57CB and HP5). Retention indices
were calculated from the retention times of a series of nalkanes (from 6 to 26 carbon atoms)
injectedunderthesamechromatographicconditions.

2.8.Sensoryanalysis

12trainednonsmokerindividuals(8womenand4men,between25and42yearsold)constituted
thetestpanelthatperformedthesensoryexperiments,allofthembelongingtotheDepartmentof
AnalyticalChemistryoftheRoviraiVirgiliUniversityandwithprevioussensoryanalysisexperience.
Togetusedtotestingaceticacidmatrices,theyweresubjectedtoaspecifictraining:differentsingle
standardsolutions,andalsomixturesofthem,werepreparedina7%(w/v)hydroaceticsolutionat
variousconcentrationlevels.Thepanellistswereaskedtodescribetheodourdetectedandtorate
the intensity perceived in a scale from 0 to 5 for each standard (i.e. each odour quality) and
concentration, which was also used to evaluate the panel response. The training was carried out
twice a week during five consecutively weeks, lasting each session 60 minutes. The coefficients of
variance of each single panellist for every sample replicates were less than 10%. To evaluate the
panelperformanceasawhole,onewayanalysisofvariance(ANOVA)wascarriedout.

2.9.Thresholdsdetermination

Thresholdvaluesweredeterminedbythethreealternativeforcedchoice(3AFC)test(24,25),that
consistsinthreesamples,twocontrolsandonespikedsampleamongwhichassessorsareinstructed
toguess(forcedchoice)whentheycannotperceiveadifference.

Firstly,thethresholdvaluesofthedifferentodorantswerelookedupintheliterature(26),although
mostofthemhadnotbeencalculatedinavinegarmatrix.Evenso,thesethresholdswerechosenas
theodorantsconcentrations(xvalues)todelimitafirstconcentrationworkingrange.Then,five2
folddilutions(x/8;x/2;x;2xand8x)werepreparedina7%(w/v)aceticacidwatersolutionforeach
substancewhosethresholdwastobedetermined,andthefive3AFCsweregiventothepanellists
in ascending order (most diluted first). For each level, all the solutions were labelled with a
randomizedthreedigitnumberandtheappearanceorderforthespikedsamplewasalsorandom.

Moredilutedorconcentratedsolutionswerepreparedwhennecessaryforeachpanellistso,finally,
itwaspossibletorelateeachassessortotwoconcentrationvaluesforeachodorant:thelowestwas
theonewheretheodourwasnotstillperceivedandthehighest,wheretheodourwasdetectedfor


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
172 JournalofAgriculturalandFoodChemistry(2011)

thefirsttime.Individualthresholdswerecalculatedbythebestestimatecriterion:thethresholdfor
each individual was the geometric mean between the last concentration missed and the first
concentrationdetectedforallthesensorysessions.Thefinalthresholdwasthegeometricmeanof
eachpanellistbestestimatesforeachcompound(24,25).

3.RESULTSANDDICUSSION

3.1.OptimizationofHSSPMEparameters

The chromatographic areas of the extracted compounds (FID response) not always present a
correlationwiththesensoryperception,soitisnotenoughtoconsiderthisfactwhenoptimizingthe
parameters that affect the aroma extraction efficiency. Therefore, we decided to evaluate the
numberandintensityoftheodorantsperceived(GCOresponse)aswell.Alltheexperimentswere
performedintriplicateandweusedmorethanoneSPMEfibretotakeintoaccounttheirvariability
response,althoughthereproducibilityofthefibreshasconsiderablybeenimprovedduringthelast
years.

The first parameter considered was the SPME fibre coating chosen. The coatings checked were
those that, according to their specifications, were the most appropriate to extract aroma
compounds: CAR/PDMS (low molecular weight compounds), PDMS (volatiles) and DVB/CAR/PDMS
(volatilesandsemivolatiles).Theresultsobtained,whenextractingthesamevinegarwithdifferent
fibres,showedthattheDVB/CAR/PDMSfibrespresentedhigherextractionefficiency.Thus,whereas
withPDMSthenumberofodouractiveregionswasbetween3540andforCARPDMSwasbetween
5560, when using DVB/CAR/PDMS, up to 79 odorant regions were detected, so this last fibre
coatingwasselected.

The extraction efficiency is greatly affected by the headspace volume (27), so the next parameter
studiedwasthesample/headspaceratio.Experimentswith20and50mLvialsanddifferentsample
volumes (5, 10 and 25 mL) were carried out. The results showed that the extraction efficiency
improved as the headspace decreased, being 1/1the optimum sample/headspace ratio, whatever
thevialconsidered.However,andinordertousetheminimumamountofsampleineachanalysis,it
wasdecidedtoworkwith10mLofsampleina20mLvial.Relatedtoionicstrength,thehigherit
wasthebetterresponseobtained,sosamplesweresaturatedbyadding3.5gofNaCl.

In SPME, extraction time and temperature are deeply related, so both parameters were studied
simultaneously.Thus,differentexperimentsintherangefrom2to4hours(timesunder2hoursdid
notensurethesuitablearomaticperceptionofalltheodorants)andfrom30to50Cwerecarried

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 173

out.Theexperimentsshowedthattheshortestsamplingtimeandthelowesttemperature(2h,30
C) provided the poorest chromatographic and olfactometric profiles. Meanwhile,the largesttime
andthehighesttemperature(4h,50C)didnotimprovetheoverallextractionefficiencybecauseof
the exothermic character of the SPME technique. Therefore, as the chromatographic and
ofactometricresponsesobtainedat2hand50Cdidnotsignificantlydiffer(lessthan5%)fromthe
onesobtainedat3hand40C,wedecidedtoreducethesamplepreparationstepbyemployingthe
shortestextractiontime(2h,50C).

Asaresult,theoptimumHSSPMEconditionswereachievedbyplacing10mLofsampleintoa20
mL glass vial with 3.5 g of NaCl and a little magnetic stir bar. Extraction was performed during 2
hoursat50Cunderconstantmagneticstirring.

Regarding the precision of the method, it was assessed in terms of withinday repeatability and
betweendays repeatability (intermediate precision). Although both precision parameters were
sensory evaluated in the sniffing port, it was difficult to quantify them. Therefore, to obtain an
objective evaluation we used the chromatographic response of the aromatic compounds and we
expressed both parameters by means of the percentage of relative standard deviation (%RSD) of
that response. Thus, while the repeatability was calculated by the consecutive injection of 5
different extracts obtained the same day, the intermediate precision was calculated after the
injection of 6 different extracts obtained over a month. In both cases the results were very good
sinceweobtainedRSD<4.7%forrepeatabilityandRSD<7.3%forintermediateprecision.

3.2.Extractrepresentativeness

Althoughthebestconditionsabovespecifiedallowedobtainingthehighestnumberandintensityof
odorants,itshouldnotbeforgottenthatthearomarepresentativenessofthesampleextractisthe
most important parameter to ensure the reliability of the results when characterizing that sample
aroma. Therefore, 12 trained assessors evaluated the similarity between the aroma of the three
Sherry vinegars considered and the aroma extracted by the HSSPME technique. To evaluate the
global perception of the compounds retained on the SPME fibre, the direct gas chromatography
olfactometry technique (DGCO) (23, 28) was employed. This technique avoids chromatographic
separationoftheextractconstituents,sotheanalystperceivestheextractasawholeatthesniffing
port.Whenaskingthepanellistsaboutthedegreeofsimilitudebetweentheextractsandthereal
sample,theyfoundan85%(5%RSD)oflikenesswhatevertheSherryvinegarevaluated.Therefore,
thisgreatsimilitudeindicatedthattheSPMEisagoodandfasttechniquetoobtainrepresentative
aromaextractsofsamplessocomplexsuchasvinegars.

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
174 JournalofAgriculturalandFoodChemistry(2011)

3.3.HSSPMEGCO

ThearomaofthethreeSherryvinegarsconsideredinthisstudywereextractedandconcentratedby
HSSPMEandanalyzedbyGCO.Theresultsshowedslightdifferencesinthenumberofodouractive
regions detected: while 70 aromatic areas were recorded for the A sample, 65 and 79 were
perceived for the B and C samples, respectively. Furthermore, most of the odouractive regions
coincidedinthethreesamplesbothintheirretentiontimesandthedescriptorsusedtodescribethe
odoursdetected.Inallcases,andashappenswhenapolarcolumnisemployedtocarryoutsimilar
flavour studies (18, 22, 23), chemical and fruity odours appeared at lower retention indices. Then
earthy and green notes were detected, followed by lactic and fatty ones. Afterwards, sweety and
flowery odours appeared and finally, at the end of the GCO analysis, smoky and disgusting notes
wereperceived.

Toevaluatethesensorycontributionofeachodoranttothewholesamplearomaandtogetafirst
hierarchicalclassificationoftheodorantsincommercialSherryvinegar,thevolatilesextractedwith
theHSSPMEtechniquewereanalyzedbyusingtheapproachtotheAEDApreviouslydevelopedin
our laboratory (22). This approach has demonstrated to be a valuable screening tool for ranking
odouractivecompoundsinasampleaccordingtotheirrelativeodourpotency(22,23).Itinvolves
stepwise dilution of the sample (therefore, of its aroma) followed by SPME and the subsequent
evaluation of each dilution by GCO until no odours are perceived in the GCO effluent. As defined
when using the classical AEDA (29, 30), the last dilution step where an odorant is perceived is its
flavour dilution (FD) factor that can be regarded as a good indicator of the odour potency of that
compound.

The odouractive regions with higher FD factors (ranging from 64 to 8192 for at least one of the
threesamples)arereportedinTable1,wheretheyhavebeenarrangedaccordingtotheirretention
indicesinthepolarcolumn.Ascanbeseen,amongthedifferentodouractiveregionsonly2ofthem
were not detected for the A sample (regions number 37 and 46, which were not identified), 3 of
themwerenotperceivedfortheBsample(areasnumber9identifiedasisobutanol,number25
unknownandnumber41identifiedasheptanoicacid)andonlytheflavouractiveregionnumber
39(benzylalcohol)wasnotdetectedintheCsample.Fromtheseresults,andasusualwhendealing
withdifferentsamplesofthesameproduct,wecouldconcludethattheodorantsresponsibleforthe
Sherryvinegararomaarealmostthesamewhateverthesampleconsideredandthatthedifferences
among samples are given by the perception intensity of some of these odorants (i.e. different
flavourdilution(FD)factors).Infact,only5odouractiveregionsweredetectedwiththesameFDin
all the samples: 4 regions with a FD of 4096, described as strawberry, earthy, fatty, blue


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 175

cheese,sweat,andsweet,honey,whichcorrespondedtoregionsnumber3,20,29and44,and1
withaFDof1024thatwasdescribedaspaperlike(region26).

As shown in Table 1, some of the identified odorants had been previously reported in Sherry
vinegarseitherasvolatile(7,8,10,12,13)oraromatic (18,19)compounds,but13ofthemwere
detected in Sherry vinegar aroma for the first time. These are the ones summarized in Table 2,
whose odour thresholds in an acetic acid water solution were also determined: 2 pyrazines (3
isopropyl2methoxypyrazine, and 3isobutyl2methoxypyrazine), 2 sulphur compounds
(methanethiol and dimethyltrisulphide), 1 insaturated ketone (1octen3one), 1 norisoprenoid (
damascenone), 1 ester (ethyl transcinnamate) and 6 aldehydes (2 and 3methylbutanal, octanal,
nonanal,(E)2nonenaland(E,E)2,4decadienal).

sensory FDfactor
threshold
odorant (ngL1) A B C
3isopropyl2methoxypyrazine 10 4096 8192 4096
3isobutyl2methoxypyrazine 22 1024 1024 4096
Dimethyltrisulphide 35 4096 64 64
Methanethiol 160 1024 1024 64
damascenone 190 1024 4096 1024
(E,E)2,4decadienal 435.6 1024 4096 1024
Ethyltranscinnamate 480 4096 4096 4096
(E)2nonenal 1500 1024 1024 1024
1octen3one 6800 4096 4096 1024
Nonanal 18200 16 256 1024
Octanal 22500 4096 1024 1024
3methylbutanal 31600 4096 16 16
2methylbutanal 84300 4096 16 16

Table2.SensorythresholdsoftheodorantsfoundinSherryvinegarforthefirsttime

Thepresenceof3alkyl2methoxypyrazinescouldbeduetotheirnaturaloriginingrapes(31)and,
although they are characteristic of some varieties such as Cabernet sauvignon, Merlot noir and
Sauvignonblanc(32),theyhavealsobeenidentifiedinsomeagedredwines(33).Regardingsulphur
compounds,theyaremostlyreleasedduringalcoholicfermentationbythedegradationofodourless
precursors,suchasScysteineconjugates.However,theoriginofthesecompoundsinwinesisstill
being investigated and alternative biogenetic pathways involving conjugated carbonyl compounds,
ortheSglutathioneconjugate,haveeitherbeenhypothesisedorevidenced(34,35).Relatedto1
octen3one,itisacommonconstituentofthegaschromatographicodour(GCO)profileofnormal
dry wines and it is a naturally occurring compound in grapes (36). On the other hand,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
176 JournalofAgriculturalandFoodChemistry(2011)

damascenone has its source in grape carotenoid degradation (37), ethyl transcinnamate comes
from the alcoholic fermentation in wines (38), 3methylbutanal can be considered an aminoacid
derivative(39)and(E)2nonenalisaproductoftheoxidativedegradationofunsaturatedfattyacid
(40). Moreover, the formation of aldehydes in vinegars, as occurred in wine, could be related to
changesinaromapropertieslinkedtooxidation(41)anditisalsoknownthatthealdehydeswith8
10carbonatomscanbeconsideredstrongodorantsbecauseoftheirsensoryproperties(42,43).

Table2alsoshowstheFDfactorsoftheseodorantsforeachsampleandtheirsensorythresholds,
whatinsomecasesareatngL1levels.BecauseoftheirhighFDvalues,itcouldbethoughtthata
priori they could contribute significantly to the overall aroma of the sample, despite their low
concentrations.Indeed,theselowconcentrationsimplytheuseofaconcentrationtechniquesuch
SPMEtobedetected.Evenso,althoughwecouldperceiveallofthembyGCO,onlysomeofthem
weredetectedwhenapplyingaconventionaldetector.

However, although the FD factors provided a first hierarchical classification of the odorants
detected,itwasnecessarytouseotherparameterstogetmorepreciseinformationaboutthereal
contributionofeachodoranttotheoverallsamplearoma.

3.4.OdourActivityValue(OAV)

Odouractivityvalue(OAV)wasobtainedbydividingtheconcentrationofthecompoundinamatrix
byitsodourthresholdinthatmatrix(5).Althoughthisparameterprovidesaroughpatternofthe
sensory importance of the odorants, it allows turning the quantitative data into sensorial
information.SoitisgenerallyassumedthattheodorantswithhigherOAVscontributeinastronger
mannertotheoverallaroma.

Therefore,oncethemostpotentodorantsweredetermined,itwasnecessarytoquantifythemwith
theaimtocalculatetheirOAVs.Tomakeassimpleaspossiblethemethodologyusedtocarryout
the quantification, the extract employed for this purpose was the same that the one used to
perform the GCO analysis. Taking into account the matrix interference that hindered the use of
calibrationcurvesconstructedwithmodelsolutions,weelaboratedthecalibrationgraphsbyusing
the addition standard method and extracting the spiked samples under the same HSSPME
extractionconditionsabovespecified(section2.4).Thus,themostpotentodouractivecompounds
accordingtotheAEDAresultswerequantified,exceptthosewithsoextremelylowconcentrations
thatitwasnotpossibletoobtainanyinstrumentalsignalwhenusingaFIDoraMSD.Thisiswhat


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 177

happened with 3alkyl2methoxypyrazines, 1octen3one or the sulphur compounds, among


others.Table3summarizesthemeanconcentrationsoftheodorantsquantified.

meanconcentrationsd(gL1)
compound A B C
Ethylisobutyrate 462.98.5 303.112.7 391.917.6
Diacetyl 117.54.9 60.813.8 177.716.7
Ethylbutyrate 16.30.7 23.13.7 17.22.1
Ethyl2methylbutyrate 10.00.7 26.50.4 7.20.2
Ethylisovalerate 277.57.2 301.61.7 299.52.5
Isobutanol 1752.455.4 nd 2042.927.6
Isoamylacetate 1071.77.9 840.262.67 1315.624.6
2methyl1butanol 2949.133.0 3086.669.1 2774.914.2
Isoamylalcohol 3674.935.5 3812.117.5 3306.012.2
Octanal 14.10.9 10.81.8 11.71.1
Isobutyricacid 2460.519.1 1801.969.6 3622.0111.7
2methylbutyricacid 2301.0107.6 1989.381.9 2523.0181.4
Isovalericacid 6643.0226.9 6110.1325.0 5830.8120.7
Benzylacetate 13.20.2 20.50.6 10.40.4
Ethylphenylacetate 988.32.6 117.20.4 385.51.7
2phenylethylacetate 462.316.0 388.421.0 240.921.0
damascenone 0.210.03 0.290.02 0.140.03
Phenylmethanol 120.212.7 63.46.6 nd
2phenylethanol 6514.2132.4 7993.1133.0 9511.3161.0
4ethylguaiacol 2971.487.5 664.41.8 1603.929.6
4ethylphenol 71.70.5 81.34.7 79.86.0
Decanoicacid 126.73.326 122.71.5 31.55.5

Table3.MeanconcentrationsofthepotentodorantsfoundinSherryvinegars

Inaddition,wedeterminedthesensorythresholdsofthemostpotentodorantsidentifiedbymeans
ofGCOandAEDA.Inordertodeterminethesevaluesinamatrixassimilaraspossibletothereal
one, an acetic acid water solution was employed. The values obtained can be seen in Table 4
togetherwiththeOAVscalculatedforeachquantifiedcompoundineverySherryvinegarsample.

Whencomparingthesevalueswiththoseobtainedbyotherauthorsthatpreviouslyidentifiedsome
of these compounds in Sherry vinegar aroma, we could check that the relative OAVs for ethyl
isovalerate,ethylisobutyrate,isoamylacetate,isovalericacidor2phenylethylacetateagreedwith
the ones reported by Callejn et al. (19). However, there was no coincidence when comparing 4


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
178 JournalofAgriculturalandFoodChemistry(2011)

ethylphenol and diacetyl, as these authors obtained higher OAVs. In fact, diacetyl presented the
highest OAV in their study. But these differences could be attributed to the different extraction
procedures employed and also to the lower odour threshold reported by Callejn et al. for both
compounds: 4 g L1 vs 51 g L1 regarding 4 ethylphenol, and 40 g L1 vs 95.3 g L1 regarding
diacetyl.

OdourActivityValues(OAV)
sensorythreshold
odorant (gL1) A B C
Ethylisovalerate 2.2 126 137 136
Ethylisobutyrate 5.2 89 58 75
Isoamylacetate 22.2 48 38 59
Isovalericacid 144.4 46 42 40
4ethylguaiacol 69.5 43 9.6 23
2methylbutyricacid 200.5 11 9.9 12
2phenylethanol 1400 4.6 5.7 6.8
2phenylethylacetate 97.8 4.7 4.0 2.5
Isobutyricacid 1500 1.6 1.2 2.4
4ethylphenol 51 1.4 1.6 1.6
Ethylphenylacetate 148.2 6.7 0.79 2.6
Diacetyl 95.3 1.2 0.64 1.9
damascenone 190a 1.1 1.5 0.74
Isoamylalcohol 3500 1.0 1.1 0.94
Ethyl2methylbutyrate 16.5 0.61 1.6 0.44
Octanal 22.5 0.63 0.48 0.52
Ethylbutyrate 73 0.22 0.32 0.24
2methyl1butanol 12200 0.24 0.25 0.23
Isobutanol 7500 0.23 nd 0.27
Decanoicacid 1100 0.11 0.11 29103
3 3
Phenylmethanol 5100 2310 1210 nd
Benzylacetate 2300 5.7103 8.9103 4.5103
a
ConcentrationinngL1

Table4.OdourthresholdsandOdourActivityValues(OAV)calculatedforthequantifiedodorants

Finally,focusingagainontheresultsshowedinTable4,thereare10compoundswithOAVs>1in
the three vinegars analyzed. These compounds, together with their FD values, are displayed in a
spiderweb (Figure 1). As it can be seen from this figure, the profile obtained is quite similar
whatever the sample considered, except for isobutyric acid, 4ethylguaiacol and, in less extent, 2
phenylethanol.Tochecktherealcontributionofthese10compoundstotheSherryvinegararoma,a
verysimplesimilaritytestwasperformed:weaddedallthesecompoundstoa7%(w/v)hydroacetic
solutionatthesameconcentrationtothattheywerefoundineachvinegar.Then,panellistswere


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 179

asked to evaluate the similarity between the spiked solution and the real vinegars. The results
showed a degree of similarity of 49, 46 and 51% (RSD 5%) for vinegars A, B and C, respectively.
According to the panellistsdescription, this relative low percentage was related to a much higher
perceptionofthepungentsensationinthespikedsamplemainlyduetotheaceticacid.Therefore,
we performed a second similarity test, but this time adding all the compounds quantified. In this
case,panellistsagreedwiththefactthatthepungentsensationwasbalancedthankstothehigher
aromatic richness of the spiked solution, and, when rating the degree of similarity, they gave a
punctuationof67,63and70%(RSD6%)forvinegarsA,BandC,respectively.So,theseresultsagree
withtheonesobtainedintheGColfactometricstudybecause,asitcanbeseen,themostimportant
aromaticcompounds,thosethatplaythemostrelevantroleinSherryvinegararoma,arealmostthe
same whatever the sample considered. Only slight differences are perceived among samples
regarding the perception intensity of the odorants, which makes possible the characteristic
organolepticpropertiesofeverySherryvinegarsample.

ethylisovalerate
4096
4ethylphenol ethylisobutyrate
1024
256
2phenylethylacetate 64 isoamylacetate
16
4

isobutyricacid isovalericacid

4ethylguaiacol 2methylbutyricacid

2phenylethanol

SherryvinegarA SherryvinegarB SherryvinegarC


Figure1.SpiderwebfortheodorantswithOAVs1forthethreeSherryvinegarsamples

Fromtheresults,wecanconcludethattheHSSPMEtechniquewhenusingaDVB/CAR/PDMSfibre
is suitable for extracting and analyzing the odour compounds in vinegar matrices. Moreover, it
requires shorter sampling times and minimum sample handling compared with the conventional
extractionmethods(i.e.liquidliquidextraction).Asexplained,someofthekeyodorantsdetermined
inthisstudyhavebeenreportedasaromaticcompoundsinSherryvinegararomaforthefirsttime
andtheirodourthresholdshavebeendeterminedinahydroaceticsolution.Then,theapproachto
theAEDAappliedhasallowedustoestablishahierarchyonthecontributionofeachcompoundto


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
180 JournalofAgriculturalandFoodChemistry(2011)

Sherry vinegar aroma, which has been confirmed by the OAVs calculated. Nevertheless, to finally
give more accurate results about the real contribution of the different constituents to the overall
Sherryvinegararomaitwillbenecessarytoovercomethelimitationsoftheinstrumentaldetector
(e.g. by using aMS detector in SIM mode) to make possible the quantification of all the odorants
detectedbyGCOandtoperformcompletereconstitutionstudiesthatwillbethefutureaimofour
studies.

Acknowledgements
ThisstudywassupportedbytheSpanishMinistryofScienceandTechnology(projectAGL200761550).



Laura Acea Muoz

Table1.MainodorantsfoundinSherryvinegarwithFD64atleastinoneofthethreesamples

odour RIon FDfactor identification


active RT CP MSD Previouslyreported
regions (min) WAX HP5 odourdescription A B C odorant CASno. A B C RI odour inSherryvinegar
UNIVERSITAT ROVIRA I VIRGILI

1 4.9 a b cabbage,sewer 1024 1024 64 methanethiol 74931 a X


96173 X X X X X
2 6.5 890 a malty,bitteralmonds 4096 16 16 2/3methylbutanal
ISBN:9788469432341/DL:T. 1040-2011

590863 X X X X X
3 7.1 950 a strawberry 4096 4096 4096 ethylisobutyrate 97621 X X X X X 7,12,18,19
4 7.4 970 b butter 4096 1024 4096 diacetyl 431038 X X X X X 18,19
5 7.6 990 plastic,rubbery 1024 4096 256 unknown
6 8.4 1032 801 fruity,strawberry 64 256 64 ethylbutyrate 105544 X X X X X 7,12,18,19
7 8.7 1050 843 fruity,pineapple 1024 8192 1024 ethyl2methylbutyrate 7452791 X X X X X 12,18,19
8 9.1 1062 852 fruity,solvent 1024 8192 4096 ethylisovalerate 108645 X X X X X 7,18,19
9 9.9 1105 nd sulphury,disgusting 256 nd 4096 isobutanol 78831 X X X X 7,8,10,12,19
10 10.2 1119 881 banana,gluelike 4096 1024 4096 isoamylacetate 123922 X X X X X 7,8,10,12,18,19
11 11.7 1168 fruitysolvent,rancid 64 64 1024 unknown
12 12.8 1214 756 solvent,bitteralmonds 64 256 16 2methyl1butanol 137326 X X X X X 7,8,10,12,19
13 12.8 1219 710 solvent,bitteralmonds 64 256 16 isoamylalcohol 123513 X X X X X 7,8,10,12,13,18,19
14 14.6 1290 1001 citrus,fresh 4096 1024 1024 octanal 124130 X X X X X
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

15 14.9 1306 975 mushroom 4096 4096 1024 1octen3one 4312996 X X


16 16.9 1368 965 sulphurlike 4096 64 64 dimethyltrisulphide 3658808 X X X X X
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

17 17.5 1397 nd citrus,flowery 16 256 1024 nonanal 124196 X X X X X


18 17.6 1410 mushroomlike,earthy 256 4096 1024 unknown
19 18.3 1427 nd green,earth 4096 8192 4096 3isopropyl2methoxypyrazine 25773404 c c c X X
20 18.6 1445 earthy,fatty 4096 4096 4096 unknown
21 19.2 1459 907 cookedpotato 1024 256 1024 methional 3268493 c c c X X 18
22 19.8 1512 fresh,green 4096 1024 4096 unknown
23 20.3 1529 nd leaflike 64 64 256 unknown


Laura Acea Muoz

24 20.6 1532 1191 greenpepper 1024 1024 4096 3isobutyl2methoxypyrazine 24683009 X X


25 20.8 1538 aniselike,fresh 256 nd 256 unknown
26 20.9 1546 1160 paperlike 1024 1024 1024 (E)2nonenal 18829566 X X X
27 21.8 1590 1232 lactic,cheese 64 4 256 isobutyricacid 79312 X X X X X 7,12,13,18
UNIVERSITAT ROVIRA I VIRGILI

28 23.2 1644 nd cheese,vomit 1024 4096 4096 butyricacid 107926 X X X X X 7,12,13,18


2methylbutyricacid 116530 X X X X X 10
ISBN:9788469432341/DL:T. 1040-2011

29 23.7 1675 879 bluecheese,sweat 4096 4096 4096


isovalericacid 503742 X X X X X 7,12,13,18,19
30 24.9 1728 1324 deepfried 1024 4096 1024 (E,E)2,4decadienal 25152845 X X
31 25.2 1739 nd fresh,mintlike 1024 4096 1024 benzylacetate 140114 X X X X X 7,10,12,13,19
32 26 1770 sweet,flowery 256 64 4096 unknown
33 26.6 1817 1243 flowery,rose,sweet 256 16 256 ethylphenylacetate 101973 X X X X X 10,12,13,18,19
34 27 1839 geranium 4096 8192 4096 unknown
35 27.2 1845 1257 roses 4096 4096 1024 2phenylethylacetate 103457 X X X X X 7,10,12,13,18,19
36 27.4 1851 1383 sweet,peachjam 1024 4096 1024 damascenone 23726934 X X X X X
37 27.8 1870 flowery,sweet nd 4096 256 unknown
38 28.5 1899 1093 smoky,sweet 4096 4 1024 guaiacol 90051 X X X X 13,18,19
39 28.7 1915 1039 roses,sweety 4096 16 nd phenylmethanol 100516 X X X X X 7,10,12,13,18,19
40 29.6 1957 1119 roses 256 256 4096 2phenylethanol 60128 X X X X X 7,10,12,13,19
41 30.2 1986 nd disgusting,sour 4 nd 256 heptanoicacid 111148 X X 18
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

42 30.7 2022 roasted,burnt 1024 4096 1024 unknown


43 31.7 2089 1281 smoky,clove 4096 16 4096 4ethylguaiacol 2785899 X X X X X 10,12,13,18
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

44 33.4 2178 1466 sweet,honey 4096 4096 4096 ethyltranscinnamate 103366 X X


45 34.3 2217 1182 animal,stall 1024 4096 4096 4ethylphenol 123079 X X X X X 10,12,13,18,19
46 34.6 2245 animal nd 4096 1024 unknown
47 35.1 2320 1377 dusty,spicy 4096 4096 4 decanoicacid 334485 X X X X X 7,10,12,13,18,19
RT: RetentionTimeonaCPWAX57CB FD: FlavourDilution a:RInotcalculatedduetosolventinterference
RI: RetentionIndexondifferentstationaryphases nd: notdetected b:RI<RIofthefirstalkane(C6)
c: identificacionnotpossibleduetoaceticacidinterference

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 183

LITERATURECITED
(1)Mazza,S.;Murooka,Y.Vinegarsthroughtheages.InVinegarsoftheworld;Solieri,L.,Giudici,P.,
Eds.;Springer:Milan,Italy,2009;1739.
(2)Tesfaye,W.;Morales,M.L.;GarcaParrilla,M.C.;Troncoso,A.M.Improvementofwinevinegar
elaboration and quality analysis: instrumental and human sensory evaluation. Food Reviews Int.
2009,25,142156.
(3)Resolucinde24demarzode2009porlaqueseconcedelaproteccinnacionaltransitoriaala
DenominacindeOrigenProtegidaVinagredeJerez.BoletnOficialdelEstadode13deabrilde
2009;Nm.90,3460334613.
(4)Tesfaye,W.;Morales,M.L.;GarcaParrilla,M.C.;Troncoso,A.M.Jerezvinegar.InVinegarsof
theworld;Solieri,L.,Giudici,P.,Eds.;Springer:Milan,Italy,2009;179195.
(5) Belitz, H.D.; Grosch, W.; Schieberle, P. Aroma Compounds. In Food Chemistry, third revised
edition;Springer:Berlin,Germany,2004;342408.
(6) Cabezudo, M. D.; Gorostiza, E. F.; Herraiz, M.; FernndezBiarge, J. GarcaDomnguez, J. A.;
Molera, M. J. Mixed columns made to order in gas chromatography. IV. Isothermal selective
separationofalcoholicandaceticfermentationproducts.J.Chromatogr.Sci.1978,16,6167.
(7) Blanch, G. P.; Tabera, J.; Sanz, J.; Herraiz, M.; Reglero, G. Volatile composition of vinegars.
Simultaneous distillationextraction and gas chromatographymass spectrometric analysis. J. Agric.
FoodChem.1992,40,10461049.
(8) Troncoso, A. M.; Guzmn, M. Volatile components in Andalusian vinegars. Z. Lebensm. Unters.
Forsch.1987,185,130133.
(9) Morales, M. L.; Tesfaye, W.; GarcaParrilla, M. C.; Casas, J. A.; Troncoso, A. M. Sherry wine
vinegar:physicochemicalchangesduringtheacetificationprocess.J.Sci.FoodAgric.2001,81,611
619.
(10)NateraMarn,R.;CastroMejas,R.;GarcaMoreno,M.V.;GarcaRowe,F.;GarcaBarroso,C.
Headspacesolidphasemicroextractionanalysisofaromacompoundsinvinegar.Validationstudy.J.
Chromatogr.A2002,967,261267.
(11)Tesfaye,W.;GarcaParrilla,M.C.;Troncoso,A.M.SensoryevaluationofSherrywinevinegar.J.
SensoryStudies2002,17,133144.
(12) Durn Guerrero, E.; Natera Marn, R.; Castro Mejas, R.; Garca Barroso, C. Stir bar sorptive
extraction of volatile compounds in vinegar: validation study and comparison with solid phase
microextraction.J.Chromatogr.A2007,1167,1826.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
184 JournalofAgriculturalandFoodChemistry(2011)

(13) Chinnici, F.; Durn Guerrero, E.; Sonni, F.; Natali, N.; Natera Marn, R.; Riponi, C. Gas
chromatographymass spectrometry (GCMS) characterization of volatile compounds in quality
vinegarswithprotectedEuropeangeographicalindication.J.Agric.FoodChem.2009,57,47844792.
(14) Holley, A. Processing information about flavour. In Flavour in Food, first edition; Voilley, A.,
Etivant,P.,Eds.;WoodheadPublishingLimited:Cambridge,England,2006;3661.
(15) Mayol, A. R.; Acree, T. E. Advances in gas chromatographyolfactometry. In Gas
chromatographyolfactometry. The state of the art, first edition; Leland, J. V., Schieberle, P.,
Buettner,A.,Acree,T.E.,Eds.;ACSSymposiumSeries,WashingtonD.C.,Washington,2001;110.
(16)Zellner,B.A.;Dugo,P.;Dugo,G.;Mondello,L.Gaschromatographyolfactometryinfoodflavor
analysis.J.Chromatogr.A2008,1186,123143.
(17)Charles,M.;Martin,B.;Ginies,C.;Etivant,P.;Coste,G.;Guichard,E.Potentaromacompounds
oftworedwinevinegars.J.Agric.FoodChem.2000,48,7077.
(18) Callejn, R. M.; Morales, M. L.; Troncoso, A. M.; Silva Ferreira, A. C. Targeting key aromatic
substancesonthetypicalaromaofSherryvinegar.J.Agric.FoodChem.2008,56,66316639.
(19)Callejn,R.M.;Morales,M.L.;SilvaFerreira,A.C.;Troncoso,A.M.Definingthetypicalaroma
ofSherryvinegar:sensoryandchemicalapproach.J.Agric.FoodChem.2008,56,80868095.
(20)Arthur,C.L.;Pawliszyn,J.Solidphasemicroextractionwiththermaldesorptionusingfusedsilica
opticalfibers.Anal.Chem.1990,62,21452148.
(21) Wardencki, W.; Michulec, M.; Curylo, J. Areview of theoretical and practical aspects ofsolid
phasemicroextractioninfoodanalysis.Int.J.FoodSci.Technol.2004,39,703717.
(22) Mart, M. P.; Mestres, M.; Sala, C.; Busto, O.; Guasch, J. Solidphase microextraction and gas
chromatography olfactometry analysis of successively diluted samples. A new approach of the
aromaextractdilutionanalysisappliedtothecharacterizationofwinearoma.J.Agric.FoodChem.
2003,51,78617865.
(23) Acea, L.; Vera, L.; Guasch, J.; Busto, O.; Mestres, M. Comparative study of two extraction
techniques to obtain representative aroma extracts for being analysed by gas chromatography
olfactometry:applicationtoroastedpistachioaroma.J.Chromatogr.A2010,1217,77817787.
(24)AMSTStandardPracticeDesignationE67991.StandardPracticeforDeterminationofOdorand
Taste Thresholds by a ForcedChoice Ascending Concentration Series Method of Limits; ASTM
International:Philadelphia,PA.2004;3438,doi:10.1520/E067904.
(25) Plotto, A.; Margara, C. A.; Goodner, K. L.; Goodrich, R.; Baldwin, E. A. Odour and flavour
thresholds for key aroma components in an orange juice matrix: terpenes and aldehydes. Flavour
Fragr.J.2004,19,491498.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
CharacterizationofcommercialSherryvinegararoma 185

(26) Rychlik, M.; Schieberle, P.; Grosch, W. Compilation of odor thresholds, odor qualities and
retention indices of key food odorants. Deutsche Forschungsanstalt fr Lebensmittelchemie and
InstitutfrLebensmittelchemiederTechnischen.UniversittMnchen:Garching,Germany,1998.
(27)Pawliszyn,J.Solidphasemicroextraction:theoryandpractice;WileyVCHInc.:NewYork,New
York,1997.
(28) Rega,B.;Fournier,N.;Guichard,E.Solidphasemicroextraction (SPME)of orangejuiceflavor:
odorrepresentativenessbydirectgaschromatographyolfactometry(DGCO).J.Agric.FoodChem.
2003,51,70927099.
(29) Ullrich, F.; Grosch, W. Identification of the most intense volatile flavor compounds formed
duringautoxidationoflinoleicacid.Z.Lebensm.Unters.Forsch.1987,184,277282.
(30) Schieberle, P.; Grosch, W. Evaluation of the flavor of wheat and rye bread crusts by aroma
extractdilutionanalysis.Z.Lebensm.Unters.Forsch.1987,185,111113.
(31)Sala,C.;Mestres,M.;Mart,M.P.;Busto,O.;Guasch,J.Headspacesolidphasemicroextraction
method for determining 3alkyl2methoxypyrazines in musts by means of polydimethylsiloxane
divinylbenzenefibres.J.Chromatogr.A2000,880,9399.
(32)Sala,C.;Mestres,M.;Mart,M.P.;Busto,O.;Guasch,J.Headspacesolidphasemicroextraction
analysisof3alkyl2methoxypyrazinesinwines.J.Chromatogr.A2002,953,16.
(33)Culler,L.;Escudero,A.;Cacho,J.;Ferreira,V.Gaschromatographyolfactometryandchemical
quantitativestudyofthearomaofsixPremiumqualitySpanishagedredwines.J.Agric.FoodChem.
2004,52,16531660.
(34) Mestres, M.; Busto, O.; Guasch, J. Headspace solidphase microextraction analysis of volatile
sulphidesanddisulphidesinwinearoma.J.Chromatogr.A1998,808,211218.
(35) RodrguezBencomo, J. J.; Schneider, R.; Lepoutre, J. P.; Rigou, P. Improved method to
quantitatively determine powerful odorant volatile thiols in wine by headspace solidphase
microextractionafterderivatization.J.Chromatogr.A2009,1216,56405646.
(36) Culler, L.; Cacho, J.; Ferreira, V. Validation of an analytical method for the solid phase
extraction, in cartridge derivatization and subsequent gas chromatographicion trap tndem mass
spectrometricdeterminationof1octen3oneinwinesatngL1level.Anal.Chim.Acta2006,563,
5157.
(37) Strauss, C. R.; Wilson, B.; Anderson, R.; Williams, P. J. Development of precursors of C13 nor
isoprenoidflavorantsinrieslinggrapes.Am.J.Enol.Vitic.1987,38,2327.
(38)Sumby,K.M.;Grbin,P.R.;Jiranek,V.Microbialmodulationofaromaticestersinwine:current
knowledgeandfutureprospects.FoodChem.2010,121,116.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
186 JournalofAgriculturalandFoodChemistry(2011)

(39) Campo, E.; Cacho, J.; Ferreira, V. The chemical characterization of the aroma of dessert and
sparkling white wines (Pedro Ximnez, Fino, Sauternes, and Cava) by gas chromatography
olfactometryandchemicalquantitativeanalysis.J.Agric.FoodChem.2008,56,24772484.
(40)Vesely,P.;Lusk,L;Basarova,G;Seabrooks,J;RyderD.Analysisofaldehydesinbeerusingsolid
phase microextraction with onfiber derivatization and gas chromatography/mass spectrometry. J.
Agric.FoodChem.2003,51,69416944.
(41)Azzara,C.D.;Campbell,L.B.Offflavorsofdairyproducts.InOffflavorsinfoodsandbeverages
(developmentsinfoodscience);Charalambous,G.Ed.;ElsevierSciencePublishers:Amsterdam,The
Netherlands,1992;329374.
(42) van Gemert, L.J. (2000). Compilations of odour threshold values in air and water. Boelens
AromaChemicalInformationService.
(43)ComettoMuiz,J.E.;Abraham,M.H.Odordetectionbyhumansoflinealaliphaticaldehydes
andhelionalasgaugedbydoseresponsefunctions.Chem.Senses2010,35,289299.


UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 5
Los pistachos tostados
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 189

5.1.LOSFRUTOSSECOS

Aunque existen escasos vestigios de la dieta seguida por nuestros primeros


antepasados,sesabequeelhombresiemprehasidoomnvoro.Juntoconlashojas,
los brotes, las cortezas y las races, los homnidos consuman insectos y carroa, as
como distintos frutos [1]. Yacimientos prehistricos en Israel, con restos
arqueolgicos con ms de 780.000 aos de historia, aportan uno de los primeros
indiciosdelaexistenciadelosfrutossecosyaporentonces.Entrelosencontradoshay
especiesqueanseconsumenhoyenda,comoelpistachoolaalmendra[2,3].

Ademsdecontribuiraladieta,losfrutossecosestnestrechamentevinculados
a la cultura de las poblaciones que se han servido de ellos. De forma general, la
palabra nuez designa a todos los frutos con una semilla comestible, la almendra,
encerrada en una cubierta exterior dura. Las expresiones simblicas referidas a la
almendraconrespectoalacscaraseextiendenatodoslosfrutosquecontienenuna
semilla,ysignificanloesencialescondidoenloaccesorio[2].Igualmente,tambinhay
citasenelAntiguoTestamentodelaBibliaalasalmendras,lospistachosolasnueces
enlasquesesonconsideradosunsignodeesperanzaoalgovalioso.

5.1.1.Definicin

Los frutos secos son frutas con un bajo contenido en agua (menos del 50%) y
ricas en lpidos, protenas y oligoelementos, que consisten en un grano o semilla
comestibleencerradoenunacscaraquesevuelveduratraslamaduracin[4].

Ciertos frutos secos, como las castaas, las avellanas o las bellotas, tambin
puedendefinirsecomofrutasconunasolasemilladuraycomestibleycuyopericarpio
esduroeindehiscente[3].Porpericarpioseentiendelaparteexteriordelfrutodelas
plantas, lo que cubre las semillas, e indehiscente significa que no se abre
naturalmenteparaquesalgalasemillacuandoelfrutoestmaduro[5].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
190 Captulo5

Sinembargo,estadefinicinnoesvlidaparaelrestodefrutossecos,entrelos
queseencuentranlasalmendras,lasnueces,lospistachos,laspacanasolasnueces
demacadamia.Enrealidad,estosproductossonloshuesosdurosdedistintasdrupas
(frutosdemesocarpiocarnosoyendocarpioleosoconunasolasemilla)[3].Mientras
que de los melocotones, por ejemplo, comemos su parte fresca (mesocarpio) y
tiramosloshuesos(endocarpio),enelcasodeestosfrutossecos,loquedesechamos
sonlaspielecitasqueconstituyensumesocarpio,comindonossushuesos.

5.1.2.Tiposdefrutossecos

Los frutos secos ms populares y de mayor cultivo, junto a los rboles que los
producenylazonadelaquesonoriginarios,seespecificanenlaTabla5.1.

Frutoseco rbolproductor,nombrecientficoy(familia) Zonadeorigen


Almendro.PrunusamygdalusBatschSin./
Almendra PrunusdulcisD.A.Webb/Amygdaluscommunis CentrooestedeAsia
L.(Rosaceae)
Anacardo.AnacardiumoccidentaleL.
Anacardo AmricadelSur
(Anacardiaceae)
Avellana Avellano.CorylusavellanaL.(Corylaceae) AsiaMenor

Nuez Nogal.JuglansregiaL.(Juglandeceae) AsiaCentral


NogaldeBrasil.BertholletiaexcelsaHumb.et
NuezdeBrasil Cuencaamaznica
Bonpl.(Lecythidaceae)
Macadamia.MacadamiaintegrifoliaMaidenet
Nuezdemacadamia Betche/MacadamiatetraphillaL.A.S.Johnson Australia
(Proteaceae)
Pacana.Caryaillinoiensis(Wang.)K.Koch
Pacana CuencadelMisisipi
(Juglandaceae)
Pin Pinopionero.PinuspineaL.(Pinaceae) Cuencamediterrnea

Pistacho Pistachero.PistaciaveraL.(Anacardiaceae) CentrooestedeAsia

Tabla5.1.Nombreyprocedenciadelosfrutossecosmspopulares[6]

Las caractersticas fsicas, qumicas y nutritivas de todos estos frutos secos son
similares, al igual que los procesos de recoleccin, cosecha, procesado y


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 191

comercializacin. Sin embargo, los rboles que los producen s requieren diferentes
condicionesclimticas.Losalmendros,avellanos,nogales,pacanas,pinospionerosy
pistachosprecisanclimasmediterrneos,mientrasquelosanacardos,macadamiasy
nogales del Brasil necesitan climas ms clidos. El almendro, el pino pionero y el
pistachero destacan por su tolerancia a la sequa. En cambio, el anacardo, la
macadamia y el nogal de Brasil son propios de las zonas hmedas. Y mientras que
almendros, avellanos, macadamias, nogales, pacanas y pistacheros se cultivan en
plantaciones, los pinos pioneros y los nogales de Brasil lo hacen en bosques. Los
anacardosseencuentrantantoenplantacionesregularescomodeformasilvestre[6].

Otros frutos secos comestibles son las castaas, las bellotas y los cocos. Los
cacahuetes,sinembargo,noloson,yaqueprocedendeunaplantaleguminosa.Pero,
dadoquepresentanunperfilnutricionalsemejantealdelosfrutossecos,sonhabitual
ymundialmenteconsideradoscomotales[4].

Enfuncindesupresentacin,losfrutossecosseclasificanen[7]:

Frutossecosconcscara.Sonlosquesepresentanconsucscara,talcomo
han sido recolectados, como las nueces, las avellanas, las almendras o los
pistachosconcscara.

Frutossecosengrano.Sonlosproductosqueresultantrasextraerlacscara.

Frutos secos repelados. Son productos en grano, pero sin la piel superficial,
debidoaqueseaplicaunprocesodepelado,comoocurreconlospiones,
lasavellanasolasalmendrasrepeladas.

5.1.3.Procesadodelosfrutossecos

Losfrutossecoscrudospresentanunbajocontenidoenhumedadrelativa,porlo
que no es necesario consumirlos tras la cosecha. Adems, si la recoleccin se ha
realizadode manera adecuada y en condiciones ptimas, pueden conservarse hasta
912mesesconbuenascualidadesorganolpticasynutricionales.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
192 Captulo5

Antes de su comercializacin, los frutos secos son sometidos a uno o varios de


los procesos siguientes: limpieza, clasificacin, calibrado, descascarillado, secado,
tostado,pelado,repelado,fritoosalado[7].Demaneraqueencontramos:

Frutos secos crudos. No se les ha aplicado ningn proceso tecnolgico de


elaboracin.Esloqueocurreconlasnueces,quesuelenpresentarseenteras
y crudas. Algunos frutos secos crudos pueden sufrir un proceso de
elaboracin (laminado, paliteado, granillado, molturacin) que afecte a su
formadepresentacin.

Frutos secostostados. En este caso, se les somete a un proceso de tostado,


quepuede incluir la adicin de sal, caso de las avellanas, lospistachosy las
almendras.

Frutos secos fritos. Se les somete a un proceso de fritura en aceite vegetal,


generalmenteacompaadodelaadicindesal.Enalgunoscasos,lafriturase
acompaaconmiel.

5.1.3.1.Recoleccin

Una buena recoleccin es el primer paso para obtener frutos secos con una
calidadorganolpticaynutricionaladecuada.Lacscaradelfrutodebeestarentera,
seca y limpia, y debe presentar su color caracterstico y sin ennegrecimiento. Al
romper la cscara, el grano debe aparecer bien desarrollado, limpio y sin olores ni
saboresextraos,ademsdeestarsano(sininsectos,mohosopodredumbre)[7].

Para que la recoleccin no condicione negativamente la vida posterior del


producto, debeevitarse un contacto inadecuado con elsuelo, as como los golpes y
laslesionesdelosfrutos,conelobjetivodequenopuedanpenetrarlosinsectosylos
microorganismos,aligualquelahumedad[7].

Larecoleccinpuedehacersedeformamanualomecnica,enfuncindeltipo
defrutosecoodelazonadeproduccin.Eselcasodelasalmendrasydelasnueces,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 193

queenlacuencamediterrneasuelenrecolectarseamano,mientrasqueenEstados
Unidosseempleancosechadorasmecnicasqueagitanlosrbolesparahacercaerlos
frutos maduros al suelo, de donde se recogen posteriormente [8, 9]. Los pistachos
tambin se recolectan con mquinas, aunque a veces, sobre todo si se trata de
rboles jvenes, el proceso se realiza a mano [10]. En cambio, las nueces de
macadamia,lasdeBrasil,losanacardosylasavellanassedejancaeralsuelounavez
maduras, de donde son recogidas manual o mecnicamente de forma peridica [8
10]. Por su parte, la recoleccin de los piones es artesanal y, o bien se cortan las
piasverdesqueloscontienen,sedejansecaralsolyseextraenlospiones,obien
serecogenlosfrutosdedebajodelospinospioneros[10].

5.1.3.2.Conservacin

Una vez recolectados los frutos secos es muy importante someterlos


inmediatamente a unas buenas condiciones de conservacin, para reducir las
posibilidades de contaminacin por hongos o insectos. En primer lugar, hay que
secarlos rpidamente hasta humedades relativas inferiores al 56%. Luego,
conservarlosenlugaresfrescosysecos,contemperaturasderefrigeracinentrelos6
ylos10C,unahumedadrelativainferioral60%yunabuenaventilacin[7].

De este modo es posible conservar los frutos secos entre 9 y 12 meses, un


perodo de tiempo similar al que transcurre entre cada cosecha anual. Pero este
tiempo depende del tipo de producto. Sin embargo, en ningn caso es aconsejable
prolongarlo,yaquesualtocontenidoencidosgrasospredisponealenranciamiento.
De hecho, las nueces se enrancian con mayor rapidez que otros frutos secos por su
riquezaencidosgrasospoliinsaturados[911].

Uno de los procesos recomendados para mejorar la conservacin de los frutos


crudos,aligualqueantesdeenvasarlosagranelysinelaborar,eslafumigacin.As
se evita su insectacin. Y aunque los productos aplicados son muy txicos para los
insectos,nomodificannilaspropiedadesorganolpticasninutricionalesdelosfrutos


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
194 Captulo5

secos [7]. Pero desde hace unos aos se est probando con buenos resultados la
irradiacinconrayoscomounaalternativaalafumigacin[12,13],yaquetampoco
altera las propiedades de los productos y se elimina el riesgo que supone la
manipulacindelosinsecticidas.

5.1.3.3.Elaboracin

Tras la recoleccin y los procesos de limpieza y clasificacin, a algunos frutos


secos,casodelasalmendras,losanacardos,lasavellanas,laspacanasolospiones,
selesquitalacscara.Otrosfrutos,comolosdistintostiposdenuecesolospistachos,
puedenserdescascarilladosono[8].

Parte de la produccin de frutos secos se consume sin que previamente se les


aplique ningn otro tratamiento adicional (avellanas, nueces, pacanas y nueces de
Brasil),mientrasqueotrapartedelaproduccinpuedeconsumirse,obiencruda,o
bientrashabersidotostadaysalada(anacardos).Lospionesylasalmendrassuelen
tostarse,mientrasqueeshabitualquelasnuecesdemacadamiasefranysalen.En
cuantoalospistachos,lonormalestostarlosysalarlos,tantosiseleshaquitadola
cscaracomosino[811].

Encualquiercaso,losprocesosdeelaboracinalosqueselessometeimplican
aplicarcalor,yaquesetratadeuntostadoounafritura.Ambosreducenlahumedad
relativadelfrutosecoavaloresprximosal2%yfavorecensuconservacin,adems
de eliminar microorganismos e insectos. El tostado se realiza aplicando aire caliente
(150 C) sobre el producto, o bien combinando aire caliente y una superficie de
contacto en movimiento a alta temperatura (conveccinconduccin). La fritura se
lleva a cabo sumergiendo el fruto seco en un aceite vegetal a una temperatura
cercanaalos150C[14].Losdosprocesospuedeniracompaadosdeunsaladoy,en
elcasodelafritura,tambindeunprocesodecaramelizacinodeadicindemielo
similares[7].Laadicinfinaldesaltambinfavorecelaconservacindelfrutoseco,
yaqueinhibeelcrecimientodemohos.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 195

Gracias al tostado, los frutos secos desarrollan una textura crujiente y un color
tostado, a la vez que numerosos aromas. Adems, disminuye su contenido en
azcares por las reacciones de pardeamiento que se producen, que incluyen
reacciones de caramelizacin y las reacciones de Maillard. Tambin pueden
desnaturalizarsealgunasprotenas,aunquesinquedisminuyasensiblementesuvalor
nutritivo. Sin embargo, mientras que las vitaminas B2 (riboflavina) y B3 (niacina) se
conservanbien,sedestruyeunaltoporcentajedeB1(tiamina)[14].

Enlafritura,partedelaceiteempleadoquedaimpregnadoenelalimento,conlo
que le termina aportando sus componentes nutricionales y su aroma, a la vez que
partedelafraccingrasadelalimentosefundeeincorporaalaceitedefritura.Este
proceso es ms agresivo que el tostado y provoca una desnaturalizacin de las
protenas,unpardeamientoqumico,yunadestruccindevitaminasyantioxidantes
[14].Debidoaestaprdidadeantioxidantes,ydadoqueelaltocontenidoencidos
grasos de los frutos secos da problemas de enranciamiento, es habitual aadir un
antioxidantedurantelafritura[7].

5.1.3.4.Envasado

Elenvasadodebeidentificarelproductoyconservarloadecuadamenteparaque
presente unas condiciones ptimas a lo largo de toda su vida til [14]. Los envases
que contienen los frutos secos deben protegerlos frente a contaminaciones fsicas,
qumicasobiolgicasyfrenteaalteracionesdelcolor,elolor,elsaborolatextura,al
mismotiempoquedebenimpedirlaentradadeoxgenoohumedad[7].

Adems,elalmacenamientodelosfrutossecostrassuenvasadoconstituyeuna
parte muy importante de su proceso de obtencin y elaboracin, ya que las
condicionesenlasqueserealizaincidendirectamentesobrelacalidaddelproducto
quellegaalconsumidor.Paraelloesnecesariofrenarlaactuacindelosfactoresque
favorecendichaoxidacin,comosonlapresenciadeoxgeno,laexposicinalaluzo
temperaturaselevadas,olosbajosnivelesdeantioxidantesnaturales.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
196 Captulo5

En este sentido, existen diversos estudios en los que se ha analizado el efecto


que distintas condiciones de almacenamiento y diferentes materiales de envasado
ejercen sobre la calidad de los frutos secos [15, 16]. As, se ha demostrado que la
temperaturaeselprincipalfactorimplicadoenlaoxidacin,seguidoporlapresencia
deoxgenoylaluz[15].Encuantoalasatmsferasprotectoras(aqullasenlasqueel
oxgenodelenvasehasidosustituidoporotrosgases,comonitrgeno,argnohelio),
s son eficaces frente a la oxidacin, pero son an ms eficaces ciertos materiales
capacesdeabsorberoxgeno[16].

De forma general, los materiales de envasado que se utilizan son el metal, el


vidrio o el plstico. Los tarros de vidrio permiten aplicar el vaco, con lo que se
incrementaelpotencialdeconservacin.Laslatasmetlicascierranhermticamente,
protegentotalmentedelaluzyademspermitenaadiratmsferasprotectoras.Por
suparte,losplsticosconstituyenbuenosmaterialesdeenvasado,yaque,ademsde
ser flexibles, ligeros y resistentes, pueden proteger de la luz (si llevan una capa
plsticadealuminio)ytambinpermitenaadiratmsferasprotectoras.

5.1.4.Composicinqumica

Todoslosfrutossecossecaracterizanporunaltovalorenergtico.Estosedebe
al elevado porcentaje de lpidos de su composicin, que oscila entre el 26% para el
coco y el 75% para las nueces de macadamia. Adems, los cidos grasos que
constituyen estos lpidos son mayoritariamente monoinsaturados, entre los que
destacaelcidooleico,aunquetambinesimportantelacantidaddepoliinsaturados,
principalmentedecidolinoleico[17,18].

Tambinelcontenidoproteicodelosfrutossecosesrelativamentealto,yaque,
enalgunoscasos(pistachosyalmendras)llegahastalos20g/100g.Sinembargo,el
patrndeaminocidosproporcionadoporlosfrutossecosnoesptimo,alpresentar
deficienciasrespectoaalgunosaminocidosesencialescomolalisina,eltriptfano,la
metioninaylacistena[17,18].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 197

Respecto a los hidratos de carbono, las cantidades en las que aparecen se


asemejanalasdelasprotenas.Oscilanentreun12%paralasnuecesyun62%para
lascastaas,ylasacarosaeselazcarmayoritario(>95%deltotaldelosazcares).A
diferencia de otros productos vegetales, apenas contienen almidn, aunque son
especialmentericosenfibrainsoluble[17,18].

Encuantoalasvitaminasylosminerales,losfrutossecossonbuenasfuentesde
estosmicronutrientes.Especialmenteimportanteeselaportedevitaminasdelgrupo
B (B1, B2, B3, B6, B9), vitamina E y vitamina K que proporcionan, as como de ciertos
minerales:Mn,Mg,PyK.Adems,lasnuecesdemacadamiadestacanporsuriqueza
en Se, los piones, en Zn, y las almendras y los anacardos, en Ca y Fe,
respectivamente[17].

Por ltimo, los frutos secos, sobre todo las pacanas,las nueces y los pistachos,
presentan cantidades importantes de distintos compuestos fenlicos [19, 20], con
numerososybeneficiososefectosantioxidantes[17].

Pero el contenido de estos componentes qumicos vara enormemente en


funcin del tipo de fruto seco que se considere [21, 22]. Y no slo eso: tambin
existennotablesdiferenciassegnlavariedad[23,24],lazonadeproduccin[25,26]
olascondicionesdecultivoyrecoleccin[27].

5.1.5.Efectosfuncionalesdelosfrutossecos

Talycomosehavistoenapartadosanteriores,losfrutossecosconstituyenuna
buena e importante fuente de energa, ricos en lpidos y protenas y con una gran
variedaddemicronutrientes,porloquesehanconsumidodesdelaprehistoria.Pero,
adems, y debido a su composicin, estudios actuales han demostrado que estos
productostambinpuedenserconsideradosalimentosfuncionalesnaturales,capaces
de prevenir diferentes enfermedades crnicas. De hecho, las dietas seguidas en
ciertaszonas,enlasquelosfrutossecosocupanunlugardestacado,comoocurrecon


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
198 Captulo5

ladietamediterrnea,se han revelado patrones alimenticios quefavorecenla salud


dequieneslossiguen[28,29].

El consumo habitual de frutos secos est relacionado con un descenso en la


incidencia de las enfermedades cardiovasculares, la obesidad y la diabetes, al igual
que con la reduccin del colesterol, al mismo tiempo que ayudan a prevenir ciertas
enfermedadesdegenerativasdelmundocivilizado[30,31].

Losresponsablesdeestosnumerososefectosbeneficiosossonvarios.Enprimer
lugar,loscidosgrasosmonoypoliinsaturadosdelperfillipdicodelosfrutossecos,
que reducen los factores de riesgo cardiovascular al disminuir el contenido de
colesterol en sangre [32]. Estos compuestos, junto con los fenoles, que presentan
actividadesantioxidantes,sonlosresponsablesdelainhibicindelosfenmenosde
oxidacin,directamenterelacionadosconciertostiposdecncer[33].Porsuparte,el
alto contenido en fibra alimentaria de los frutos secos ayuda a mejorar el trnsito
intestinalymantienelasensacindesaciedad,loqueafectaalpesocorporal,alavez
quefavoreceelcontroldelmetabolismodelaglucosa,conunaaccinclarasobrela
sensibilidadalainsulina[34].

5.2.LOSPISTACHOS

Lospistachossonlosfrutosdelrboldenominadoalfncigoorbolpistachero.
Su parte comestible es la semilla, que es de color amarillo o verde. Pertenece a la
familiaAnacardiaceae,lamismadelanacardooelmango.DentrodelgneroPistacia
L.,quecomprende9especiesy5subespeciesdiferentes[35],slolaespecieP.vera
proporcionafrutoscomestibles[3].

OriginariodelaszonasdesrticasdeAsiacentralyOrientePrximo,dondeyase
cultivaba en el 10.000 a. C., el pistachero se introdujo poco a poco en los pases
mediterrneos,dedondeseexportenelsigloXIXalosEstadosUnidos.Sinembargo,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 199

nofuehastalosaos70delsiglopasadocuandolosestadounidensesloempezarona
cultivar masivamente [2, 9]. Actualmente, la Repblica Islmica de Irn es el mayor
productormundialdepistachos,conunaproduccinanualdecasi200.000toneladas
en el 2008, seguido de los EE.UU. y Turqua [36]. Siempre se comercializa con la
cscara,tostadoysalado,yprincipalmenteseempleaenlaelaboracindeheladosy
confitera,aunquetambinseconsumecomoaperitivo.

Los pistachos se caracterizan por ser los menos calricos de todos los frutos
secos, con 577 kcal/100 g de producto seco, a la vez que presentan el mayor
contenidoproteico(alrededorde20g/100g)y,adems,conunimportanteaportede
lisina.Respectoalrestodefrutossecos,sucontenidoenhidratosdecarbonotambin
esalto(entornoal28%),aligualquesucontenidoenvitaminasAyB6[17,18].

Comoocurreparalosdemsfrutossecos,lospistachostambinpresentanuna
diferentecomposicinqumicaenfuncindelavariedaddequesetrate[24,37].De
este modo, distintos estudios realizados sobre la composicin de los pistachos han
permitidoclasificarlasmuestrasanalizadassegnsuorigen[38,39]ovariedad[40].

Porltimo,ademsdelosefectosfuncionalesbeneficiososdelassemillasdelos
pistachos(porserunfrutoseco)[30,41],tambinhayqueconsideraralgunasotras
propiedadesquetienenotrosproductosproducidosporelrbolpistachero.Eselcaso
delaactividadantimicrobianaquepresentanlosaceitesesencialesobtenidosapartir
de su resina [42], o las propiedades antifngicas de los aceites esenciales obtenidos
desushojas[43].

5.3.ELAROMADELOSPISTACHOSTOSTADOS

Los frutos secos crudos, sin tostar o frer, no destacan por tener un aroma
especialmenteintenso.Encambio,todoslosfrutossecostostadospresentanunolor
caractersticoyfcilmenteidentificable[44].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
200 Captulo5

Elprocesodeltostadogeneranumerososcompuestosvoltiles,principalmentea
travs de tres reacciones: la reaccin de Maillard y su asociada, la degradacin de
Streckerdelosaminocidos,lacaramelizacindelosazcares,yladegradacindelos
lpidos,queincluyelasreaccionestrmicas(pirlisis)ylasoxidativas.Graciasalasdos
primerasreaccionesseproducenpirazinas,piridinas,pirroles,furanosylosaldehdos
de Strecker, entre otros muchos compuestos, mientras que la caramelizacin es la
responsable de la aparicin de los derivados del furano y el maltol. Todos estos
compuestos resultantes aportan al producto final sus aromas, colores y sabores
caractersticos. Por su parte, y aunque la degradacin de los lpidos suele asociarse
conlaformacindenotasaromticasdesagradables,tambinpropicialaaparicinde
algunosaldehdosycetonasqueproporcionannotasdulcesyafrutadas[44].

Existen varios estudios en los que se ha analizado la composicin voltil de


distintosfrutossecos,tantocrudoscomotostados[4548].Tambinsehainvestigado
elefectoqueestetostadotienesobreelaromadelosfrutossecos,paraloquesehan
comparadolasfraccionesvoltilesyaromticasdelosproductostostadosysintostar
[49,50].Deestaforma,ydeunauotramanera,elaromadelasnueces,lasavellanas,
lasalmendras,lascastaas,laspacanas,lasnuecesdeBrasilylasdemacadamiayaha
sidoestudiado[4450].

Sin embargo, no existen estudios sobre el aroma de los piones, y nicamente


hayuntrabajode1975enelqueseanalizanlosvoltilesdelasnuecesdemacadamia
[51].Delmismomodoque,hastaeldesarrollodelaparteexperimentalquehadado
lugarestatesisdoctoral,slohabauntrabajosobreloscompuestosvoltilesdelos
pistachostostados[52],aunquelainformacinqueproporcionaesteestudiode1981
esbastanteincompleta.

As, a pesar de que los autores de dicho estudio identifican una serie de
compuestos (mediante espectrometra de masas y/o tiempos de retencin), en
verdadnopuedenestablecerlaimportanciaqueesoscompuestostienenenelaroma
global de los pistachos tostados, ya que no trabajan con la cromatografa de gases

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 201

olfatometra. Se limitan a relacionarlos con odorantes previamente identificados en


otrosproductostostadosyquesecreequecontribuyenalaromatostado.

Adems, tambin debe sealarse que el extracto aromtico obtenido se


manipula de distintas maneras para poder ser analizado, segn un procedimiento
publicadoen1974[53].Peroenningnmomentosecompruebaquerealmentesea
representativodelaromadelospistachos.

Porlotanto,ydadoelvacoexistenteenestecampoyelintersqueelaromade
esteproductosuscitaenlaelaboracindedistintosalimentosmanufacturadosquese
empleanenpastelerayconfitera,sedecidiiniciarlainvestigacindelaromadelos
pistachostostadosenprofundidad.Enprincipio,estudiandodostcnicasdistintasde
extraccin y concentracin de voltiles, la microextraccin en fase slida sobre el
espaciodecabeza(HSSPME)ylaextraccindirectacondisolventes(DSE)seguidade
highvacuum transfer (HVT). El objetivo era averiguar cul de las dos proporcionaba
extractos representativos de la muestra, o si ambas lo hacan. Y, aunque el estudio
confirm este segundo supuesto, la HSSPME demostr que presentaba una mejor
repetitividad y reproducibilidad. Adems, comparando los resultados olfatomtricos
obtenidosparaambastcnicas,sepudocomprobarquelaHSSPMEtambinpermita
unamayorextraccindecompuestosaromticos.

Todaestainformacindiolugaralprimerartculoqueseadjuntaalfinaldeeste
captulo, titulado Comparative study of two extraction techniques to obtain
representative aroma extracts for being analysed by gas chromatography
olfactometry: application to roasted pistachio aroma y que ha sido publicado en la
revistaJournalofChromatographyA[54].

Asimismo,estasinvestigacionesdieronpiealdesarrollodelsegundoartculode
este captulo, aceptado para su publicacin en la revista Journal of Agricultural and
FoodChemistry[55] en elmomento de redactar estatesis doctoral, y cuyottuloes


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
202 Captulo5

Determination of roasted pistachios (Pistacia vera L.) key odorants by headspace


solidphasemicroextractionandgaschromatographyolfactometry.

En este segundo artculo se procedi a caracterizar el perfil aromtico de dos


variedades distintas de estos pistachos, utilizando la HSSPME como tcnica de
obtencindeextractosaromticosrepresentativos.Latcnicaolfatomtricaaplicada,
el Aroma Extract Dilution Analysis (AEDA), permiti comprobar que la variedad
Fandooghipresentabaunperfilaromticomsricoquelaotravariedad,laKerman,lo
que adems concordaba con los resultados obtenidos del anlisis descriptivo
sensorial.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 203

BIBLIOGRAFA
[1] CarbonellRoura,E.,PastMarn,I.Plantas,frutossecosyevolucindeloshomnidos.En:
SalasSalvad,J.,RosRahola,E.,SabatCasellas,J.,editores.Frutossecos,saludycultura
mediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.5564.
[2] Sol Alberich, R., Angls Soronellas. Historia, simbolismo y citas bblicas de los frutos
secos. En: SalasSalvad, J., Ros Rahola, E., Sabat Casellas, J., editores. Frutos secos,
saludyculturamediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.6576.
[3] Rosengarten,F.,Jr.Thebookofediblenuts.NewYork:DoverPublications,Inc.;2004.
[4] Alasalvar, C., Shahidi, F. Tree nuts: composition, phytochemicals, and health effects: an
overview. En: Alasalvar, C., Shahidi, F., editors. Tree nuts. Composition, phytochemicals,
andhealtheffects.BocaRaton:CRCPress;2009,p.110.
[5] Rae.es,RealAcademiaEspaola[Internet].Madrid:Rae.es;[acceso19deenerode2011].
Disponibleen:http://www.rae.es.
[6] VargasGarca,F.J.rbolesproductoresdefrutossecos.Origen,distribucin,descripcin
y produccin. En: SalasSalvad, J., Ros Rahola, E., Sabat Casellas, J., editores. Frutos
secos,saludyculturamediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.2154.
[7] VilardellCera,J.,FortunyQueralt,J.Poscosechadelosfrutossecos.En:SalasSalvad,J.,
RosRahola,E.,SabatCasellas,J.,editores.Frutossecos,saludyculturamediterrneas.
Barcelona:EditorialGlosa,S.L.;2005,p.97106.
[8] Ensminger, A. H., Ensminger, M. E., Konlande, J. E., Robson, J. R. K. Foods & Nutrition
encyclopedia.Volume2.2ndedition.BocaRaton:CRCPress;1994.
[9] Kearney, P. Nuts. En: Francis, F. J., editor. Wiley enciclopedia of food science and
technology.Volume4.2ndedition.NewYork:JohnWiley&Sons,Inc.;2000,p.26762690.
[10] Stephenson,R.A.Nuts.En:Caballero,B.,Trugo,L.C.,Finglas,P.M.,editors.Encyclopedia
of food sciences and nutrition. Volume seven. 2nd edition. Amsterdam: Academic Press;
2003,p.42054212.
[11] Styles,B.T.Pinekernels.En:Caballero,B.,Trugo,L.C.,Finglas,P.M.Encyclopediaoffood
sciencesandnutrition.Volumeseven.2ndedition.Amsterdam:AcademicPress;2003,p.
45754578.
[12] Mexis,S.F.,Kontominas,M.G.Effectofgammairradiationonthephysicochemicaland
sensory properties of raw shelled peanuts (Arachis hypogaea L.) and pistachios nuts
(PistaciaveraL.).J.Sci.FoodAgric.2009;89:867875.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
204 Captulo5

[13] AlBachir, M. Effect of gamma irradiation on fungal load, chemical and sensory
characteristicsofwalnuts(JuglansregiaL.).J.StoredProd.Res.2004;40:355362.
[14] AleixandreBenavent,J.L.Conservacindealimentos.Valencia:ServiciodePublicaciones
delaUniversidadPolitcnicadeValencia;1997.
[15] Mexis,S.F.,Badeka,A.V.,Riganakos,K.A.,Karakostas,K.X.,Kontominas,M.G.Effectof
packaging and storage conditions on quality of shelled walnuts. Food Control 2009; 20:
743751.
[16] Jensen,P.N.,Srensen,G.,Brockhoff,P.,Bertelsen,G.Investigationofpackagingsystems
forshelledwalnutsbasedonoxygenabsorbers.J.Agric.FoodChem.2003;51:49414947.
[17] Sathe,S.K.,Monaghan,E.K.,Kshirsagar,H.H.,Venkatachalam,M.Chemicalcomposition
of edible nut seeds and its implications in human health. En: Alasalvar, C., Shahidi, F.,
editors. Tree nuts. Composition, phytochemicals, and health effects. Boca Raton: CRC
Press;2009,p.1135.
[18] Rafecas Martnez, M., Boatella Riera, J. Los frutos secos: fuentes de energa y
macronutrientes.En:SalasSalvad,J.,RosRahola,E.,SabatCasellas,J.,editores.Frutos
secos,saludyculturamediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.129143.
[19] Kornsteiner,M.,Wagner,K.H.,Elmadfa,I.Tocopherolsandtotalphenolicsin10different
nuttypes.FoodChem.2006;98:381387.
[20] Maguire, L. S., OSullivan, S. M., Galvin, K., OConnor, T. P., OBrien, N. M. Fatty acid
profile, tocopherol, squalene and phytosterol content of walnuts, almonds, peanuts,
hazelnutsandthemacadamianut.Int.J.FoodSci.Nutr.2004;55:171178.
[21] Venkatachalam, M., Sathe, S. K. Chemical composition of selected edible nut seeds. J.
Agric.FoodChem.2006;54:47054714.
[22] Moodley, R., Kindness, A., Jonnalagadda, S. B. Elemental composition and chemical
characteristics of five edible nuts (almond, Brazil, pecan, macadamia and walnut)
consumedinSouthernAfrica.J.Environm.Sci.HealthPartB2007;42:585591.
[23] Ruggeri,S.,Cappelloni,M.,Gambelli,L.,Nicoli,S.,Carnovale,E.Chemicalcompositionand
nutritivevalueofnutsgrowninItaly.Ital.J.FoodSci.1998;10:243252.
[24] Kkner,E.,Yurt,B.SomechemicalcharacteristicsofPistaciaveravarietiesproduced
inTurkey.Eur.FoodRes.Technol.2003;217:308310.
[25] GarcaLpez, C., GranTeruel, N., BerenguerNavarro, V., GarcaGarca, J. E., Martn
Carratal,M.L.Majorfattyacidcompositionof19almondcultivarsofdifferentorigins.A
chemometricapproach.J.Agric.FoodChem.1996;44:17511755.

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 205

[26] Evaristo,I.,Batista,D.,Correia,I.,Correia,P.,Costa,R.ChemicalprofilingofPortuguese
PinuspineaL.nuts.J.Sci.FoodAgric.2010;90:10411049.
[27] Nanos, G. D., Kazantzis, I., Kefalas, P., Petrakis, C., Stavroulakis, G. G. Irrigation and
harvesttimeaffectalmondkernelqualityandcomposition.Sci.Hortic.2002;96:249256.
[28] Lois, M. T. A.E., GarcaAndrade, C. R., Walther, L. A. .S., NezCorts, J. M. The
Mediterranean diet: a combination of beneficial elements for cardiovascular disease.
Curr.Nutr.FoodSci.2010;6:105106.
[29] Vernaglione,L.TheMediterraneandiet:amatterofhistory,tradition,cultureandhealth.
J.Nephrol.2009;22:149158.
[30] Ternus, M. E., Lapsley, K., Geiger, C. J. Health benefits of tree nuts. En: Alasalvar, C.,
Shahidi, F., editors. Tree nuts. Composition, phytochemicals, and health effects. Boca
Raton:CRCPress;2009,p.3764.
[31] Coates,A.M.,Howe,P.R.C.Ediblenutsandmetabolichealth.Curr.Opin.Lipidol.2007;
18:2530.
[32] Mataix Verd, J., Ros Rahola, E. Composicin en cidos grasos de los frutos secos:
implicaciones para la salud. En: SalasSalvad, J., Ros Rahola, E., Sabat Casellas, J.,
editores. Frutos secos, salud y cultura mediterrneas. Barcelona: Editorial Glosa, S. L.;
2005,p.145156.
[33] Blomhoff, R. Antioxidantes y frutos secos: importancia en la prevencin de las
enfermedadescrnicas.En:SalasSalvad,J.,RosRahola,E.,SabatCasellas,J.,editores.
Frutossecos,saludyculturamediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.177
199.
[34] SalasSalvad, J., GarcaLorda, P., Ros Rahola, E. Fibra, frutos secos y enfermedades
cardiovasculares.En:SalasSalvad,J.,RosRahola,E.,SabatCasellas,J.,editores.Frutos
secos,saludyculturamediterrneas.Barcelona:EditorialGlosa,S.L.;2005,p.157175.
[35] ALSaghir,M.G.PhylogeneticanalysisofthegenusPistaciaL.(Anacardiaceae)basedon
morphologicaldata.AsianJ.Plant.Sci.2010;9:2835.
[36] Fao.org, Food and Agriculture Organization of the United Nations [Internet]. Roma:
Fao.org;[acceso19deenerode2011].Disponibleen:http://faostat.fao.org.
[37] Tsantili, E., Takidelli, C., Christopoulos, M. V., Lambrinea, E., Rouskas, D., Roussos, P. A.
Physical,compositionalandsensorydifferencesinnutsamongpistachio(PistaciaveraL.)
varieties.Sci.Hortic.2010;125:562568.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
206 Captulo5

[38] Anderson, K. A., Smith, B. W. Use of chemical profiling to differentiate geographic


growingoriginofrawpistachios.J.Agric.FoodChem.2005;53:410418.
[39] Arena, E., Campisi, S., Fallico, B., Maccarone, E. Distribution of fatty acids and
phytosterols as a criterion to discriminate geographic origin of pistachio seeds. Food
Chem.2007;104:403408.
[40] Chahed, T., Bellila, A., Dhifi, W., Hamrouni, I., Mhamdi, B., Kchouk, M. E., Marzouk, B.
Pistachio (Pistacia vera) seed oil composition: geographic situation and variety effects.
GrasasAceites2008;59:5156.
[41] Gentile,C.,Tesoriere,L.,Butera,D.,Fazzari,M.,Monastero,M.,Allegra,M.,Livrea,M.A.
Antioxidant activity of Sicilian pistachio (Pistacia vera L. Var. Bronte) nut extract and its
bioactivecomponents.J.Agric.FoodChem.2007;55:643648.
[42] Alma, M. H., Nitz, S., Kollmannsberger, H., Digrak, M., Efe, F. T., Yilmaz, N. Chemical
composition and antimicrobial activity of the essential oils from the gum of Turkish
pistachio(PistaciaveraL.).J.Agric.FoodChem.2004;52:39113914.
[43] Duru,M.E.,Cakir,A.,Kordali,S.,Zengin,H.,Harmandar,M.,Izumi,S.,Hirata,T.Chemical
composition and antifungal properties of essential oils of three Pistacia species.
Fitoterapia2003;74:170176.
[44] Cadwallader, K. R., Puangpraphant, S. Flavor and volatile compounds in tree nuts. En:
Alasalvar, C., Shahidi, F., editors. Tree nuts. Composition, phytochemicals, and health
effects.BocaRaton:CRCPress;2009,p.109125.
[45] Elmore,J.S.,Nisyrios,I.,Mottram,D.S.Analysisoftheheadspacearomacompoundsof
walnuts(JuglansregiaL.).FlavourFragr.J.2005;20:501506.
[46] Alasalvar, C., Odabasi, A. Z., Demir, N., Balaban, M. ., Shahidi, F., Cadwallader, K. R.
VolatilesandflavoroffiveTurkishhazelnutvarietiesasevaluatedbydescriptivesensory
analysis, electronic nose, and dynamic headspace analysis/gas chromatographymass
spectrometry.J.FoodSci.2004;69:99106.
[47] Takei,Y.,Yamanishi,T.Flavorcomponentsofroastedalmond.Agric.Biol.Chem.1974;38:
23292336.
[48] Krist,S.,Unterweger,H.,Bandion,F.,Buchbauer,G.VolatilecompoundanalysisofSPME
headspace and extract samples from roasted Italian chestnuts (Castanea sativa Mill.)
usingGCMS.Eur.FoodRes.Technol.2004;219:470473.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Lospistachostostados 207

[49] Alasalvar, C., Shahidi, F., Cadwallader, K. R. Comparison of natural and roasted Turkish
Tombulhazelnut(CorylusavellanaL.)volatilesandflavorbyDHA/GC/MSanddescriptive
sensoryanalysis.J.Agric.FoodChem.2003;51:50675072.
[50] BurdackFreitag, A., Schieberle, P. Changes in the key odorants of Italian hazelnuts
(CorylusavellanaL.Var.TondaRomana)inducedbyroasting.J.Agric.FoodChem.2010;
58:63516359.
[51] Crain,Jr.,W.O.,Tang,C.S.Aresearchnote:volatilecomponentsofroastedmacadamia
nuts.J.FoodSci.1975;40:207208.
[52] Mervat,M.,Soliman,A.,Osman,F.,ElSawy,A.Volatilecomponentsofroastedpistachio
nut.Agric.Biol.Chem.1981;45:21232125.
[53] Takei, Y., Shimada, K., Watanabe, S., Yamanishi, T. Volatile components of roasted
almonds:basicfraction.Agric.Biol.Chem.1974;38:645648.
[54] Acea,L.,Vera,L.,Guasch,J.,Busto,O.,Mestres,M.Comparativestudyoftwoextraction
techniques to obtain representative aroma extracts for being analysed by gas
chromatographyolfactometry: application to roasted pistachio aroma. J. Chromatogr. A
2010;1217:77817787.
[55] Acea,L.,Vera,L.,Guasch,J.,Busto,O.,Mestres,M.Determinationofroastedpistachios
(Pistacia vera L.) key odorants by headspace solidphase microextraction and gas
chromatographyolfactometry.J.Agric.FoodChem.2011,DOI:10.1021/jf104496u.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Comparativestudyoftwoextractiontechniquestoobtainrepresentative
aromaextractsforbeinganalysedbygaschromatographyolfactometry:
applicationtoroastedpistachioaroma

JournalofChromatographyA,1217(2010)77817787


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Comparativestudyoftwoextractiontechniquestoobtainrepresentativearoma
extractsforbeinganalysedbygaschromatographyolfactometry:Applicationtoroasted
pistachioaroma

LauraAcea,LucianoVera,JosepGuasch,OlgaBusto,MontserratMestres

ResearchGroupofAnalyticalChemistryofWineandFood
DepartmentofAnalyticalChemistryandOrganicChemistry
CampusSescelades.FacultyofOenologyofTarragona
RoviraiVirgiliUniversity.43007Tarragona(Spain)

ABSTRACT

This research paper presents a comparative study of two different extraction and concentration
techniques to obtain representative pistachio aroma extracts: the traditional direct solvent
extraction (DSE) followed by highvacuum transfer (HVT) and the headspace solidphase
microextraction (HSSPME). The results showed that, although both techniques provide accurate
informationaboutthearomaticcompositionthatwillbeperceivedbytheconsumer,theprecisionin
terms of withinday repeatability and betweendays repeatability (intermediate precision) of the
chromatographic areas presented better values for HSSPME than for DSEHVT. Moreover the
solventfreeHSSPMEallowstheextractionofmoreodouractiveregions,requiresverylittlesample
handlingandshortertimeforsampling.

KEYWORDS: Pistachio nuts; aroma; Direct Solvent ExtractionHigh Vacuum Transfer; Headspace
SolidPhaseMicroExtraction;GasChromatographyOlfactometry


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
212 JournalofChromatographyA(2010)

1.INTRODUCTION

Ediblenutshavebeenwidelyusedsinceancienttimesasanimportantsourceofnutrientssuchas
proteins,vitamins,mineralsandlipids(mainlymonoandpolyunsaturatedfattyacids)[1,2].

Asinanyotherfoodproduct,nutsqualityiscloselyrelatedtotheflavourandthearomadetectedby
consumerswillhaveagreatinfluenceontheacceptanceorrejectionofthenutevaluated.However,
ithastobesaidthatrawnutshavearatherblandaroma,beingsomecompoundsgeneratedduring
the roasting process responsible for the characteristic nut odour [36]. Due to the importance of
nutsonhumandietandhealth[7,8]thereareseveralstudiespublishedontheirchemical[2,912]
and volatile composition [1315] for both raw and roasted nuts. Nevertheless, only a few studies
related to their aromatic fraction [36, 1315] have been carried out and, for some nuts, such
pistachios,therehasnotbeenpublishedanystudyaboutthecompoundsresponsibleforitsaroma.

The aroma of any foodstuff is influenced by the action of hundreds of different and very
heterogeneouschemicals(alcohols,aldehydes,esters,ketones,pirazines,acids,terpenes,etc.)each
of them with a different contribution to the whole aroma [16]. Every odorant must be volatile in
order to reach the nose and interact with the appropriate receptors located on the olfactory
epithelium[17],butnotallthecomponentsofthevolatilefractionareodouractive.

Gas chromatographyolfactometry (GCO) is a powerful technique in food aroma characterization


[18, 19] that uses the human nose as a chromatographic detector in parallel with a conventional
one, like the Flame Ionic Detector (FID) or the Mass Spectra Detector (MSD). Therefore, this
technique allows distinguishing the odouractive compounds within the whole range of volatiles
presentinaparticularproduct.SeveraltechniqueshavebeendevelopedtocollectandprocessGCO
datainordertoevaluatethesensorycontributionofeachodoranttothesamplearoma[18].Aroma
extractdilutionanalysis(AEDA)isoneofthemostcommonlyusedtodeterminetherelativeodour
potencyofthosearomaticcompoundspresentinasampleextract[20,21].Thistechniqueinvolves
stepwisedilutionofthearoma extractfollowedbyanevaluationofeachdilutionbyGCOuntilno
odorants are perceived in the GCO effluent. The last dilution step where an odorant is perceived
constitutes its flavour dilution (FD) factor, which can be considered a good indicator of the odour
potencyofthatcompound(i.e.thehighertheFDfactor,thehigherthesensorycontributionofthat
compoundtothesample).Inthatway,AEDAisavaluablescreeningtoolfor rankingodouractive
compoundsinasampleaccordingtotheirrelativeodourpotency.

But obtaining reliable data in aroma characterization depends on the representativeness of the
extractitself.Indeed,severalstudiesshowthelargeinfluenceoftheextractionmethodemployed
on the results of the olfactometric analyses performed [22], because the extract not only should

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 213

containallthesampleodorants,butalsotheirrelativeamountsshouldremainconstant.Nowadays,
toobtainarepresentativeextractisstillachallengeinmostfoodstuffs,wheretheiraromaaredue
tocomplexmixturesofhundredsofcompoundswithdifferentchemicalpropertiesand,moreover,
present at different levels of concentration, ranging from several mg L1 to a few ng L1. Different
samplingtechniques,suchasliquidliquidextraction,solidliquidextraction,distillation,headspace
techniques, solidphase microextraction, demixing, etc. [2330] have been used to obtain extracts
foraromacharacterization.

The purpose of this paper was to make a comparative study of two different extraction and
concentration techniques to obtain representative pistachio aroma extracts: the direct solvent
extraction (DSE) followed by highvacuum transfer (HVT) [26, 31] and the headspace solidphase
microextraction (HSSPME) [32]. The first technique has been widely used as sample preparation
techniqueonthecharacterizationofmanyfoodsbutitimpliesmultiplestepsinsamplehandling,it
istimeconsuming,and,asitemploysorganicsolvents,itisunfriendlywiththeenvironmentandit
can also generate artifacts that will interfere in aroma detection. However, once the extract is
obtaineditisveryeasytoproceedwiththeAEDAanalysis.Ontheotherhand,theSPMEisanewer
solventfree technique much faster because it carries out the extraction and concentration in a
single step, and that requires very little sample manipulation. However, there is an important
drawback when dealing with the AEDA because, as the analytes are retained on the fibre and no
physicalextract isobtained,itisnecessarytostepwisediluteeachsamplebeforecarryingoutthe
extractionforeachdilution[27].

2.MATERIALSANDMETHODS

2.1.Samples

The samples used in this study were Iranian pistachio nuts of the variety Fandooghi. Shellfree
nutsfromthe2008harvestwereroastedat160Cfor20minutesandimmediatelyvacuumpacked
(bagsof250g)inordertousefreshpistachiosbatchesforeveryanalysis.

2.2.Reagentsandchemicals

The chemical standards of the aroma compounds, whose CAS numbers are specified in Table 2,
were supplied by SigmaAldrich (Madrid, Spain), Fluka (Madrid, Spain) and Lancaster (Bischheim,
France) and their purity was above 90%. Dichloromethane, diethyl ether, hexane and sodium


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
214 JournalofChromatographyA(2010)

chloridewereofanalyticalgradeandpurchasedfromScharlab(Barcelona,Spain),whilepurewater
wasobtainedfromaMilliQpurificationsystem(Millipore,Bedford,USA).

2.3.SPME

The SPME holder for manual sampling and the polydimethylsiloxane (PDMS) 100 m, polyacrilate
(PA) 85 m, CarboxenPolydimethylsiloxane (Carboxen/PDMS) 75 m and StableFlex
DivinylbenzeneCarboxenPolydimethylsiloxane(DVB/CAR/PDMS)50/30mfibresusedinthisstudy
were purchased from Supelco (Bellefonte, USA). All the fibres were conditioned before use and
thermallycleanedbetweenanalysesbyinsertingthemintotheGCinjectorportatthetemperature
recommendedbytheproducer.

2.4.Isolationandconcentrationofthevolatilecompounds

2.4.1.Directsolventextraction(DSE)followedbyhighvacuumtransfer(HVT)

To obtain the extract, 100 g of fresh roasted pistachios finely ground in a coffee mill and passed
throughasieve(1.5mmofdiameter)wereextractedwith100mLofdichloromethanefor5hoursat
25 C under constant magnetic stirring and nitrogen atmosphere. Then, the mixture was filtered
(paper Whatman 42) using a water jet filter pump. The liquid phase obtained containing the
volatilesandlargeamountsoflipids,wassubjectedtoahighvacuumtransfer(HVT)[26],inorderto
isolatethevolatilefraction.ToproceedwiththeHVT,theliquidphasewasslowlydroppedintothe
distillation flask, which was heated to 36 C. When the addition was finished, distillation was
continued for 30 min. The vacuum used in the apparatus was of 5 mPa and the distillate was
condensedinthefirstofthetwocoolingtrapsemployed.Thecondensatewasfinallyconcentrated
to0.5mLbymeansofaVigreuxcolumnandathermostaticbathat42C.2Lofthisextractwere
usedforGCOanalysis.

2.4.2.Headspacesolidphasemicroextraction(HSSPME)

To extract the volatiles, 15 g of fresh roasted pistachios finely ground in a coffee mill and passed
through a sieve (1.5 mm of diameter) were placed into a 50 mL glass vial together with 15 mL of
MilliQ water and a magnetic stir bar, being the sample/headspace ratio 1:1. After tightly capping
thevialwithasiliconseptumundernitrogenatmosphere,itwaspreequilibratedfor15minat50C
inathermostaticbath.Afterwards,thestainlesssteelneedleoftheSPMEdevicewherethefibreis

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 215

housed was pushed through the vial septum. Then, the fibre was pushed out of the housing and
exposedfor2hoursat50C tothevialheadspace.Afterextraction,thefibre waspulledinto the
needleassembly,theSPMEdevicewasremovedfromthevialandinsertedintotheinjectionportof
theGCforthermaldesorptionoftheanalytesat270Cfor1min.

2.5.Gaschromatographyanalysis

2.5.1.GCFIDandGCO

TheanalyseswereperformedwithaHewlettPackard(HP,PaloAlto,USA)6890gaschromatograph
equippedwithaflameionizationdetector(FID)andanolfactorydetector.Thefusedsilicacapillary
column employed to carry out the chromatographic separations was a Chrompack (Varian,
Middelburg, The Netherlands) CPWAX 57CB (50 m x 0.25 mm i.d., 0.2 m film thickness) with
helium as a carrier gas at a constant flowrate of 1 mL min1. The oven temperature was
1
programmedasfollows:40C(2min),5Cmin to220C(22min).Thefusedsilicacapillarycolumn
usedtoverifytheidentityofthecompoundswasaHP5(AgilentTechnologies,USA)(30mx0.32
mmi.d.,0.25mfilmthickness)withheliumasacarriergasataconstantflowrateof1mLmin1.
1 1
Theoventemperatureprogramwas:40C(5min),3.5Cmin to120C,10Cmin to210C(10
min). In both cases, the splitsplitless injection port operated inthe splitless mode at 270C for 1
minandthetemperatureoftheFIDwassetat250C.

TosplittheeffluentintotheFIDandthesniffingport,theendofthecapillarycolumnwasconnected
toasplittingassemblybasedontheCapillaryFlowTechnology(AgilentTechnologies,USA).Thesplit
ratio for the olfactometric analysis was 1:1 (FID:sniffing port) and it was achieved by using two
deactivated and uncoated fused silica capillaries of the same length and width as a transfer line
between the splitting assembly and the detectors. Moreover, the use of an olfactory detector
control module commercialized by SGE International (Ringwood, Australia) that incorporates a
heated transfer section from the GC oven to the glass detection cone, kept the unit at a suitable
temperature to transfer the volatile compounds to the detection cone without losses due to
condensation. Furthermore, the glass cone is purged with humidified air to prevent nasal mucous
membranesfromdryingoutinordertomaintainolfactorysensitivity.

Timing and odour descriptions were recorded by two trained sniffers after each sample injection
and they were replaced at 15 min intervals to avoid fatigue and distractions. Each sample was
analysedintriplicatebyeachtrainedresearcher.



APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
216 JournalofChromatographyA(2010)

2.5.2.GCMS

GCMS analyses were performed with a HewlettPackard (HP, Palo Alto, USA) 6890 gas
chromatographcoupledtoanHP5973massselectivedetector.Separationwasachievedunderthe
sameoperatingconditionsdescribedaboveandusingthesamecolumnsasintheGCFIDandGCO
analyses. The mass spectrometer operated in the electron impact ionization mode (70 eV).
Interface,sourceandquadrupoletemperatureswere200C,230Cand150C,respectively, and
themassrangewasfrom35to300amu.Thesplitsplitlessinjectionportoperatedinthesplitless
modeat270Cfor1min.

2.6.AromaExtractDilutionAnalysis

To get ahierarchically classification of the most odouractive compounds in roasted pistachioswe


determinedtheflavourdilution(FD)factors(obtainedbytwotrainedsniffersintriplicate)byAEDA,
which was carried out in two different ways depending on the extraction technique employed.
When dealing with the DSE, the aroma extract obtained was stepwise diluted (1:4) with
dichloromethane[33].ButwhenthesamplingwasperformedwithHSSPME,anewapproachtothe
AEDAwasusedasnophysicalextractwasobtained.Itconsistsofstepwisereductionoftheamount
of roasted pistachio that was put into the vial (1:4) before carrying out the SPME by adding a
suitable amount of MilliQ water to keep constant the headspace/sample ratio. In both cases, the
dilutions were carried out until no odorant was detected by sniffing the highest dilution. Two
experienced sniffers performed the AEDA experiments and their response (sensitivity) to the
individualcompoundsdidnotdifferbymorethan2FDfactors.

2.7.Compoundsidentification

The odorants detected in the olfactometric study were identified by comparison with reference
compoundsonthebasisofthefollowingcriteria:odourqualityperceivedatthesniffingport,mass
spectra obtained and retention indices (RI) on the two stationary phases of different polarity
employed(CPWAX57CBandHP5).Retentionindiceswerecalculatedfromtheretentiontimesofa
series of nalkanes (from 6 to 26 carbon atoms) injected under the same chromatographic
conditions.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 217

2.8.Sensoryanalysis

To determine the similarity between the aroma of the different extracts obtained with the two
extractiontechniquesandthearomaofthefreshroastedpistachios,apanelof8trainedassessors
evaluated the global odour for each particular case. Firstly, panellists were familiarized with the
roasted pistachio aroma and were then asked to agree in a common list of 6 descriptors: green,
sweet,roasted,chocolate/coffee,rancidandnutty(thislastwasevaluatedasaglobalimpression).

Then,assessorswereaskedtoratetheintensityonadiscontinuousscalefrom0(nosimilarity)to5
(equal) for the 6 descriptors above specified. The coefficients of variance found for each single
panellistfordifferentreplicatesofonesamplewere<10%.

3.RESULTSANDDISCUSSION

3.1.OptimizationofDSEparameters

Taking into account that the aim of this study was to extract the odorant compounds of the
pistachio samples, when optimizing the parameters that affected the extraction equilibrium we
evaluatednotonlythechromatographicareasofthecompoundsextracted(FIDresponse),butalso
the number and intensity of the odorants perceived (GCO response). All the experiments were
performedintriplicate.

Amongthedifferentsolventsusuallyusedtoextractfoododorantswetesteddiethylether,hexane
and dichloromethane. The results showed that the best efficiency was obtained when using
dichloromethanebecausehexaneresultedinvolatileslossesduetoitshighboilingpointanddiethyl
ether gave a poorer chromatographic response (nearly 9% smaller than the one obtained when
using dichloromethane). Once the solvent was chosen, it was necessary to determine the volume
requiredtogetthemaximumextractionefficiency.Nevertheless,thisparameteriscloselyrelatedto
thesampleamountusedso,thesampleweight/solventvolumeratiowasoptimized.Withthisaim,
different ratios (from 1:1 to 1:4) were tested by varying both parameters: sample weight ranged
from 50 to 200 g and solvent volume ranged from 50 to 200 mL. The best results, both
chromatographic and olfactometric, were obtained for the 1:1 ratio. To make easier the sample
handling, mainly during the filtration process, we choose as the optimal values 100 g of finely
groundroastedpistachiosextractedwith100mLofdichloromethane.

Regarding to extraction time and temperature, both parameters were studied simultaneously as
theyarestronglyinfluencedonebytheother[34].Todeterminetheoptimumsamplingconditions,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
218 JournalofChromatographyA(2010)

different experiments were carried out for 2.5, 5 and 7.5 hours, at 0 C and 25 C. Higher
temperatures were not evaluated since it could imply losses of some aromatic compounds. The
resultsshowedthat,whatevertheextractiontime,theefficiencydecreasedatlowertemperature.
Withregardtosamplingtime,theshortestoneresultedinapoorerchromatographicprofile,while
thelargestonedidnotimprovesignificantly(lessthan5%)theextractionyieldcomparedtothatof
5hours.

Therefore,theoptimumDSEresultswereobtainedwhen100goffinelygroundroastedpistachios
wereextractedfor5hoursat25Cwith100mLofdichloromethane.

3.2.OptimizationofHSSPMEparameters

Althoughthereproducibilityoffibreshasconsiderablybeenimprovedduringthelastyears,weused
morethanoneinordertotakeintoaccountthevariabilityresponseamongthem.

Toselectthebestconditions,weevaluatedbothchromatographicareasandnumberandintensity
ofodorantsextracted,intriplicate,aswasdoneintheprevioussection.

ThechoiceoftheSPMEfibrecoatingwasthefirstparameterconsidered.Thecoatingscheckedare
listedinsection2.3.Theresultsshowedthat,whereaswithPDMS,PDAorCARPDMSthenumberof
odorantregionswasbetween40and45forthefirsttwofibresandbetween60and65forthethird
one,whenusingDVB/CAR/PDMSupto75odorantsweredetected.Thus,thislastfibrewasselected
astheoptimumfortheextraction.

Another important issue that had to be considered was whether adding a solvent to ground
pistachios (solid sample) could improve the SPME extraction. Although different solvents and
mixturesweretested,theresultsshowedthattheuseoforganicsolventsimpliedacompetencein
the extraction process, so we decided to work only with MilliQ water to homogenize the sample
andacceleratetheextraction[35].

The sample/headspace ratio was the next parameter studied, because it is well known that the
headspacevolumeaffectstheextractionefficiency[36].Thus,weaddeddifferentwatervolumesto
pistachiosamplestoreach5and10mLin20mLvials,and25mLin50mLvials.Thebestresponse
wasobtainedwhentheexperimentswerecarriedoutwith25mLofthesample+watermixtureina
50mLvial.

Related to ionic strength it is known that thehigher the ionic strength, the lower the solubility of
neutralmoleculesinthewaterandthelesslikelythesemoleculesaretopassfromthesolidmatrix


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 219

tothewater.Asaresult, theextractionefficiencyofthesemoleculesdecreases[35].Wechecked
whethertheadditionofsalthadanyinfluenceontheextractionoftheodouractivecompoundsand
theresultscorroboratedthisnegativeeffectformostofthecompoundsofinterest.Consequently
wedecidedtoavoidthesaltadditiontothesamples.

Extractiontimeandtemperaturewereagainsimultaneouslystudied,sodifferentexperimentswere
performedintherangefrom2to4h(shortertimesdidnotensurethesuitablearomaticperception
ofallthecompounds)andfrom30to50C.Theresultsshowedthatthepoorestchromatographic
and olfactometric responses were obtained when working at the lowest temperature and the
shortestsamplingtime(2h,30C).However,asthemicroextractionisanexothermicprocess,the
highest temperatures and the largest times (4 h, 50 C) did not improved the overall extraction
efficiency. Therefore, taking into account that the chromatographic and olfactometric profiles
obtainedat2h,50Cwerenotsignificantlydifferent(<5%)totheonesobtainedat3h,40C,we
decidedtoemploytheshortestextractiontime(2h,50C)tomakefasterthesamplepreparation.

Hence,theoptimalconditionsforHSSPMEwereachievedbymixing15goffinelygroundpistachios
with15mLofMilliQwater(theseamountsofsample+waterimplyavolumeof25mL)intoa50mL
vialwithalittlemagneticstirbarandextractingfor2hoursat50C.

3.3.Precisionofthedevelopedmethods

Once the optimum conditions were determined, we evaluated the precision of both methods in
terms of withinday repeatability and betweendays repeatability (intermediate precision) of the
chromatographicareas.Sincethechromatogramprofilesobtainedwereveryrichbutverydifferent
dependingontheextractiontechniqueemployed(Figure1),tosuitablyevaluatetheseperformance
parameters, we selected 13 chromatographic peaks which were positively identified by both
techniquesaccordingtothefollowingcriteria:theyshouldpresentdifferentretentiontimesalong
the entire chromatogram; they should cover the range of widths and heights of the whole of the
chromatographicpeaks;theyshouldcorrespondtoaromaticcompoundswithdifferentcontribution
tothearoma(i.e.differentFD);andtheyshouldbelongtodifferentchemicalfamilies.

Both precision parameters were expressed by means of the percentage of relative standard
deviation (%RSD). The repeatability was calculated by injecting, consecutively, 5 different extracts
obtained the same day while the intermediate precision was calculated from the results acquired
wheninjecting6differentextractsobtainedoveramonth(approximatelyoneextracteveryweek).
Table 1 shows the results obtained for the compounds selected. The low %RSD values for both


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
220 JournalofChromatographyA(2010)

parametersandbothtechniquesallowedustoconfirmthattheaccuracyoftheoptimizedmethods
was very good. However, for almost all the chromatographic peaks, the RSD values (both for
repeatabilityandintermediateprecision)obtainedwhenworkingwithHSSPMEweresmallerthan
theonesobtainedwhenworkingwithDSEHVT.Therefore,althoughinsomecasesthe%RSDvalues
obtained with each one of the techniques were not statistically different, the fact that the SPME
technique always presented lower RSD values allows us to conclude that the SPME technique
providedbetteraccuracy.

a
pA

100

80

60

40

20

0
0 10 20 30 40 min
b
pA

100

80

60

40

20

0
0 10 20 30 40 min

Figure 1. Chromatograms belonging to the extract of roasted pistachio obtained in the GCFID (a) with
DSEHVT techniqueand (b)withHSSPME technique. The chromatogramswere achievedbyusing aCP
WAX57CBcolumnandwithoutsplittingtothesniffingport.

3.4.DSEHVTversusHSSPME

AsshowninFigure1,theGCFIDchromatogrambelongingtotheextractobtainedbyapplicationof
DSEHVT presents more and higher peaks than the one obtained by application of HSSPME. This
greater response is due to the fact that, whereas the headspace technique only allows the
extraction of those actually volatile compounds, when using DSE, any compound that exhibits
affinitytothesolventemployedwillbeextracted.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 221

However,whentheextractsobtainedwithbothtechniqueswereanalysedbygaschromatography
olfactometry,theresultswereverysimilar:75and74differentodouractiveregionsweredetected
for the DSEHVT and the HSSPME techniques, respectively. Moreover, most of these regions
coincidedinbothcasesintheirretentiontimesandthedescriptorsemployedtodefinetheodours
perceived.Inthatway,asusuallyinthiskindofflavourstudies[5,6,27],whenusingapolarcolumn,
fruityandchemicalnoteswereperceivedatlowerretentionindices,followedbygreenandearthy
notes.Attheendoftheanalysis,lacticandfattyodours,followedbyburnedandcaramelizedones
were detected. Therefore, this comparison shows that, although DSEHVT technique allows the
extractionofahighernumberofcompounds,whenwefocusonlyontheextractionofodouractive
compounds,thesearealmostthesameonesregardlessoftheextractiontechniqueemployed.The
differenceliesintheperceptionintensityofsomeofthesecompounds(i.e.differentflavourdilution
(FD)factors).

DSEHVT HSSPME
Retention Meanof Meanof
time(min) Compound area %RSDrep. %RSDint.pr. area %RSDrep. %RSDint.pr.
7.8 Isobutanal 69382 2.4 4.6 793788 2.4 5.0
9.5 Diacetyl 672958 2.0 5.2 44691 2.2 4.3
11 2,3pentanedione 699943 4.9 8.9 126680 3.4 4.7
11.9 Hexanal 3278534 6.5 8.6 563835 3.1 4.1
13.2 (E)2pentenal 452619 4.7 6.1 75525 2.1 4.6
15.3 2/3methyl1butanol* 6190691 5.1 9.6 469958 3.9 6.2
18.9 2ethylpyrazine 1827142 6.9 10.5 934466 2.6 4.8
19.9 Dimethyltrisulfide 44293 5.9 9.8 11267 3.3 6.7
20.3 2ethyl5methylpyrazine 5587016 6.3 7.4 2647486 3.0 5.3
23 2acetylfuran 383012 5.1 8.3 177382 2.5 6.1
31.1 Guaiacol 89875 4.8 7.7 34539 3.2 4.9
32.3 2phenylethanol 1808021 5.2 9.5 876731 2.8 4.6
35.4 Furaneol 174012 6.1 10.3 529962 3.2 6.4
%RSDrep.: relativestandarddeviationoftherepeatability
%RSDint.pr.: relativestandarddeviationoftheintermediateprecision
* CompoundwithFD16,soitdoesnotappearinTable2

Table1.Valuesofrepeatabilityandintermediateprecisionfortheselectedcompoundsexpressedbymeansof
thepercentageofrelativestandarddeviation(%RSD).

By applying the suitable AEDA for each extraction technique, the most odouractive regions were
determined:thesearetheoneswithhigherFDfactors(rangingfrom64to1024foratleastoneof
thetwoextractiontechniques).TheresultsaresummarizedinTable2,wherethedifferentodours
perceived have been arranged following their retention indices in the polar column. It should be

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
222 JournalofChromatographyA(2010)

notedthat,althougheacharomaperceivedismostlyduetoasinglecompound,amongthedifferent
odouractiveregionsdetectedinbothextracts,wefound3odoursthatwereoriginatedbyamixture
ofsomecompounds.Thisisthecaseoftheflavouractiveregionsnumber15(roastednut,corn),21
(cookedpotato)and24(fatty,greenlike),thathavebeenpositivelyidentifiedasamixtureof2,3
dimethylpyrazine, 2,6dimethylpyrazine and 2ethylpyrazine (region 15), a mixture of 3ethyl2,5
dimethylpyrazine,2ethyl3,5(or6)dimethylpyrazineandmethional(region21),andamixtureof2
acetylfuran,3,5diethyl2methylpyrazineand2,3diethyl5methylpyrazine(region24).

AsshowninTable2,34and45flavouractiveregionswithaFD64weredetectedwhenusingDSE
HVT and HSSPME, respectively. As it can be seen, not always a high FD value obtained when
workingwithanextractiontechniqueimpliesahighFDvaluewhenworkingwiththeotherone.In
fact, only 15 of these regions were perceived with the same FD in both extracts, being 1024 the
highestFDfactor,whichwasfoundfortheodorantregionsnumber2,13,15,19,22and42.After
these mainly toasted, heavy and rubbery notes, and in descending order of FD, we found other
odorant regions with a coincident FD in both extracts: 6 regions with a FD of 256 that mainly
providedfruity,earthyandgreennotes(regions5,11,14,18,25and29)and3withaFDof64that
contributetothearomaextractswithbuttery,fruityandflowerynotes(regions7,10and38).

However,therearealsosomedifferencesbetweentheresultsobtainedfromthedistillateandthe
onesfromtheSPMEthatgiveevidenceofthedifferentextractionandconcentrationeffectiveness
ofbothtechniques.Ononehand,5odouractiveregionsweredetectedontheSPMEextractbutnot
onthedistillate:20(mushroom),23(aniselike,fennel),26(roastednuts,popcorn),28(vomit,lactic)
and 44 (stall, animal), which correspond to two unknown odorants (regions 20 and 23) plus 2
acetylpyridine(region26),butyricacid(region28)and4ethylphenol(region44).Ontheotherhand,
while 19 flavouractive regions were perceived in the SPME with a higher FD factor than in the
distillate,only6odoursappearedinthedistillatewithahigherFDfactor:1(malty,solventlike),3
(fruity, strawberry), 17 (sulphurlike), 21 (cooked potato), 31 (blue cheese, sweaty) and 32 (deep
fried), which have been positively identified as isobutanal (region 1), ethyl propanoate (region 3),
dimethyltrisulfide (region 17), a mixture of 3ethyl2,5dimethylpyrazine, 2ethyl3,5(or 6)
dimethylpyrazine and methional (region 21), 2 and 3methylbutyric acid (region 31) and (E,E)2,4
decadienal(region32).

Fromalltheseresultsitseemsthat,althoughDSEcouldextractcompoundswithhighermolecular
weight and lower volatility than the HSSPME [37] it is less sensitive to some trace components,
which are very important in the flavour perception of foodstuffs. Nevertheless, working with the
distillatehassomeadvantagesbecausealiquidextractisobtainedso,unlikewhenworkingwiththe


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 223

SPME,thesamesamplecanbetestedmanytimesanditcanbeconcentratedtodifferentdegreesto
achievemorechromatographicorolfactometricresponse.Ontheotherhand,theSPMEtechnique
showsseveraladvantages:simplicity,rapidityandcleanliness,asitissolventfreeandinvolvesvery
littlesamplemanipulation.

However, the aroma representativeness of the sample extract is the crucial parameter to decide
which extraction technique is the most appropriate. So, to determine the similarity between the
aromaofthedifferentextractsobtainedandthearomaofthefreshroastedpistachios,apanelof8
trained assessors evaluated the global odour for each particular case by using the selected
descriptors: green, sweet, roasted, chocolate/coffee, rancid and nutty. For the DSEHVT extract,
similaritytestswereperformedbyplacingadropofitonaperfumesamplingpaperandcomparing
thearomaperceivedwiththeoriginalroastedpistachioodourasapair.

TocheckthearomasimilaritybetweentheSPMEextractsandtheroastedpistachionutsweused
the direct gas chromatographyolfactometry technique (DGCO) [38]. Since a short deactivated
capillary column is used, this technique avoids chromatographic separation of flavour volatiles, so
the analyst perceives the extract as a global odour. In this case, the aroma detected is also
comparedwiththeoriginalroastedpistachiooneasapair.

Nutty
5
4
3
Rancid Green
2
1
0

Chocolate /coffee Sweet

Roasted

freshly roasted pistachio HS-SPME DSE-HVT


Figure2.OdourprofilesoffreshlyroastedpistachioanditsaromaticextractsobtainedbyDSEHVTandHSSPME.

TheresultsareshowninFigure2.Asitcanbe seen,bothextractsgavesimilar intensityvaluesof


roasted, green and coffee to the natural roasted pistachio. However, when dealing with DSEHVT,
thedescriptorrancidwasperceivedwithahigherintensity.Thisbehaviourcanbeduetothefact


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
224 JournalofChromatographyA(2010)

that,althoughthepanellistsspentsomesecondsbeforesniffingthedropofextractplacedonthe
perfume sampling paper to eliminate the solvent by evaporation, this solvent note persisted.
Regarding to the HSSPME technique, all the panellists agreed with the good correlation between
theextractaromaandtherealsampleexceptontheperceptionofanintenseplasticnoteonthe
SPMEextract(inFigure2thisdescriptordoesnotappearbecausethisisnotadescriptorofpistachio
aroma). This fact was because of the high affinity of the fibres used for the sulphur compounds
which give this kind of aromas [39]. These low differences observed in the spiderweb diagram
betweentherealpistachiosamplesandbothkindofextractswerecorroboratedwhenthepanellists
wereaskedaboutthedegreeofsimilitudeoftheextractstotherealsample:thevaluesobtained
were7580%oflikenessinbothcases.

4.CONCLUSIONS

In conclusion, although the DSE followed by HVT has proved to be a good technique to analyse
pistachio aroma as well as other food aroma, the results show that the HSSPME is a good
alternativetoobtainrepresentativepistachioaromaextractswithawiderangeofodorants,suitable
forGCO,andthatrequiresshortertimeforsampling.Althoughbothextractiontechniquesprovide
accurate information about the volatile fraction that will be perceived by the consumer, HSSPME
hasdemonstratedtobeabletoextractmoreodouractiveregionsthatcanbedetecteduntilhigher
flavourdilutionfactors.Moreover,andthankstotheapproachtotheAEDAemployed,ithasbeen
possibletoestablishaninitialhierarchyonthecontributionofeachcompoundtoroastedpistachio
aromaandthereconstitutionstudieswouldbethenextstep.

Acknowledgments
ThisstudywassupportedbytheSpanishMinistryofScienceandTechnology(projectAGL200761550)and
also by the Ingenio 2010 program from the Spanish Ministry of Industry in a CENIT project called MET
DEVFUN and by the leader company of the project consortium, La Morella Nuts S.A. (Reus, Catalonia,
Spain).



Laura Acea Muoz

Table2.MainodorantsfoundinroastedpistachionutswithFD64atleastinoneofthetwoextractiontechniques.

RIon FDfactor identification


Odour MSD
active DSE HS
UNIVERSITAT ROVIRA I VIRGILI

regions RT(min) CPWAX HP5 odourdescription DSEHVT HSSPME compound CASno. HVT SPME RI odour
1 7.8 a a Malty,solventlike 1024 256 Isobutanal 78842 X X X X
ISBN:9788469432341/DL:T. 1040-2011

1024 1024 96173 X X X X


2 8.6 936 a Malty,bitteralmonds 2/3methylbutanal
1024 1024 590863 X X X X
3 9.4 958 nd Fruity,strawberry 256 64 Ethylpropanoate 105373 X X X
4 9.5 968 b Butter 256 1024 Diacetyl 431038 X X X X
5 10.2 1005 773 Strawberry 256 256 2methylpropylacetate 110190 X X
6 10.9 1031 801 Fruity 64 256 Ethylbutyrate 105544 X X
7 11 1041 702 Butter 64 64 2,3pentanedione 600146 X X X X
8 11.2 1044 843 Fruity,apple 256 1024 Ethyl2methylbutyrate 7452791 X X X
9 11.9 1071 794 Green,grass 64 1024 Hexanal 66251 X X X X
10 13.2 1122 753 Fruity 64 64 (E)2pentenal 1576870 X X X X
11 16 1226 896 Fishy 256 256 (Z)4heptenal 6728310 X X
12 16.3 1233 Earthy 16 1024 unknown
13 17.4 1275 1001 Citrus,fresh 1024 1024 Octanal 124130 X X
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

14 17.7 1284 975 Mushroom 256 256 1octen3one 4312996 X X X X


nd 1024 1024 2,3dimethylpyrazine 5910894 X X X X
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

15 18.9 1327 923 Roastednuts,corn 1024 1024 2,6dimethylpyrazine 108509 X X X X


920 1024 1024 2ethylpyrazine 13925003 X X X X
16 19.5 1350 Geranium 4 256 unknown
17 19.9 1366 965 Sulphurlike 1024 256 Dimethyltrisulfide 3658808 X X X X
18 20.3 1381 997 Fruity,strawberry 256 256 2ethyl5methylpyrazine 13360640 X X X X
19 21 1410 Rubber,plastic 1024 1024 unknown
20 21.2 1429 nd Mushroom nd 1024 1octen3ol 3391864 X X X



Laura Acea Muoz


1077 1024 256 3ethyl2,5dimethylpyrazine 13360651 X X X c
21 21.7 1439 1085 Cookedpotato 1024 256 2ethyl3,5(or6)dimethylpyrazine 55031157 X X X X
907 1024 256 Methional 3268493 X X
UNIVERSITAT ROVIRA I VIRGILI

22 22.5 1467 Rubber,sulphurlike 1024 1024 unknown


23 22.7 1469 Aniselike,fennel nd 1024 unknown
ISBN:9788469432341/DL:T. 1040-2011

nd 64 256 2acetylfuran 1192627 X X X X


24 23 1487 1170 Fatty,greenlike 64 256 3,5diethyl2methylpyrazine 18138051 X X X c
1150 64 256 2,3diethyl5methylpyrazine 18138040 X X X X
25 23.7 1521 1160 Paperlike 256 256 (E)2nonenal 18829566 X X X X
26 24.4 1573 1026 Roastednuts,popcorn nd 256 2acetylpyridine 1122629 X X X
27 25.1 1584 Aniselike 16 1024 unknown
28 25.5 1604 nd Vomit,lactic nd 1024 Butyricacid 107926 X X
29 26 1621 Greenpepper,earthy 256 256 unknown
30 26.5 1649 1043 Greenroses 16 1024 Phenylethanal 122781 X X X
1024 256 116530 X X
31 26.8 1659 879 Bluecheese,sweaty 2/3methylbutyricacid
1024 256 503742 X X
32 27.7 1694 1324 Deepfried 256 64 (E,E)2,4decadienal 25152845 X X
33 29.1 1761 1098 Roastednuts 64 1024 2acetyl2thiazoline 29926418 X X
34 30 1805 nd Fatty,flowery 64 256 Methyllaurate 111820 X X
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

35 30.4 1824 1383 Sweet,peachjam 256 1024 damascenone 23726934 X X


36 31.1 1861 1093 Smoky 256 1024 Guaiacol 90051 X X X X
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

37 31.4 1872 1039 Roasted,sweety 64 256 Phenylmethanol 100516 X X X X


38 32.3 1916 1119 Roses 64 64 2phenylethanol 60128 X X X X
39 33.5 1981 Roasted,burnt 4 1024 unknown
40 33.9 2006 1387 Metallic 64 256 trans4,5epoxy(E)2decenal 134454312 X X
41 35.1 2063 1284 Disgusting,animal 64 1024 Octanoicacid 124072 X X
42 35.4 2080 nd Caramel 1024 1024 Furaneol 3658773 X X X X



Laura Acea Muoz

43 35.5 2085 nd Peeodour 64 256 mcresol 108394 X X X X


44 37 2201 nd Stall,animal nd 256 4ethylphenol 123079 X X
45 37.6 2215 1332 Smoky,sweet 4 256 4vinylguaiacol 7786610 X X X
RI:Retentionindexondifferentstationaryphases
UNIVERSITAT ROVIRA I VIRGILI

FD:Factorofdilution
nd:notdetected
a:RInotcalculatedduetothesolventinterference
ISBN:9788469432341/DL:T. 1040-2011

b:RI<RIofthefirstalkane(C6)
c:standardnotavailable


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
228 JournalofChromatographyA(2010)

REFERENCES

[1] A.H.Ensminger,M.E.Ensminger,J.E.Konlande,J.R.K.Robson,Foods&NutritionEncyclopedia,
CRCPress,BocaRaton,1994,pp.1619.
[2] M.Venkatachalam,S.K.Sathe,J.Agric.FoodChem.54(2006)4705.
[3] C.Alasalvar,F.Shahidi,K.R.Cadwallader,J.Agric.FoodChem.51(2003)5067.
[4] G.L.Baker,J.A.Cornell,D.W.Gorbet,S.F.OKeefe,C.A.Sims,S.T.Talcott,J.FoodSci.68(2003)
394.
[5] I.Chetschik,M.Granvogl,P.Schieberle,J.Agric.FoodChem.56(2008)10237.
[6] A.BurdackFreitag,P.Schieberle,J.Agric.FoodChem.58(2010)6351.
[7] P.M.KrisEtherton,G.Zhao,A.E.Binkoski,S.M.Coval,T.D.Etherton,Nutr.Rev.59(2001)103.
[8] E.Ros,J.Mataix,Br.J.Nutr.96(2006)S29.
[9] M.Kornsteiner,K.H.Wagner,I.Elmadfa,FoodChem.98(2006)381.
[10] E.Kkner,B.Yurt,Eur.FoodRes.Technol.217(2003)308.
[11] J.Birch,K.Yap,P.Silcock,Int.J.FoodSci.Technol.45(2010)81.
[12] A..Kksal,N.Artik,A.imek,N.Gne,FoodChem.99(2006)509.
[13] J.S.Elmore,I.Nisyrios,D.S.Mottram,FlavourFragr.J.20(2005)501.
[14] C.Alasalvar,A.Z.Odabasi,N.Demir,M..Balaban,F.Shahidi,K.R.Cadwallader,J.FoodSci.69
(2004)99.
[15] S.Krist,H.Unterweger,F.Bandion,Eur.FoodRes.Technol.219(2004)470.
[16] H.D.Belitz,W.Grosch,P.Schieberle,FoodChemistry,Springer,Berlin,2004,pp.342.
[17] A. Holley, in: A. Voilley, P. Etivant (Eds.), Flavour in Food, Woodhead Publishing Limited,
Cambridge,2006,pp.36.
[18] B.A.Zellner,P.Dugo,G.Dugo,L.Mondello,J.Chromatogr.A1186(2008)123.
[19] A.R. Mayol, T.E. Acree, in: J.V. Leland, P. Schieberle, A. Buettner, T.E. Acree (Eds.), Gas
ChromatographyOlfactometry.TheStateoftheArt,ACSSymposiumSeries,WashingtonD.C.,
2001,pp.1.
[20] F.Ullrich,W.Grosch,Z.Lebensm.Unters.Forsch.184(1987)277.
[21] P.Schieberle,W.Grosch,Z.Lebensm.Unters.Forsch.185(1987)111.
[22] S.M.vanRuth,Biomol.Eng.17(2001)121.
[23] T.H.Parliament,in:R.Marsilli(Ed.),TechniquesforAnalyzingFoodAroma,MarcelDekker,Inc.,
NewYork,1997,pp.1.
[24] T.P.Wampler,in:R.Marsilli(Ed.),TechniquesforAnalyzingFoodAroma,MarcelDekker,Inc.,
NewYork,1997,pp.27.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
HSSPMEvsDSEHVTtoobtainrepresentativearomaextracts 229

[25] A.D.Harmon,in:R.Marsilli(Ed.),TechniquesforAnalyzingFoodAroma,MarcelDekker,Inc.,
NewYork,1997,pp.81.
[26] W. Grosch, in: L.M.L. Nollet (Ed), Handbook of Food Analysis. Physical Characterization and
NutrientAnalysis,MarcelDekker,Inc.,NewYork,2004,pp.717.
[27] M.P.Mart,M.Mestres,C.Sala,O.Busto,J.Guasch,J.Agric.FoodChem.51(2003)7861.
[28] V.Ferreira,R.Lpez,A.Escudero,J.F.Cacho,J.Chromatogr.A806(1998)349.
[29] C.Priser,P.X.Etivant,S.Nicklaus,O.Brun,J.Agric.FoodChem.45(1997)3511.
[30] F.SanJuan,J.Petka,J.Cacho,V.Ferreira,A.Escudero,FoodChem.123(2010)188.
[31] A.Sen,G.Laskawy,P.Schieberle,W.Grosch,J.Agric.FoodChem.39(1991)757.
[32] C.L.Arthur,J.Pawliszyn,Anal.Chem.62(1990)2145.
[33] P. Schieberle, in: A.G. Goankar (Ed.), Characterization of Food: Emerging Methods, Elsevier
Science,Amsterdam,1995;pp.403.
[34] H.Kataoka,H.L.Lord,J.Pawliszyn,J.Chromatogr.A880(2000)35.
[35] M.Riu,M.Mestres,O.Busto,J.Guasch,J.Chromatogr.A1107(2006)240.
[36] J. Pawliszyn, Solid Phase Microextraction: Theory and Practice, WileyVCH, Inc., New York,
1997.
[37] J.Cai,B.Liu,Q.Su,J.Chromatogr.A930(2001)1.
[38] B.Rega,N.Fournier,E.Guichard,J.Agric.FoodChem.51(2003)7092.
[39] M.Mestres,O.Busto,J.Guasch,J.Chromatogr.A945(2002)211.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

Determinationofroastedpistachios(PistaciaveraL.)keyodorants
byheadspacesolidphasemicroextractionand
gaschromatographyolfactometry

JournalofAgriculturalandFoodChemistry(2011)
DOI:10.1021/jf104496u


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

DeterminationofRoastedPistachios(PistachiaveraL.)KeyOdorantsbyHeadspace
SolidPhaseMicroextractionandGasChromatographyOlfactometry

LauraAcea,LucianoVera,JosepGuasch,OlgaBusto,MontserratMestres

ResearchGroupofAnalyticalChemistryofWineandFood
DepartmentofAnalyticalChemistryandOrganicChemistry
CampusSescelades.FacultatdEnologiadeTarragona
UniversitatRoviraiVirgili.43007Tarragona(Spain)

ABSTRACT

Key odorants in roasted pistachio nuts have been determined for the first time. Two different
pistachiovarieties(FandooghiandKerman)havebeenanalyzedbymeansofheadspacesolidphase
microextraction(HSSPME)andgaschromatographyolfactometry(GCO).Thearomaextractdilution
analyses (AEDA) applied have revealed 46 and 41 odoractive regions with a flavor dilution (FD)
factor64fortheFandooghiandtheKermanvarieties,respectively,and39ofthemwererelatedto
precisely identified compounds. These included esters, pyrazines, aldehydes, acids, furans and
phenols.TheresultsshowthattheFandooghivarietypresents,notonlymoreodoractiveregions,
but also higher FD factors than the Kerman variety, that can lead to the conclusion that the first
variety has a richer aromatic profile than the second one. The descriptive sensory analysis (DSA)
showed that the roasted, chocolate/coffee and nutty attributes were rated significantly higher in
Fandooghivariety,whereasthegreenattributewassignificantlyhigherintheKermanone.

KEYWORDS:Pistachioaroma;keyodorants;GCO;HSSPME;Fandooghivariety;Kermanvariety


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
234 JournalofAgriculturalandFoodChemistry(2011)

1.INTRODUCTION

Amongalltheediblenuts,peanuts,almonds,hazelnuts,pecans,pinenuts,macadamias,pistachios
andwalnutsarethemostpopularandcommerciallyvaluable.Theyhavebeenanimportantsource
of nutrients (1, 2) since ancient times and it has been proved that they play a relevant role on
humandietandmoreover,thattheyareofgreatbenefittoconsumershealth(3,4).Nowadays,a
minorpartofthenutcropisconsumednaturalorraw,whilethemajorityisroastedandfinallyused
as a snack or as an ingredient in the food industry. Several studies have been published on their
chemical(1,2,57)and,formostofthem,volatilecomposition(810)forbothrawandroastednuts,
althoughitmustbesaidthatrawnutshavearatherblandaroma.Theircharacteristicnutodoris
mainlyduetosomecompoundsgeneratedduringtheroastingprocess(1114).

Pistachio(PistaciaveraL.)isamemberoftheAnacardiaceaefamily,theonlypistachiospeciesthat
providesediblenuts.ItisnativeofaridzonesofCentralandWestAsia,whereitisdistributedaswell
asthroughouttheMediterraneanbasin(15),andtheIslamicRepublicofIranisthemajorsupplierin
theworldwithanannualproductionof230000tin2007,followedbyTurkeyandtheUnitedStates
ofAmerica(http://www.fao.org/corp/statistics/en).

Somestudieshavebeenpublishedonthepistachiochemicalcomposition(6,16)anditsantifungal
(17),antimicrobial(18)andantioxidant(19)activities;moreover,differentstudieshavebeencarried
out to determine its geographical origin and the variety effects (2022). Nevertheless, only two
previous studies have been published about its volatile composition (23, 24), although only the
lateststudyconsideredthecontributionofthesecompoundstothearoma.Thiskindofstudiesare
very important because, as in any other food product, pistachio quality is closely related to the
aroma detected by consumers and this attribute will have a great influence on its acceptance or
rejection.

Thecharacteristicanduniquearomaofeveryfoodcommodityisattributedtoacomplexmixtureof
hundreds of different and very heterogeneous chemicals (alcohols, aldehydes, esters, ketones,
pyrazines,acids,terpenes,etc.),presentatvariableconcentrations(rangingfromseveralmgkg1to
1
afewngkg )andeachoneofthemwithitsownchemicalpropertiesandadifferentcontributionto
thewholearoma(25).Indeed,itiswellknownthat,althoughtheodorantsmustbevolatiletoreach
thenoseandinteractwiththeappropriatereceptorslocatedontheolfactoryepithelium(26),onlya
limitednumberofvolatileshaveanactualcontributiontotheoverallaroma.

For assessing the odoractive compounds in complex mixtures such as foods, gas chromatography
olfactometry(GCO)isthemostappropriateanalyticaltoolasitallowsperceivingtheelutedanalytes


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 235

by a conventional detector (FID, MSD) and the human nose, simultaneously. As a result, GCO
providesbothinstrumentalandsensoryresults(27,28).

DifferenttechniqueshavebeendevelopedtocollectandprocesstheGCOdataobtainedinorderto
evaluate the contribution of each odorant to the sample aroma. Among them, the aroma extract
dilution analysis (AEDA) is one of the most used (29, 30). AEDA involves stepwise dilution of the
aromaextractfollowedbyanevaluationofeachdilutionbyGCOuntilnoodorsareperceivedinthe
GCOeffluent,sothelastdilutionstepwhereanodorantisperceivedisitsflavordilution(FD)factor,
whichcanbeconsideredagoodindicatoroftheodorpotencyofthatcompound.ThismakesAEDAa
verysuitableandvaluablescreeningtoolforrankingodoractivecompoundsinasampleaccording
totheirrelativeodorpotency.

However,andpriortotheGCOanalysis,arepresentativearomaticextracthastobeobtainedtoget
areliablearomacharacterization.Indeed,thefoodflavorprofileobtainedwill stronglydependon
theisolationprocedureperformed.Amongallthesamplingtechniques,theheadspacesolidphase
microextraction(HSSPME)hasprovedtobeaquick,solventfreeandaquitesimpletechniquethat
requires very little sample manipulation (31), also when applied on the analysis of food aroma
compounds(32).

Therefore, the aim of this study is to characterize the roasted pistachio nut aroma by GCO and
employingtheHSSPMEtechniquewhich,inapreviousstudyperformedinourlaboratory(24),has
already demonstrated to be suitable for providing representative pistachio aroma extracts. By
application of the AEDA, the most potent odorants present in two of the most popular pistachio
varieties(FandooghiandKerman)havebeenanalyzedandcompared.

2.MATERIALSANDMETHODS

2.1.Samples

Representative samples of the Fandooghi (Iran) and Kerman (Spain) varieties were supplied
fromanimportantnutprocessingcompanywhosequalitycontrolensuretheaccomplishmentofthe
specificationsofeachoneofthevarietiesprocessedandalsothatthesampleshavebeencollected
and transported under the optimal conditions. Moreover, to take into account the sample
variability,differentbatchesofpistachiosweresampledandthesedifferentaliquotsweremixedin
ordertogetasinglesampleasrepresentativeaspossible.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
236 JournalofAgriculturalandFoodChemistry(2011)

Togetsimilarproductsthanthoseobtainedinanindustrialroastingtreatment,forbothvarieties,
portions of 1 kg of shellfree samples were roasted for 20 min at 160 C in a laboratory electrical
oven. After being roasted, the pistachio samples were vacuumpacked in 100 g portions into non
permeablepolypropylene/aluminum/polyethylenebagsandstoredatroomtemperatureuntilused
foranalysis.

2.2.Reagentsandchemicals

The chemical standards of the aroma compounds were supplied by SigmaAldrich (Madrid, Spain)
and Lancaster (Bischheim, France) and their purity was above 90% in all cases. Pure water was
obtainedfromaMilliQpurificationsystem(Millipore,Bedford,MA,USA).Theoilusedtodetermine
theodorthresholdswasadeodorizedanddistillatevacuumpumpoilforresearchapplications.

2.3.Headspacesolidphasemicroextraction(HSSPME)

The SPME holder for manual sampling and the StableFlex DivinylbenzeneCarboxen
Polydimethylsiloxane(DVB/CAR/PDMS)fiberswitha50/30mfilmthicknessusedinthisstudywere
purchasedfromSupelco(Bellefonte,PA,USA).Thefiberswereconditionedbeforeuseandthermally
cleanedbetweenanalysesbyinsertingthemintotheGCinjectorportat270C.

The volatile compounds were extracted according to the optimum conditions determined in a
previous study (24), where the different parameters that influence the HSSPME were carefully
studiedbyassessingboththechromatographicareasandthenumberandintensityoftheodorants
extracted.Thus,15goffreshroastedpistachiosfinelygroundinacoffeemillandpassedthrougha
sieve(1.5mmofdiameter)with15mLofMilliQwater(tohomogenizethesampleandaccelerate
the extraction (24, 33)) and a magnetic stir bar (as the extraction was carried out under constant
magneticstirring)wereplacedintoa50mLglassvial,beingthesample/headspaceratio1:1.Then,
the vial was tightly capped with a silicon septum under nitrogen atmosphere and it was pre
equilibratedfor15minat50Cinathermostaticbath.Afterwards,theSPMEdevicewasmanually
pushedthroughthevialseptumandthefiberwasexposedfor2hours(shortertimesdidnotensure
thesuitablearomaticperceptionofallthecompounds)at50C(highertemperaturesduringsuch
longtimecouldpromotechangesinsamplecomposition)totheheadspacevial.Afterextraction,the
fiberwaspulledintotheneedleassemblyandtheSPMEdevicewasremovedfromthevial.Itwas
finallyinsertedintotheinjectionportoftheGCforthermaldesorptionoftheanalytesat270Cfor
1mininthesplitlessmode.

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 237

The precision of the method was assessed in terms of withinday repeatability and betweendays
repeatability (intermediate precision). These parameters were evaluated not only from the
chromatographic response, but also from the number, intensity and quality of the odorants
perceived. Both parameters were expressed by means of the percentage of relative standard
deviation (%RSD). The first one was calculated by injecting, consecutively, 5 different extracts
obtained the same day while the second one was calculated from the results acquired when
injecting 6 different extracts obtained over a month (approximately one extract every week).The
resultsobtainedwereRSD<4%forrepeatabilityandRSD<7%forintermediateprecision.Theselow
%RSDvaluesallowedustoconfirmthattheprecisionoftheoptimizedHSSPMEtechniquewasvery
good.

2.4.Gaschromatographicanalysis

2.4.1.GCFIDandGCO

The analyses were made on a HewlettPackard (HP, Palo Alto, USA) 6890 gas chromatograph
equipped with a flame ionization detector (FID) and an olfactory detector. Chromatographic
separationswereperformedbyaChrompack(Varian,Middelburg,TheNetherlands)CPWAX57CB
(50mx0.25mmi.d.,0.2mfilmthickness)fusedsilicacapillarycolumnandtheoventemperature
programwas:40C(2min),5Cmin1to220C(22min).Toverifytheidentityofthecompounds,a
HP5(AgilentTechnologies,USA)(30mx0.32mmi.d.,0.25mfilmthickness)fusedsilicacapillary
columnwasemployedwiththefollowingoventemperatures:40C(5min),3.5Cmin1to120C,
1
10Cmin to210C(10min).Inbothcases,thecarriergaswasheliumataconstantflowrateof1
mLmin1,thesplitsplitlessinjectionportoperatedinthesplitlessmodeat270Cfor1minandthe
temperatureoftheFIDwassetat250C.

The GCO analyses were carried out using a splitting assembly based on the Capillary Flow
Technology(AgilentTechnologies,USA),wheretheendofthecapillarycolumnisconnected,which
enablestheeffluenttobesplitintotheFIDandthesniffingport.Thesplitratiofortheolfactometric
analysiswas1:1(FID:sniffingport)anditwasachievedbyemployingtwodeactivatedanduncoated
fusedsilicacapillariesofthesamelengthandwidthasatransferlinebetweenthesplittingassembly
and the detectors. In addition, an olfactory detector control module commercialized by SGE
International(Ringwood,Australia),thatincorporatesaheatedtransfersectionfromtheGCovento
the glass detection cone, keeps the unit at a suitable temperature to transfer the volatile
compoundstothedetectionconewithoutlossesduetocondensation.Furthermore,theglasscone


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
238 JournalofAgriculturalandFoodChemistry(2011)

is purged with humidified air to prevent nasal mucous membranes from drying out in order to
maintainolfactorysensitivity.

Twotrainedsniffers(replacedat15minintervalstoavoidfatigueanddistractions)recordedtiming
anddescriptionoftheodorsperceivedduringtheelutionofthesampleextractcompounds.Every
samplewasanalyzedintriplicate.

2.4.2.GCMS

GCMS analyses were performed with a HewlettPackard (HP, Palo Alto, USA) 6890 gas
chromatographequippedwithanHP5973massselectivedetector(HP,PaloAlto,USA).Separation
wasachievedunderthesameoperatingconditionsdescribedaboveandusingthesamecolumnsas
intheGCFIDandGCOanalyses.Themassspectrometeroperatedintheelectronimpactionization
mode (70 eV). Interface, source and quadrupole temperatures were 200 C, 230 C and 150 C,
respectively,andthemassrangewasfrom35to300amu.Thesplitsplitlessinjectionportoperated
inthesplitlessmodeat270Cfor1min.

2.5.AromaExtractDilutionAnalysis(AEDA)

When working with the SPME, the analytes are retained on the fiber so no physical extract is
obtained. Therefore, the usual AEDA cannot be applied. In this study, the most odoractive
compoundsinroastedpistachioswerehierarchicallyclassifiedbyanapproachtotheAEDA(24,34).
Itconsistedofstepwisereductionoftheamountofroastedpistachio(1:4)thatwasplacedintothe
vialbeforeperformingtheSPMEwhileasuitableamountofMilliQwaterwasaddedineachdilution
tokeepconstanttheheadspace/sampleratio.Thedilutionswerecarriedoutuntilnoodorantwas
detectedbysniffingthehighestdilution.TwotrainedsniffersperformedtheAEDAexperimentsand
theirresponse(sensitivity)totheindividualcompoundsdidnotdiffer,inanycase,bymorethan2
FDfactors.

2.6.Compoundsidentification

Theidentificationoftheodorantsperceivedwasbasedoncomparisonofthreeparametersofthe
unknownodorantswiththoseofthestandardcompoundsanalyzedunderidenticalconditions:odor
quality perceived at the sniffing port, mass spectra obtained and retention indices determined on
the two stationary phases of different polarity employed (CPWAX 57CB and HP5). Retention


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 239

indices were calculated from the retention times of a series of nalkanes (from 6 to 26 carbon
atoms)injectedunderthesamechromatographicconditions.

In some cases, due to the coelution of several compounds with similar aromatic qualities, their
perceptionthresholdconstitutedahelpfultooltodeterminetherealcontributiontothearomatic
regionconsidered.Inthesecases,becauseoftheimportantfattycomponentofthesample,these
thresholds were not determined in water but in a deodorized and distillate vacuum pump oil in
ordertogetasuitablematrix.

2.7.Descriptivesensoryanalysis

Theodorofthetwodifferentvarietiesoffreshroastedpistachiosfinelygroundwasevaluatedbya
panelof8trainednonsmokerassessors(5womenand3men,between25and42yearsold),allof
thembelongingtotheDepartmentofAnalyticalChemistryoftheRoviraiVirgiliUniversity.Togeta
more specific training on the aroma of roasted nuts, panelists were subjected to the following
training: during 10 sessions, each lasting 60 minutes, they evaluated an array of different
commercial roasted edible nuts (hazelnuts, almonds and pistachios), describing samples odor
qualitiesonthebasisoftheirpersonalcriterion.Inthatway,multipleodorqualitieswereachieved
and after an intense discussion, panelists finally agreed on a common list of 8 descriptors for
pistachionuts:green,sweet,roasted,chocolate/coffee,rancid,nutty,fattyandearthy.

Finally,assessorsevaluatedtheodorofthetwodifferentvarietiesofroastedpistachiosanalyzedin
this study on a discontinuous scale from 0 (not detected) to 5 (maximum detection) for the 8
descriptors selected: green, sweet, roasted, chocolate/coffee, rancid, nutty, fatty and earthy.
Samples (20 g of fresh roasted pistachios finely ground) were single presented to the panelists in
dark glass flasks with random coded numbers (each sample was evaluated in triplicate). Sensory
analyseswereperformedinasensorypanelroomat22C2.Thecoefficientsofvarianceofeach
singlepanelistforeverysamplereplicatesofonesamplewerelessthan10%.Toevaluatethepanel
performanceasawhole,onewayanalysisofvariance(ANOVA)wascarriedout.

3.RESULTSANDDISCUSSION

Thesensoryanalysisofthetworoastedpistachiovarietiesrevealedimportantdifferencesforsome
of the descriptors evaluated, as it can be seen in Figure 1. Thus, although both cultivars gave
comparableintensityvalues(=0.05)forthesweet,rancid,fattyandearthydescriptors,theodor


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
240 JournalofAgriculturalandFoodChemistry(2011)

profiles of the two varieties differed significantly ( = 0.05) with regard to the green, roasted,
chocolate/coffee and nutty descriptors: while Kerman variety presented a higher intensity for
green, Fandooghi cultivar presented a higher intensity for roasted, chocolate/coffee and
nutty, descriptors usually associated with the roasted nut odor. Furthermore, the perception of
thesethreedescriptors,especiallyinthisvariety,wassohighthatitdisguisedtherestofattributes.
TheseresultsagreedwiththeonesdescribedinTable1,wherealmostallthedifferentnuttyodors
detectedforthetwopistachiovarietiespresentedahigherFDfactorfortheFandooghi.

Figure1.Odorprofilesoffreshlyroastedpistachios

In the same way, when the Fandooghi variety was analyzed by HSSPME and GCFID, the
chromatographic profile obtained was slightly richer with more and higher peaks than the one
providedbytheKermanvariety.ThismeantthattheFandooghivarietyhadamorecomplexvolatile
compositionthantheKermancultivar,butbothHSSPMEextractswereanalyzedbyGCOtoverifyif
this higher volatile complexity also implied a greater aromatic response. The results of these
analysesconfirmedthattherewasadifferenceinthenumberofodoractiveregionsdetectedwhen
analyzingtheSPMEextractsof bothvarietiesbyGCO:while74differentodoractiveregionswere
perceivedfortheFandooghicultivar,only60wererecordedfortheKermanone.However,nearlyall
these latest 60 odoractive areas coincided both in their retention times and the descriptors
employedtodefinethemwithdifferentflavoractiveregionsdetectedfortheFandooghivariety.In
both cases, and as it happens in similar flavor studies when employing a polar column (12, 14),
chemicalandfruitynoteswereperceivedatlowerretentionindices,followedbygreenandearthy
notes. At theend of the analysis appeared thelactic and fattyodors,followed by the burned and
caramelizedones.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 241

To get a first hierarchical classification of the odorants in roasted pistachio aroma, the volatiles
extractedwereanalyzedbythenewapproachtotheAEDAdeveloped.Theresultsaresummarized
inTable1,wheretheodoractiveareaswithhigherFDfactors(rangingfrom64to1024)havebeen
arrangedfollowingtheirretentionindicesinthepolarcolumn.46and41flavoractiveregionswitha
FD64weredetectedfortheFandooghiandtheKermanvarieties,respectively.Asitcanbeseen,
theactualpotentodorantspresentinpistachioaromaarealmostthesame,whateverthepistachio
varietyanalyzed.Themaindifferencewithregardtotheodorantsliesintheperceptionintensityof
someofthesecompounds,asahighFDfactorobtainedforavarietydoesnotimplyahighFDvalue
fortheothercultivar.Indeed,onlyeighteenflavoractiveregionsweredetectedwiththesameFD
factorforthetwovarieties:eightregionswiththeFDof1024andtenwiththeFDof256,whileno
coincidencebetweenthecultivarswasfoundfortheFDof64.TheeightodoractiveareaswithaFD
factorof1024weretheregionsnumber2(malty,bitteralmonds),12(earthy),13(citrus,fresh),15
(roasted nuts, corn), 19 (rubber, plastic), 22 (rubber, sulfurlike), 28 (aniselike) and 37 (smoky),
whichwereidentifiedbymassspectra,retentionindicesandtheodorofthereferencecompounds
as 2 and 3methylbutanal (region 2), octanal (region 13) and guaiacol (region 37). The odorants
responsiblefortheearthy,rubberyandaniselikenoteswerenotidentified.Regardingregion15,we
positively identified 2 pyrazines (2,6dimethylpyrazine and 2ethylpyrazine) that matched with the
aromatic quality of this region in both columns used in thisstudy. However, due to the highodor
thresholdsthatthesecompoundsshowedindeodorizedanddistillateoil(8000gL1and20000g
L1),weassumedthatanotherodoractivemoleculeshouldberesponsibleforthehighFDfactorthat
presentedthisregion.Indeed,Chetschiketal.(35)demonstrated,veryrecently,theunimportance
ofthesepyrazinesintheoverallaromaofpeanut.Ontheotherhand,inpreviousstudiesrelatedto
roasted nuts aroma (12, 14, 35), it was pointed that 2acetyl1pyrroline was responsible for a
roasted, popcornlike odor detected at a retention index which coincided with our flavoractive
area15.Sincethiscompoundshowsaverylowdetectionthresholdvalue(0.053gL1)(36),even
beingatverylowconcentrationinroastednuts(35),itbehavesasanimportantcontributortothe
overallaroma.ThiswouldexplainwhywecoulddetectitbyGCObutnotbyGCMS.However,we
could not corroborate this identification because its reference standard is not commercially
available.

Among the ten flavoractive regions with a FD factor of 256, eight of them were chemically
identifiedasshowninTable1theregionsnumber1(malty,solventlike),11(fishy),14(mushroom),
17(sulfurlike),24(fatty,greenlike),25(paperlike),32(bluecheese,sweaty)and38(sweety)and
only the regions number 30 (green pepper, earthy) and 35 (fatty, flowery) were not positively
identified. However, with regard to the odoractive region number 35, we found the compound


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
242 JournalofAgriculturalandFoodChemistry(2011)

methyllaurateasthepossibleresponsibleofthisaromaticregion.Thishypothesisisduetothefact
that the reference standard compound coincided with this region both in its odor and in its RI in
bothchromatographiccolumnsusedinthisstudy.Moreover,althoughtheGCMSwasnotableto
identify this compound, we found its most abundant m/z ratios at the retention time where this
odor eluted when analyzing the spectrum. These facts, together with its low perception threshold
(150gL1indeodorizedanddistillateoil),ledustothisassignation.

Although, as it can be seen in Table 1, each aroma perceived during theGCO analysis is generally
due to a single odorant, we found two aromatic regions which were generated by a mixture of
compounds: number 21 (cooked potato) and 24 (fatty, greenlike). The first one was positively
identified as a mixture of 3ethyl2,5dimethylpyrazine, 2ethyl3,5(or 6)dimethylpyrazine and
methional(region21),andthesecondoneasamixtureof2,3diethyl5methylpyrazine,3,5diethyl
2methylpyrazineand2acetylfuran(region24).Relatedtotheregion21,itcouldbethoughtthatits
highFDvalueswereduemainlytomethionalbecauseofitslowerperceptionthresholdinoil(0.3g
L1formethionaland550gL1forthepyrazinesidentified).However,thegreaterchromatographic
peaks of the pyrazines and also the fact that the cooked potatoes note started to be perceived
slightly before methional eluted from the column, allowed us to ensure that this aromatic region
was due to the mixture of the three compounds. On the other hand, concerning to the aromatic
region24,besidestwopyrazinesalso2acetylfuranwaspositivelyidentified.Nevertheless,although
its odor quality coincided with the one detected in the region considered, its high perception
thresholdinoil(500gL1whenusingadistilledanddeodorizedoil)wasagoodindicatorthatthis
compoundwasnotresponsibleofsuchhighFDfactors.Therefore,weconcludedthatthearomatic
region24wasonlyduetothemixtureofthetwopyrazinesidentified.

When analyzing the differences between varieties, six odoractive regions were detected for the
Fandooghi cultivar but not for the Kerman: 3 (fruity, strawberry), 5 (strawberry), 10 (fruity), 23
(aniselike, fennel), 39 (roses) and 43 (disgusting, animal), which correspond to ethyl propanoate
(region 3), 2methylpropyl acetate (region 5), (E)2pentenal (region 10), 2phenylethanol (region
39), octanoic acid (region 43) and one unknown odorant (region 23). On the contrary, only the
flavoractive area number 26 (cheese, disgusting), that was identified as isobutyric acid, was
detected for the Kerman but not for the Fandooghi variety. Furthermore, while 22 odoractive
regionswereperceivedintheFandooghicultivarwithahigherFDfactorthanintheKermancultivar,
only6odorsappearedinthissecondvarietywithahigherFDfactor:7(butter),16(geranium),21
(cookedpotato),33(deepfried),41(metallic)and42(sweet,honey),whichwereidentifiedas2,3
pentanedione (region 7), a mixture of 3ethyl2,5dimethylpyrazine, 2ethyl3,5(or 6)
dimethylpyrazineandmethional(region21)andnonalactone(region42).Theregionnumber16

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 243

wasnotpositivelyidentified.Withregardtotheodoractiveregion33(deepfried),whenusingthe
polarcolumn,wefoundthatthisodoractiveregioncouldbedueto(E,E)2,4decadienalbutalsoto
(E,E)2,4nonadienal because both compounds coeluted. However, although the last one was
presentamongtheroastedpistachiovolatiles,aswellasamongtheodorantsofotherroastednuts
(12,14),theGCOanalysesbyusingtheHP5columnallowedustoidentifythemseparatelyandwe
could identify the (E,E)2,4decadienal as the responsible of this odoractive region. Regarding
number 40 (metallic), it has been related to trans4,5epoxy(E)2decenal. Although no reference
compoundisavailable,theidentificationwasdoneonthebasisoftheodorperceived,theretention
indices calculated on the CPWAX and HP5 stationary phases, the literature (12, 14) and the
Flavornetdatabase(37).

From the results obtained, it can be observed that most of the key odorants of roasted pistachio
aromadeterminedinthisstudyhavebeenpreviouslyreportedasvolatileoraromaticcompoundsin
other roasted nuts (1014). This can lead to the conclusion that there is a group of coincident
odorantsthatinfluencesonthecharacteristicroastednutodorandthattheyarealmostthesame,
whatever the nut considered. However, we should not forget the role played by those specific
compounds present in each nut. Only the global perception of their own characteristic notes,
togetherwiththedifferentperceptionintensityofthecoincidentcompoundsprovidesthearomatic
differencesamongnutsandamongvarietiesofthesametypeofnut.

Acknowledgments
ThisstudywassupportedbytheSpanishMinistryofScienceandTechnology(projectAGL200761550and
AGL201019688)andalsobytheIngenio2010programfromtheSpanishMinistryofIndustryinaCENIT
project called METDEVFUN and La Morella Nuts S.A. (Reus, Catalonia, Spain), which leaded the
consortiumofthisproject.



Laura Acea Muoz

Table1.MainodorantsfoundinroastedpistachionutswithFD64foratleastoneofthevarietiesanalyzed

odour RIon identification


active FDfactor MSD previously
regions CPWAX HP5 odourdescription F K compound F K RI odour reportedd
UNIVERSITAT ROVIRA I VIRGILI

1 a a malty,solventlike 256 256 isobutanal X X X X

1024 1024 2methylbutanal X X X X


ISBN:9788469432341/DL:T. 1040-2011

2 915 a malty,bitteralmonds 11,12,14


3methylbutanal X X X X

3 941 nd fruity,strawberry 64 nd ethylpropanoate X X

4 943 b butter 1024 256 diacetyl X X X X 12,14

5 968 773 strawberry 256 nd 2methylpropylacetate X X

6 983 801 fruity 256 64 ethylbutyrate X X

7 991 702 butter 64 1024 2,3pentanedione X X X X 11,12,14

8 994 843 fruity,apple 1024 256 ethyl2methylbutyrate X X 11,14

9 1020 794 green,grass 1024 256 hexanal X X X X 10,12,14

10 1076 753 fruity 64 nd (E)2pentenal X X X X

11 1183 896 fishy 256 256 (Z)4heptenal X X 12,14

12 1195 earthy 1024 1024 unknown


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

13 1233 1001 citrus,fresh 1024 1024 octanal X X X 12,14

14 1243 975 mushroom 256 256 1octen3one X X X X 12,14


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

15 1294 920 roastednuts,corn 1024 1024 2acetyl1pyrroline* X c 12,14

16 1314 geranium 256 1024 unknown

17 1329 965 sulfurlike 256 256 dimethyltrisulfide X X X X 12,14

18 1343 997 fruity,sweet 256 64 2ethyl5methylpyrazine X X X X 11,13

19 1369 rubber,plastic 1024 1024 unknown


Laura Acea Muoz

20 1388 nd mushroom 1024 256 1octen3ol X X 10,11

1077 3ethyl2,5dimethylpyrazine X X X c 11
21 1402 1085 cookedpotato 256 1024 2ethyl3,5(or6)dimethylpyrazine X X X X 11,12,14
907 methional X X 12,14
UNIVERSITAT ROVIRA I VIRGILI

22 1432 rubber,sulfurlike 1024 1024 unknown

23 1434 aniselike,fennel 1024 nd unknown


ISBN:9788469432341/DL:T. 1040-2011

1150 2,3diethyl5methylpyrazine X X X X 12,13


24 1449 fatty,greenlike 256 256
1170 3,5diethyl2methylpyrazine X X X c

25 1483 1160 paperlike 256 256 (E)2nonenal X X X X 12,14

26 1510 1232 cheese,disgusting nd 1024 isobutyricacid X X

27 1519 1026 roastednuts,popcorn 256 16 2acetylpyridine X X X X 12

28 1537 aniselike 1024 1024 unknown

29 1561 nd vomit,lactic 1024 4 butyricacid X X 12,14

30 1572 greenpepper,earthy 256 256 unknown

31 1591 1043 greenroses 1024 256 phenylethanal X X X X 10,12,14

2methylbutyricacid X X 12
32 1616 879 bluecheese,sweaty 256 256
3methylbutyricacid X X 12
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

33 1653 1324 deepfried 64 256 (E,E)2,4decadienal X X 12,14


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

34 1715 1098 roastednuts 1024 64 2acetyl2thiazoline X X 12

35 1760 1520 fatty,flowery 256 256 methyllaurate* X X

36 1776 1383 sweet,peachjam 1024 256 damascenone X X 14

37 1809 1093 smoky 1024 1024 guaiacol X X X 12,14

38 1828 1039 sweety 256 256 phenylmethanol X X X X

39 1865 1119 roses 64 nd 2phenylethanol X X X X 10,14


Laura Acea Muoz

40 1930 roasted,burnt 1024 64 unknown

41 1951 1387 metallic 256 1024 trans4,5epoxy(E)2decenal X c 12,14

42 1958 1358 sweet,honey 16 256 nonalactone X X X X 12


UNIVERSITAT ROVIRA I VIRGILI

43 2015 1284 disgusting,animal 256 nd octanoicacid X X X X

44 2022 nd caramel 1024 256 furaneol X X X X 12,14


ISBN:9788469432341/DL:T. 1040-2011

45 2027 nd urine 256 64 mcresol X X X 12

46 2116 nd stall,animal 256 4 4ethylphenol X X

47 2151 1332 smoky,sweet 256 16 4vinylguaiacol X X



F: Fandooghivariety
K: Kermanvariety
RI: Retentionindexondifferentstationaryphases
FD: FlavorDilutionfactor
nd: notdetected
* tentativeidentification
a: RInotcalculatedduetosolventinterference
b: RI<RIofthefirstalkane(C6)
c: standardnotavailable
d
Thecompoundhasbeenpreviouslyreportedinroastednutsinthegivenreference
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 247

LITERATURECITED
(1) Venkatachalam, M.; Sathe, S. K. Chemical composition of selected edible nut seeds. J. Agric.
FoodChem.2006,54,47054714.
(2) Kornsteiner,M.;Wagner,K.H.;Elmadfa,I.Tocopherolsandtotalphenolicsin10differentnut
types.FoodChem.2006,98,381387.
(3) Coates,A.M.;Howe,P.R.Ediblenutsandmetabolichealth.Curr.Opin.Lipidol.2007,18,25
30.
(4) Lois, M. T. A.E; GarcaAndrade, C. R.; Walther, L. A. .S.; NezCorts, J. M. The
mediterranean diet: a combination of beneficial elements for cardiovascular disease. Curr.
Nutr.FoodSci.2010,6,105108.
(5) Moodley, R.; Kindness, A.; Jonnaladadda, S. B. Elemental composition and chemical
characteristicsoffiveediblenuts(almonds,Brazil,pecan,macadamiaandwalnut)consumed
inSouthernAfrica.J.Environm.Sci.HealthPartB2007,42,585591.
(6) Kkner, E.; Yurt, B. Some chemical characteristics of Pistacia vera varieties produced in
Turkey.Eur.FoodRes.Technol.2003,217,308310.
(7) Evaristo,I.;Batista,D.;Correia,I.;Correia,P;Costa,R.ChemicalprofilingofPortuguesePinus
pineaL.nuts.J.Sci.FoodAgric.2010,90,10411049.
(8) Elmore, J. S.; Nisyrios, I.; Mottram, D. S. Analysis of the headspace aroma compounds of
walnuts(JuglansregiaL.).FlavourFragr.J.2005,20,501506.
(9) Alasalvar,C.;Odabasi,A.Z.;Demir,N.;Balaban,M..;Shahidi,F.;Cadwallader,K.R.Volatiles
and flavor of five Turkish hazelnut varieties as evaluated by descriptive sensory analysis,
electronic nose, and dynamic headspace analysis/gas chromatographymass spectrometry. J.
FoodSci.2004,69,99106.
(10) Krist, S.; Unterweger, H.; Bandion, F.; Buchbauer, G. Volatile compound analysis of SPME
headspaceandextractsamplesfromroastedItalianchestnuts(CastaneasativaMill.)usingGC
MS.Eur.FoodRes.Technol.2004,219,470473.
(11) Alasalvar,C;Shahidi,F.;Cadwallader,K.R.ComparisonofnaturalandroastedTurkishTombul
hazelnut (Corylus avellana L.) volatiles and flavour by DHA/GC/MS and descriptive sensory
analysis.J.Agric.FoodChem.2003,51,50675072.
(12) Chetschik, I.; Granvogl, M.; Schieberle, P. Comparison of the key aroma compounds in
organicallygrown,rawWestAfricanpeanuts(Arachishypogaea)andinground, panroasted
mealproducedthereof.J.Agric.FoodChem.2008,56,1023710243.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
248 JournalofAgriculturalandFoodChemistry(2011)

(13) VzquezArajo, L.; Verd, A.; Navarro, P.; MartnezSnchez, F.; CarbonellBarrachina, . A.
ChangesinvolatilecompoundsandsensoryqualityduringtoastingofSpanishalmonds.Int.J.
FoodSci.Technol.2009,44,22252233.
(14) BurdackFreitag, A.; Schieberle, P. Changes in the key odorants of Italian hazelnuts (Coryllus
avellanaL.Var.TondaRomana)inducedbyroasting.J.Agric.FoodChem.2010,58,63516359.
(15) AlSaghir, M. G. Phylogenetic analysis of the genus Pistacia L. (Anacardiaceae) based on
morphologicaldata.AsianJ.PlantSci.2010,9,2835.
(16) Dragull, K.; Beck, J. J.; Merrill, G. B. Essential oil yield and composition of Pistachia vera
Kerman fruits, peduncles and leaves grown in California. J. Sci. Food Agric. 2010, 90, 664
668.
(17) Duru, M. E.; Cakir, A.; Kordali, S.; Zengin, H.; Harmandar, M.; Izumi, S.; Hirata, T. Chemical
composition and antifungal properties of essential oils of three Pistacia species. Fitoterapia
2003,74,170176.
(18) Alma, M. H.; Nitz, S.; Kollmannsberger, H.; Digrak, M.; Efe, F. T.; Yilmaz, N. Chemical
compositionandantimicrobialactivityoftheessentialoilsfromthegumofTurkishpistachio
(PistaciaveraL.).J.Agric.FoodChem.2004,52,39113914.
(19) Gentile, C.; Tesoriere, L.; Butera, D.; Fazzari, M.; Monastero, M.; Allegra, M.; Livrea, M. A.
Antioxidant activity of Sicilian pistachio (Pistacia vera L. Var. Bronte) nut extract and its
bioactivecomponents.J.Agric.FoodChem.2007,55,643648.
(20) Anderson, K. A.; Smith, B. W. Use of chemical profiling to differentiate geographic growing
originofrawpistachios.J.Agric.FoodChem.2005,53,410418.
(21) Arena,E.;Campisi,S.;Fallico,B.;Maccarone,E.Distributionoffattyacidsandphytosterolsasa
criteriontodiscriminategeographicoriginofpistachioseeds.FoodChem.2007,104,403408.
(22) Chahed, T.; Bellila, A.; Dhifi, W.; Hamrouni, I.; Mhamdi, B.; Kchouk, M. E.; Marzouk, B.
Pistachio(Pistaciavera)seedoilcomposition:geographicsituationandvarietyeffects.Grasas
Aceites2008,59,5156.
(23) Cadwallader,K.R.;Puangpraphant,S.Flavorandvolatilecompoundsintreenuts.InTreenuts:
Composition, Phytochemicals, and Health Effects; Alasalvar, C., Shahidi, F., Eds.; CRC Press:
BocaRaton,Florida,2009;109126.
(24) Acea, L.; Vera, L.; Guasch, J.; Busto, O.; Mestres, M. Comparative study of two extraction
techniques to obtain representative aroma extracts for being analysed by gas
chromatographyolfactometry: application to roasted pistachio aroma. J. Chromatogr. A J.
Chromatogr.A2010,1217,77817787.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Determinationofroastedpistachioskeyodorants 249

(25) Belitz, H.D.; Grosch, W.; Schieberle, P. Aroma Compounds. In Food Chemistry, third revised
edition;Springer:Berlin,Germany,2004;342408.
(26) Holley, A. Processing information about flavour. In Flavour in food, first edition; Voilley, A.,
Etivant,P.,Eds.;WoodheadPublishingLimited:Cambridge,England,2006;3661.
(27) Zellner, B. A.; Dugo, P.; Dugo, G.; Mondello, L. Gas chromatographyolfactometry in food
flavouranalysis.J.Chromatogr.A2008,1186,123143.
(28) Mayol, A. R.; Acree, T. E. Advances in Gas ChromatographyOlfactometry. In Gas
ChromatographyOlfactometry.TheStateoftheArt,firstedition;Leland,J.V.,Schieberle,P.,
Buettner,A.,Acree,T.E.,Eds.;ACSSymposiumSeries,WashingtonD.C.,Washington,2001;1
10.
(29) Ullrich, F.; Grosch, W. Identification of the most intense volatile flavour compounds formed
duringautoxidationoflinoleicacid.Z.Lebensm.Unters.Forsch.1987,184,277282.
(30) Schieberle, P.; Grosch, W. Evaluation of the flavour of wheat and rye bread crusts by aroma
extractdilutionanalysis.Z.Lebensm.Unters.Forsch.1987,185,111113.
(31) Arthur, C. L.; Pawliszyn, J. Solid phase microextraction with thermal desorption using fused
silicaopticalfibers.Anal.Chem.1990,62,21452148.
(32) Wardencki,W.;Michulec,M.;Curylo,J.Areviewoftheoreticalandpracticalaspectsofsolid
phasemicroextractioninfoodanalysis.Int.J.FoodSci.Technol.2004,39,703717.
(33) Riu, R.; Mestres, M.; Busto, O.; Guasch, J. Quantification of chloroanisoles in cork using
headspace solidphase microextraction and gas chromatography with electron capture
detection.J.Chromatogr.A,2006,1107,240247.
(34) Mart, M.P.;Mestres,M.;Sala,C.;Busto,O.;Guasch,J.Solidphasemicroextractionandgas
chromatographyolfactometryanalysisofsuccessivelydilutedsamples.Anewapproachofthe
aroma extract dilution analysis applied to the characterization of wine aroma. J. Agric. Food
Chem.2003,51,78617865.
(35) Chetschik,I.;Granvogl,M.;Schieberle,P.Quantitationof keypeanutaromacompoundsand
panroasted peanut meal. Aroma reconstitution and comparison with commercial peanut
products.J.Agric.FoodChem.2010,58,1101811026.
(36) Czerny,M;Christlbauer,M.;Christlbauer,M.;Fischer,A.;Granvogl,M.;Hammer,M.;Hartl,C.;
MoranHernandez,N.;Schieberle,P.Reinvestigationonodourthresholdsofkeyfoodaroma
compounds and development of an aroma language based on odour qualities of defined
aqueousodorantsolutions.Eur.FoodRes.Technol.2008,228,265273.
(37) Acree, T.; Arn, H. Flavornet and human odor space (latest update 06.25.2004).
http://www.flavornet.org,accessedAugust2010.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CAPTULO 6
El aceite de oliva
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 253

6.1.ELACEITEDEOLIVA

Las distintas civilizaciones que se han desarrollado alrededor del Mar


Mediterrneo a lo largo de los siglos han basado su alimentacin en los productos
derivados del trigo, el olivo y la vid. Es la denominada trada mediterrnea: pan,
aceiteyvino,peroalaquetambinhabraqueaadirlaslegumbres,porelgranpeso
quehantenidoenlaalimentacindeestospueblos[1].

Sin embargo, el trigo proviene de Oriente Prximo y la vid, de Asia Central,


mientrasquelaslegumbrestienendistintosorgenesenfuncindelaespeciedeque
se trate (Mesopotamia, Amrica o Asia Central), por lo que nicamente el olivo es
realmenteoriginariodelacuencamediterrnea[2](Figura6.1).Deahqueelaceite
de oliva sea el ms caracterstico de estos alimentos, el que diferencia a la dieta
mediterrnea del resto de modelos alimentarios, hecho que se resume con claridad
en la frase del escritor y poeta francs Georges Duhamel: donde el olivo se retira,
acabaelmediterrneo.


Figura6.1.Distribucindelolivoenlacuencamediterrnea

6.1.1.Definicin

La palabra aceite significa jugo de la oliva. Proviene del trmino arameo


zaytydelhebreojudaicoazzeit,quederivaronalazzytdelrabehispnico.
Posteriormente, el trmino evolucion hasta el aceite actual [3], que, de acuerdo

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
254 Captulo6

con la Real Academia Espaola de la Lengua [4], es el lquido graso de color verde
amarillentoqueseobtieneprensandolasaceitunas.

Enrealidad,lapalabraaceiteserefieresolamentealaceitedeolivavirgen,pero
sehaterminadogeneralizandoparadesignartodosloslquidosoleososobtenidosde
lassemillasdelasplantas.

Segn la Reglamentacin TcnicoSanitaria espaola [5], elaceite de oliva es el


aceiteprocedentenicamentedelosfrutosdeolivoOleaeuropeaL.,conexclusin
delosaceitesobtenidoscondisolventesoporprocedimientosdereesterificacinyde
todamezclaconaceitesdeotranaturaleza.

6.1.2.Tiposdeaceitedeoliva

Las legislaciones espaola y comunitaria handefinido expresamente cules son


losdiferentestiposdeaceitesdeolivaydeorujodeolivaquepuedencomercializarse
en la Unin Europea, qu caractersticas de calidad y pureza deben reunir y cmo
deben determinarse estas caractersticas [58], pudindose distinguir tres grandes
tiposdeaceites:losaceitesdeolivavrgenes,elaceitedeolivayelaceitedeorujode
oliva(Figura6.2).

Aceites de oliva vrgenes. Son todos aquellos aceites obtenidos a partir de las
aceitunasexclusivamenteporprocedimientosmecnicosoporotrosprocedimientos
fsicos, pero que impliquen una alteracin mnima del producto, y que no sean
diferentes del lavado, la decantacin, la centrifugacin o la filtracin. El trmino
virgenhacereferenciaalaausenciadecualquiertipodeintervencinqumica.De
hecho,estnexcluidosexpresamentedeestacategoralosaceitesobtenidosgracias
alusodedisolventesorgnicos,coadyuvantesqumicosobioqumicos,oaprocesos
dereesterificacin,ascomolosproductosqueseanmezclasdeotrosaceites.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 255

Sin embargo, segn la recoleccin, el transporte y el almacenamiento de las


aceitunas,porejemplo,lacalidaddeestosaceitesdeolivavrgenespuedevariar.Por
esemotivo,dentrodeestegrupo,sedistinguenotrostrestipos(Figura6.2):

Aceitedeolivavirgenextra.Presentaunaacidezlibreigualomenora0,8,
sindefectosorganolpticos,yconunatributofrutaldeaceitunas.Eselmejor
delosaceitesvrgenes,conunvalornutricionalygastronmicomximo.

Aceite de oliva virgen. Presenta una acidez libre mxima de 2, y su


valoracinorganolpticadelosdefectosdebeserigualoinferiora2,5puntos
(en una escala de 10), y con un atributo frutal positivo. Su valor nutricional
tambinesmximo,ysloloscatadoresaltamentecualificadossoncapaces
dedetectarsuscasiimperceptiblesirregularidades.

Aceitedeolivavirgenlampante.Presentaunaacidezlibresuperiora2yun
sabor defectuoso y/o un defecto organolptico superior a 2,5 puntos. No
puedeserconsumidoydebesersometidoaunprocesoderefinado,traslo
que se obtiene el aceite de oliva refinado. Este aceite de oliva refinado no
puedecomercializarse,perosusarseenlaelaboracindelaceitedeoliva.

Aceitedeoliva.Esunamezcladeaceitedeolivarefinadoyaceitedeolivavirgen
extraovirgen.Suacidezvaraenfuncindeltipodeaceitedeolivavirgenconelque
seenriquece,pudiendoser0,4(siesdemenorsabor),ode1(siesdemayorsabor).
Noposeenielvalorsensorialnielnutricionalquecaracterizaalosaceitesvrgenes.

Aceitedeorujodeoliva.Eselaceitecontenidoenelorujo,laparteslidaque
queda tras la obtencin del aceite virgen, y formado por la piel, losrestos de pulpa
agotadayelhuesodelasaceitunas.Despusdeextraerlocondisolventes,elaceitede
orujo bruto, o crudo, es sometido a un proceso de refinado. Al aceite de orujo
refinado que se consigue se le adiciona aceite de oliva virgen para mejorar sus
cualidades.Finalmente,pasaacomercializarsecomoaceitedeorujodeoliva.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
256 Captulo6

Mientras que las diferencias entre un aceite de oliva virgen extra y otro virgen
son nicamente de carcter sensorial (ya que ambos son iguales desde una
perspectivanutricional),elaceitedeolivapresentaunvalorsensorial,gastronmicoy
nutricionalsensiblementeinferior,comparablealdelaceitedeorujodeoliva.

ALMAZARA

ACEITESDEOLIVAVRGENES ORUJO

extraccin
ACEITEDEOLIVA ACEITEDEOLIVA ACEITEDEOLIVA
VIRGENEXTRA VIRGEN VIRGENLAMPANTE
ACEITEDEORUJO
Sinningndefecto Admitepequeo Notablesdefectos
organolptico. defectoorganolptico. organolpticos.
BRUTO
Acidez0,8 Acidez2 Acidez>2

procesoderefinado

ACEITEDEOLIVA ACEITEDEORUJO
REFINADO REFINADO

enriquecimientoconaceitesde
olivavrgenes

ACEITEDEOLIVA ACEITEDEOLIVA ACEITEDEORUJO


ACEITEDEOLIVA
VIRGENEXTRA VIRGEN DEOLIVA

Figura6.2.Tiposdeaceitedeoliva

6.1.3.Mtodosdeobtencindelaceitedeoliva

Paraobtenerunaceitedecalidadesnecesariopartirdeunasaceitunasenteras,
sanasymaduras.Indudablemente,factorescomoeltipodevariedadyelestadode
maduracin de las aceitunas, las condiciones climticas y edafolgicas, as como la
irrigacin o fertilizacin quesoporta elolivo, junto conelsistema de recoleccin de
losfrutos(manualomecnica),afectanalacalidaddelasaceitunasy,portanto,ala


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 257

delaceite.Perolosprocedimientosaplicadosdurante todoelprocesode extraccin


tambininfluyendecisivamenteenlacalidaddelproductofinal[2].

6.1.3.1.Obtencindelosaceitesdeolivavrgenes

A la entrada de la almazara hay que clasificar los frutos en funcin de su


variedad, de su procedencia del rbol o del suelo y de su estado fitosanitario, de
formaqueseprocesanseparadamentelosdecadaclase.Adems,esmuyimportante
quelasaceitunasentrenlimpias,sinrestosdehojasyramas,opiedrasytierra[9,10].

Acontinuacinhayquellevaracabolamoliendaotrituradolomsrpidamente
posible, para evitar procesos fermentativos sobre el fruto, que elevan la acidez del
aceite que contienen y generan malos sabores y olores. Si hubiera que almacenar
algunos frutos (uno o dos das, como mximo), es aconsejable hacerlo en un lugar
fresco y ventilado y siempre los de peor calidad, para procesar inmediatamente las
aceitunasmejores[2,10].

El fin de la molienda es liberar el aceite de las estructuras celulares que lo


contienenporroturadelostejidos.Enlaantigedad,esteprocesosehacaamanoen
recipientesdepiedraesfricosocnicos.Actualmenteseutilizansistemasdetraccin
mecnicosenmolinosdematerialesinertes,deaceroinoxidableopiedra[10,11].

La pasta obtenida tras el triturado se bate entonces con mquinas batidoras


provistas de paletas o hlices que giran a baja velocidad para evitar emulsiones. De
esta manera se produce la coalescencia entre las gotitas de aceite presentes para
generargotasgrandes.Esimportantequeesteprocesoselleveacaboatemperaturas
moderadasydentrodeunoslmitesmuyestrictos,ynoprolongarloexcesivamenteen
eltiempo.Asseevitalaprdidadevoltiles,queseinicienprocesosdeoxidacinyla
disminucindelcontenidototaldepolifenoles[2,911].

Tras el batido se procede a la separacin de la fase slida (orujo) de la fase


lquida, mediante presin, centrifugacin o una combinacin de ambos sistemas. En


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
258 Captulo6

algunoscasos,antesdeaplicarestosmtodosdeseparacin,serealizaunaextraccin
parcial del aceite suelto, el menos retenido por la pasta, aprovechando la diferente
tensin superficial del aceite y el agua de vegetacin [2, 9]. Pero el porcentaje de
aceitequeseconsigueas,enrelacinconlaproduccintotal,esmuypequeo.

Deentrelossistemasdeseparacin,elmsantiguoyutilizadoeseldepresin.
En l, la pasta se coloca en capas finas sobre discos de material filtrante, los
denominados capachos. Estos capachos van guiados por una aguja central y se
disponen unos sobre otros, formando un conjunto cilndrico (cargo) que se sita en
una vagoneta. La presin aplicada sobre el cargo provoca la salida de los lquidos,
mientrasquelosslidosquedanretenidosenloscapachos.Laestructuragranularde
lapastayloscapachosactandefiltros,yloslquidosobtenidos(elaceiteyelaguade
vegetacin)serecogenenlavagoneta.Enestoscasoshayquetenercuidadoconla
presinqueseaplica:presionesdehasta40kg/cm2proporcionanlosmejoresaceites.
Conpresionessuperiores(5565kg/cm2)selograunmayorrendimiento,peroaceites
de calidad slo aceptable. Tambin hay que lavar con frecuencia los capachos para
evitareldesarrollodefermentaciones[2,9,10].

Actualmente, la separacin del orujo de la fase lquida tiende a hacerse por


procedimientoscontinuosdecentrifugacindemasas,entrelosquesedistinguenlos
detresylosdedosfases.Enlosprimeros,lapastasediluyeconaguatempladayse
inyecta en centrifugadoras de eje horizontal, donde las fases se separan por la
diferente densidad de las fases. Por un lado se recoge el orujo (materia seca casi
desgrasada)acompaadadehumedad,porotro,elalpechn(aguadevegetacin)con
algo de aceite y, por otro, el aceite, con algo de humedad. En los sistemas de dos
fasesnoseadicionaaguaalapastaporloque,traslacentrifugacin,nicamentese
recogen el aceite (con algo de humedad) y el orujo (que contiene el agua de
vegetacindelasaceitunas)[9,10].

Unavezobtenidalafaselquidaquecontieneelaceite,esnecesariosepararel
agua de vegetacin y los slidos en suspensin. Puede hacerse por gravedad,

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 259

utilizando depsitos decantadores, o por centrifugacin. El primer proceso es ms


lento, con prolongados tiempos de contacto entre el aceite y el alpechn. Adems,
proporciona aceites de mayor acidez y menor estabilidad oxidativa, por lo que se
prefiereelmtododelacentrifugacin,quepermitetrabajarencontinuo[2,9,10].

Finalmente, el aceite se almacena en la almazara durante un tiempo ms o


menoslargohastasuenvasadoycomercializacin.Losdepsitosmsadecuadospara
almacenarlo son los que evitan grandes cambios de temperatura y la influencia del
aireylaluz,yqueestnhechosdematerialesinertesalaceite[9,10].

6.1.3.2.Obtencindelaceitedeorujobruto

Elorujoquequedatraselmolido,elbatidoylaseparacindelasfasespresenta
uncontenidovariabledeagua(2070%)yaceite(2,58%),enfuncindelsistemapor
elquesehayaobtenidoelaceitedeolivavirgen.Paraextraerelaceiteresidualque
contiene,esnecesariosecardichoorujoinmediatamentedespusdesuobtenciny
triturarlo,paraaumentarassusuperficiedecontacto.Acontinuacinseleinyectaun
disolventeprecalentado,generalmentehexano,queextraeelaceite.Eldisolventese
calientaparaaumentarlaeficaciadelaextraccin.Lamezclaobtenidasedestilacon
arrastrede vapor, de forma quese elimina eldisolvente. El aceite de orujode oliva
crudoqueseconsiguepasaaserrefinado[2,10,11].

6.1.3.3.Obtencindelaceitedeolivaydelaceitedeorujorefinados

El aceite de oliva virgen lampante y el aceite de orujo bruto tienen que ser
sometidosaunprocesoderefinacinorectificacinparaseraptosparaelconsumo.
Este proceso puede comprender mtodos fsicos, qumicos o una combinacin de
ambos, y su objetivo es eliminar los compuestos responsables de las caractersticas
organolpticasdesagradables(color,olorysabor),delaelevadaacidezydelapoca
estabilidadoxidativa.Paraello,serealizaunaseriedeprocesos(parcialototalmente):
el desgomado, la neutralizacin, el lavado, la decoloracin, la desodorizacin y el


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
260 Captulo6

desmargarinizado, que dan lugar al aceite de oliva y al aceite de orujo refinados [2,
10,11].

6.1.3.4.Obtencindelaceitedeolivaydelaceitedeorujodeoliva

Losaceitesprocedentesdelrefinadopresentanuncolormuyplidoymuybaja
acidez, son poco viscosos, y tienen poco o ningn sabor y olor que recuerden a la
aceituna. Adems, tambin han perdido componentes nutricionales importantes,
comolosantioxidantes.Conelobjetivodemejorarsuscaractersticasorganolpticas
ynutricionales,selesadicionaentoncesunaciertacantidaddeaceitedeolivavirgen,
entreun10yun20%(normalmente,pordebajodel15%).Deestaforma,seobtienen
losproductoscomercializadosconelnombredeaceitesdeolivayaceitesdeorujo
de oliva. Suelen ser suaves, agradables de sabor, aunque poco intenso, y se
caracterizanporsuhomogeneidadalolargodelascampaasydurantetodoelao
[2,10].

6.2.ELACEITEDEOLIVAVIRGEN

Elaceitedeolivavirgenrealmenteeselzumodelasaceitunas,yelnicoaceite
quepuedeconsumirsecomosaledelfruto.Lascaractersticasquepresentadependen
de la variedad de aceituna que se emplee y de los procedimientos de elaboracin
aplicados, pero, si se siguen unos procesos de obtencin adecuados, el producto se
mantiene sin alteracin del sabor, de los aromas y de las vitaminas que el aceite
contenaenlaaceituna.

6.2.1.Composicinqumica

El aceite de oliva est compuesto por una fraccin mayoritaria de tipo oleoso
que representa cerca del 98,5% del total (fraccin saponificable), y otra fraccin
minoritarianooleosa(fraccininsaponificable).


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 261

La fraccin saponificable es la constituida por


cidograso

G L I C E R O L
los triglicridos y los cidos grasos libres. Los
triglicridos,talycomosemuestraenlaFigura6.3,
cidograso
son steres de los cidos grasos y el glicerol. Estos
cidos grasos se caracterizan por tener un grupo
cidograso
cido en uno de sus extremos y un nmero par de

tomos de carbono en su cadena carbonada (que
Figura6.3.Estructuraqumica
oscilaentre12y22)[1,2,11]. genricadeuntriglicrido

Adems,lamayorpartedeloscidosgrasospresentesenelaceitedeolivason
insaturados, es decir, cuentan con dobles enlaces en su estructura. Estas
insaturaciones son las responsables de las caractersticas especiales del producto
final.Porunlado,hacenquedisminuyasupuntodefusin,deahqueelaceitesea
lquidoatemperaturaambiente,perotambinlovuelvenmsinestablefrentealos
distintos procesos de alteracin, como la oxidacin (vulgarmente llamada
enranciamiento). Por otro, le aportan su gran importancia biolgica, ya que estos
compuestos,alnosersintetizadosporelorganismo,debenseringeridosmediantela
dieta[2].

Contenido%(en tomosdeC: Posicindobles


cidograso relacinconeltotal) insaturaciones enlaces Tipo
Oleico 6183 18:1 9 monoinsaturado

Palmtico 718 16:0 saturado

Linoleico 218 18:2 9y12 diinsaturado

Esterico 0,55 18:0 saturado

Palmitoleico 0,33 16:1 9 monoinsaturado

Linolnico <1,5 18:3 9,12y15 triinsaturado

Tabla6.1.Distribucinycaractersticasdeloscidosgrasosenelaceitedeoliva


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
262 Captulo6

Los principales cidos grasos presentes en el aceite de oliva se detallan en la


Tabla 6.1, donde tambin se especifican el nmero de dobles enlaces que contiene
cadaunoylaposicinqueocupanenlacadenacarbonada.Losporcentajesenlosque
aparecenestnreferidosaltotaldecidosgrasos,ysonelmnimoyelmximoque
establecelalegislacinparacadaunodeellos[5].Lasvariacionesenlacomposicin
de estos cidos que se encuentran en los aceites se deben al tipo de aceitunas
empleadas,elestadodemaduracin,lascondicionesambientales,etc.[1,2,11].

Porsuparte,lafraccininsaponificablerepresentaunapartemnimadelaceite
de oliva (1,5%). En ella encontramos compuestos con estructuras qumicas muy
diversas, responsables de la estabilidad del aceite y de sus caractersticas
organolpticas, as como de ciertos efectos beneficiosos que este producto tiene
sobrenuestroorganismo[1,2].

Algunos de estos compuestos son hidrocarburos, entre los que destacan el


escualenoyloscarotenos.Elprimeroeselmsabundante(90%deltotal)yse cree
que es el responsable de la baja incidencia del cncer en las poblaciones
mediterrneas[12].Entrelossegundosseencuentranelcaroteno(precursordela
vitaminaA)yellicopeno,ambosconcarcterantioxidanteyresponsablesdelcolorde
losaceitesjuntoalasclorofilas.

Otro grupo importante de compuestos en el aceite de oliva lo constituyen los


esteroles, entre los que el sitosterol es el mayoritario, y cuya accin est
relacionada con una disminucin en la absorcin del colesterol alimentario [13].
Asimismo, encontramos alcoholes terpnicos, como el eritrodiol, que se cree que
tienenpropiedadesantioxidantes,antiinflamatoriasyvasodilatadoras.

Encuantoalostocoferoles,elpredominanteeseltocoferol(vitaminaE).Estos
compuestostambintienenpropiedadesantioxidantesyprotegenalosaceitesfrente
alaoxidacin.Asimismo,cabedestacarloscompuestosfenlicosopolifenoles,cuyas


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 263

acciones biolgicas van desde inhibir la nitrosacin o atrapar especies oxigenadas,


hastaquelarionesmetablicos,ademsdeevitarlaoxidacin[14].

Finalmente, dentro de esta fraccin insaponificable, y como ya se ver ms


adelante,tambinhayungrupodecompuestos,principalmentecon5y6tomosde
carbonoensuestructura,congraninfluenciasobrelascaractersticasorganolpticas
delaceitedeoliva,especialmentesobreelaroma.

6.2.2.Criteriosdecalidad

El aceite contenido en el fruto constituye el prototipo de calidad, la cual vara


segn la variedad y la zona geogrfica donde se produzca la aceituna.
Tradicionalmente, los criterios de calidad se determinaban por catadores expertos,
quecatalogabanelaceiteenfuncindesuflavor(olor,gustoysabor),coloryaspecto.
Esladenominadacalidadsubjetiva.Actualmente,aestaevaluacindeloscaracteres
organolpticos se le suma la determinacin de ciertos parmetros qumicos
relacionadosconeldeteriorodelosaceites,yqueconstituyenlacalidadobjetiva[9].

6.2.2.1.Parmetrosqumicos

Losparmetrosqumicosdecalidadmsimportantesdelosaceitesdeolivason
elgradodeacidezylaoxidacin.

El grado de acidez mide la intensidad de los fenmenos de hidrlisis que se


hayan producido en los triglicridos, fundamentalmente por la accin de unas
enzimaspresentesenelpropiosustrato,laslipasas.Enlasaceitunas,estasenzimasno
estnencontactoconelaceite,porloquenopuedenactuar.Perosilasprcticasde
obtencin del aceite no son las adecuadas, los tejidos que lo contienen se rompen
antesdetiempo.Entonces,lipasasyaceitesejuntan,ylasprimeraspuedendestruir
elenlacesterdelostriglicridosdelsegundo,liberandoloscidosgrasos[2].

Elndiceogradodeacidezeslamedidadeloscidosgrasoslibrespresentesen
elaceite,expresadaenporcentajedecidooleico.Esunparmetroutilizadoparala

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
264 Captulo6

clasificacindelosaceites,comosehaexplicadoanteriormente.Tambinescapazde
limitarsucomercializacin:losaceitesconunaacidezsuperiora2nopuedenusarse
directamenteparalaalimentacinhumana,antesdebenserrefinados[2,9,11].

Respectoalaoxidacin,seproduceporlainestabilidadquelosdoblesenlacesde
loscidosgrasosintroducenenlasmolculasyeslaresponsabledelenranciamiento
delosaceitesquemodificasuscaractersticasorganolpticas.Elgradodeoxidacinse
determinamedianteelndicedeperxidosydistintasmedidasdeabsorbanciaenla
zonaultravioletadelespectro(K232yK270).

Existen algunos agentes externos (la luz, la temperatura o ciertos metales) que
activanlamolculadelcidograso,alactuarcomocatalizadores.As,enunaprimera
etapaseformanradialeslibres,capacesdereaccionarencadenaconeloxgenodel
aire para originar radicales perxidos e hidroperxidos. En una segunda etapa, los
perxidos formados se rompen, dando lugar a los distintos compuestos voltiles
(aldehdos,cetonas,etc.),responsablesdelcambioenelaromadelaceiterancio.Sin
embargo, este proceso se ve retardado por la presencia de los antioxidantes
(especialmente, los tocoferoles), que actan como protectores y aumentan la
estabilidaddelaceite[2,15].

Elndicedeperxidoseselmtodomsutilizadoparamedirlacantidadtotalde
hidroperxidos, que son los primeros productos de oxidacin. Por tanto, es un
indicadordelaoxidacininicialdelaceite.Seexpresaenmiliequivalentesdeoxgeno
activo por kilogramo de aceite, y su valor debe ser inferior a 20 para los aceites
vrgenes[9,11,15].

Porsuparte,lasmedidasK232yK270indicanelestadooxidativoylaadulteracin
delaceitedeoliva.Durantelaformacindelosradicalesperxidosehidroperxidos,
ascomoduranteelrefinado,seproduceuncambioenlaconfiguracindelosdobles
ytriplesenlacesdeestasespecies,demaneraqueseterminanobteniendosusformas
conjugadas. Mientras que los dienos conjugados absorben a 232 nm, los trienos


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 265

conjugadoslohacena270nm[9,11,15].Deestaforma,valoresbajosdeabsorbancia
a estas longitudes de onda corresponden a aceites de buena calidad. Por ejemplo,
paraqueunaceiteseaconsideradovirgen,debepresentarunK2322,50yunK270
0,25.

6.2.2.2.Evaluacinsensorial

La evaluacin de las caractersticas organolpticas de un aceite es un criterio


bsico para determinar su calidad. El color, el sabor y el aroma son los parmetros
principalesqueseevalan,ytantoelvocabularioquedebeemplearseenelanlisis
sensorial [16], como las copas [17] y el tipo de sala de cata [18] en las que debe
llevarse a cabo la degustacin, as como la metodologa a seguir [19] y la seleccin,
entrenamientoycontroldeloscatadores[20],hansidoespecificadosporelConsejo
Olecola Internacional (COI) con el objetivo de establecer un mtodo normalizado y
objetivodeanlisisdelaceitedeolivavirgen[21],mtodoquehasidoaceptadopor
laslegislacionesespaolaycomunitaria.

El color de los aceites de oliva vrgenes vara entre el amarillo claro y un verde
msomenosintenso,enfuncindelcontenidoenclorofilasycarotenoides.Aunque
se puede determinar instrumentalmente, su evaluacin suele realizarse de forma
sensorial. Por su parte, sabor y aroma, tal y como ya se ha visto a lo largo de la
memoriadeestatesisdoctoral,estnestrechamenterelacionados,yenlaactualidad
slopuedenevaluarsecongarantasmediantepanelesdecatadores.

Estos paneles de catadores, adecuadamente seleccionados y entrenados, estn


constituidos por un mnimo de 8 y un mximo de 12miembros.Los gua un jefe de
panel, que es quien codifica y suministra las muestras, recoge los formularios
cumplimentados y realiza un estudio estadstico con los resultados. Esto le permite
establecer la valoracin organolptica del aceite de oliva virgen, que puede ser
irreprochable, bueno o defectuoso, y que, junto con el resto de pruebas de calidad,
permiteclasificarloenvirgenextraovirgen[9,10,22].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
266 Captulo6

La cata se lleva a cabo en copas de cristal coloreado de dimensiones


establecidas,yaunatemperaturaprximaalos28C(lamsadecuadaparapercibir
los aromas). Cada catador se sita en una cabina, sentado, aislado, en un ambiente
relajado, y debe anotar las sensaciones olfativas, gustativas, tctiles y quinestticas
(presin aplicada a la muestra en la cavidad bucal) que experimenta ante cada
muestra. Tambin debe sealar la presencia de las distintas cualidades y defectos,
valorandosuintensidadsobreunaescalacontinuade10cm,donde0eslaausencia
totaldeunatributoy10correspondealaintensidadmxima[2,9,10,22].

Losatributospositivosquelospanelesoficialesdecatadoresdeaceitedeoliva
virgenvalorandeentretodoslosatributossensorialessonlossiguientes[2,22]:

Atributosaromticosprincipales:
Afrutadodeaceituna:aromaquerecuerdaalaaceituna,msomenosverde,
segnsugradodemaduracin.
Verde:aromaquerecuerdaalahierbarecincortadaoalashojasdelolivo.

Atributos aromticos secundarios: nicamente pueden identificarse en


aceites vrgenes especialmente bien elaborados o que provengan de
aceitunasdemximacalidad.Recuerdanadistintasfrutasyverduras,comola
manzana,losfrutosrojosmaduros,laalmendra,elhinojo,lanuez,...

Atributosdesabor:
Amargo:saborbsicoqueseidentificaalfinaldelacavidadbucal.
Picante:sensacintctildepicorquesesienteenlagarganta.
Astringente: sensacin de sequedad en la boca a causa de la prdida
momentneadesaliva.
Dulce:saborbsicoqueseidentificaenlalengua,potenciadoporlaausencia
desustanciasamargas.

En cuanto a los atributos negativos, los principales defectos que los paneles
oficiales de catadores valoran son agrio, avinado/avinagrado, rancio, metlico,

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 267

hongos, moho/humedad o suciedad. Sus orgenes son varios, desde el estado en el


que las aceitunas entran en la almazara, hasta el proceso de extraccin y el
almacenamientodelaceite,incluyendoeltiempoquepasahastaqueelproductoes
consumido[22].

6.2.3.Efectosfuncionalesdelaceitedeoliva

El aceite de oliva virgen es una importante fuente nutricional para el ser


humano,ademsdeunfactorpreventivoenmuchasenfermedadesrelacionadascon
la nutricin, como son la obesidad abdominal, los elevados niveles de triglicridos y
de colesterol malo (LDL), la resistencia a la insulina o la intolerancia al azcar, la
presin arterial alta, etc. Su valor biolgico y teraputico est relacionado con su
estructuraqumica,ylosdistintosestudiosrealizadossobresusefectosbeneficiosos
debencontemplarsesiempreenrelacinalasrespuestasquegeneranlosaceitesde
semillas[1,2,10,11,23].

El aceite de oliva virgen es un alimento nico. En primer lugar, por los cidos
grasos que componen los triglicridos, monoinsaturados en su mayora, frente a los
saturados y los poliinsaturados que constituyen las grasas animales y los aceites de
semillas, respectivamente. Estos cidos grasos monoinsaturados son mucho ms
establesquelospoliinsaturadosantelosprocesosoxidativos.Y,ensegundolugar,por
suscomponentesminoritarios,entrelosquedestacanlostocoferoles,especialmente
eltocoferolovitaminaE,elcaroteno(precursordelavitaminaA)ylospolifenoles,
conimportantesfuncionesantioxidantes.

De esta manera, el aceite de oliva ha demostrado ser el mejor tolerado por el


estmago, con efectos beneficiosos sobre el estreimiento crnico y las lceras
gatroduodenales, a la vez que favorece la actuacin de la vescula biliar. Del mismo
modo, un consumo constante y adecuado de aceite de oliva virgen reduce la
incidencia de las enfermedades cardiovasculares, ya que, tanto el cido oleico
(principal cido graso monoinsaturado del aceite de oliva), como los compuestos


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
268 Captulo6

antioxidantes, tienen efectos protectores y son capaces de reducir la aterosclerosis.


Con respecto a los procesos cancergenos, en los que estn implicados fenmenos
oxidativos, algunos estudios relacionan la ingesta de aceite de oliva virgen con la
disminucin de la aparicin de ciertos tipos de cncer, por la accin de los
compuestosantioxidantes.Asimismo,esteproductobsicodeladietamediterrnea
mejoralarespuestainmunolgica,ayudaacontrolarelniveldeglucosaensangrey,
gracias a su accin positiva sobre el estado oxidativo celular, incide directamente
sobre el envejecimiento, ralentizndolo, lo que a su vez repercute sobre todas
aquellasenfermedadesdegenerativasasociadasal[1,2,1014,23].

6.3.ELAROMADELACEITEDEOLIVAVIRGEN

El aroma caracterstico del aceite de oliva virgen, recin obtenido y de calidad,


estconstituidoporvoltilespertenecientesadiversasfamilias(aldehdos,alcoholes,
cetonas, steres) que se producen, principalmente, a travs de distintas rutas
bioqumicas[24,25].Estoscompuestosaromticos,queformanpartedelafraccin
insaponificabledelaceite,segenerandurantelasprimerasfasesdeextraccinenla
almazara(eltrituradoyelbatido)yapartirdeloscomponentesdelasaceitunas[2].

Analizando la fraccin aromtica del aceite de oliva virgen, es interesante


comprobar que el 6080% de la misma est constituida por compuestos C5 y C6,
independientemente de la variedad y zona de produccin [26]. Esto se debe al
mecanismodeformacindeestassustancias,queestrelacionadoconlaaccinde
algunasenzimassobreloscidosgrasoslinoleicoylinolnico[27].Estoscidosgrasos
forman los lpidos de las membranas celulares de los frutos y se rompen durante la
molienda,loquepermitequelasenzimaslipoxigenasaehidroperxidoliasapuedan
actuar sobre ellos. Estas enzimas oxidan y escinden, respectivamente, estos cidos
grasos poliinsaturados liberados, de manera que se generan aldehdos con 5 6
tomosdecarbonoensuestructura.Estosaldehdossonposteriormentereducidosa


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 269

alcoholes por las alcohol deshidrogenasas y, en ltima instancia, la alcohol


aciltransferasaesterificadichosalcoholeshastaproducirsteres[25].

El anlisis del aroma del aceite de oliva ha sido estudiado por diversos
investigadoresdesdeladcadadelos70.Inicialmente,elobjetivoeraidentificarlos
compuestos responsables del aroma [2830], pero desde un principio se vio que los
aceites procedentes de distintas regiones, aunque con una composicin voltil
cualitativa similar, diferan notablemente en su composicin cuantitativa [29, 30].
Graciasaestehecho,pasacaracterizarseelaromadelaceitedeolivaparaaveriguar
el efecto que sobre l ejercen distintas variables (variedad, climatologa, procesos
tecnolgicos,etc.)[31].

De este modo, el estudio de los compuestos voltiles ha permitido discriminar


losaceitesenfuncindelavariedadyelestadodemaduracindelasaceitunas[32],
de la calidad, la variedad y el origen geogrfico [33], o, incluso, en funcin de los
mtodos de extraccin empleados [34]. De la misma manera, estos compuestos
voltiles han podido relacionarse con los atributos sensoriales que presenta el
productofinal[26].

Partedelasinvestigacionessehancentradotambinenanalizarelorigendelos
compuestosaromticos,estudiandoparaellolasenzimasimplicadasenlasdistintas
rutasmetablicas[27,35,36].Peronoslointeresaconocerculeselorigendelas
sustancias responsables del aroma: la evolucin de esos odorantes a lo largo de la
vidatildelproductotambinconstituyeunimportantecampodeestudio,dadasu
estrecharelacinconlacalidadorganolptica.

Existen distintos factores capaces de alterar el perfil aromtico del aceite de


oliva, entre los que destacan la luz, el oxgeno, la temperatura y la presencia de
metales [11]. Todos ellos provocan un incremento de la oxidacin, cuyo efecto ms
importantesobrelascaractersticassensorialeseslaaparicindeoloresindeseables
por el desarrollo de ciertos productos secundarios de oxidacin voltiles [15, 37].


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
270 Captulo6

Estos compuestos pueden ser empleados como indicadores delestado oxidativo del
aceite y, por tanto, de su calidad [3840]. Sin embargo, tambin se ha demostrado
queelusodeatmsferasprotectorasescapazdemejorarlaestabilidadyreducirlos
efectosdelaoxidacin[41,42].

Estosprocesossedanprincipalmenteduranteelalmacenamiento,porloquees
interesante conocer cul es su evolucin en este perodo de tiempo, con objeto de
controlarlosygarantizarlaestabilidadycalidaddelaceitedeoliva[43].Perolagran
mayora de los trabajos realizados hasta ahora han simulado las condiciones
generalmente implicadas en este almacenamiento, forzndolas para acelerar el
proceso[37,38,40].Existenmuypocasinvestigacionesenlasquesehayahechoun
seguimientodelprocesonatural[44].

Por ese motivo, en el trabajo que se expone a continuacin y que ha sido


enviadoalarevistaFoodControlparasupublicacin,seconsiderinteresanteevaluar
los efectos que un almacenamiento natural, no forzado, tiene sobre el aroma y los
parmetrosqumicosdecalidaddelaceitedeolivavirgen,alavezqueseestudiabala
accinejercidapordistintasatmsferasprotectoras[45].Ademsdelostradicionales
parmetros qumicos de calidad y de la evaluacin sensorial, se analizaron los
compuestos voltiles implicados en el aroma del producto por cromatografa de
gasesolfatometra (GCO). De esta manera, se ha podido establecer cul es la
evolucinindividualdecadacompuestoaromticamenteactivoalolargodetodoun
ao, que, dado el carcter anual de la produccin del aceite de oliva, es lo que se
considerasuperodonormaldeconsumoyvidatil.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 271

BIBLIOGRAFA
[1] MataixVerd,J.,BarbanchoCisneros,F.J.Elaceitedeoliva,almadelmediterrneo.Jan:
Instituto de Estudios Giennenses (Diputacin de Jan), Universidad de Jan (Servicio de
Publicaciones);2008.
[2] Boatella Riera, J., Contreras, J., coordinadors. Els olis doliva de Catalunya. Barcelona:
GeneralitatdeCatalunya.DepartamentdAgricultura,RamaderiaiPesca,Ediciones62,S.
A.;2006.
[3] Sol Alberich, R. El aceite deoliva. En: Rodrguez Pozo, ., editor. Dieta mediterrnea y
salud.Lrida:EdicionsdelaUniversitatdeLleida;1999,p.3946.
[4] Rae.es,RealAcademiaEspaola[Internet].Madrid:Rae.es;[acceso14deenerode2011].
Disponibleen:http://www.rae.es.
[5] PresidenciadelGobierno(1983).RealDecreto308/1983de 25deenero,BoletnOficial
delEstadonm.44de21defebrero,porelqueseapruebalareglamentacintcnico
sanitariadeaceitesvegetalescomestibles.
[6] Comisin (1991). Reglamento (CEE) 2568/1991 de 11 de julio, Diario Oficial Legislacin
nm.248de5deseptiembre,porelqueseestablecenlascaractersticasdelosaceites
deolivaydelosaceitesdeorujodeolivaysusmtodosdeanlisis.
[7] Consejo(2004).Reglamento(CE)865/2004de29deabril,DiarioOficialLegislacinnm.
206de9dejunio,porelqueseestablecelaorganizacincomndelmercadodelaceite
deolivaydelasaceitunasdemesa.
[8] Madrid Vicente, A., Madrid Cenzano, J., coordinadores. Legislacin y normas sobre el
aceitedeolivaylasaceitunasdemesa.Madrid:A.MadridVicente,EdicionesyEdiciones
MundiPrensa;2002.
[9] Civantos,L.,Contreras,R.,Grana,R.Obtencindelaceitedeolivavirgen.Madrid:Editorial
AgrcolaEspaola,S.A.;1992.
[10] Civantos,L.Elolivo,elaceite,laaceituna.Madrid:ConsejoOlecolaInternacional;1998.
[11] Kiritsakis,A.K.Elaceitedeoliva.Madrid:A.MadridVicente,Ediciones;1992.
[12] Sotiroudis,T.G.,Kyrtopoulos, S.A. Anticarcinogeniccompoundsofoliveoilandrelated
biomarkers.Eur.J.Nutr.2008;47:6972.
[13] Bester,D.,Esterhuyse,A.J.,Truter,E.J.,vanRooyen,J.Cardiovasculareffectsofedible
oils:acomparisonbetweenfourpopularedibleoils.Nutr.Res.Rev.2010;23:334348.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
272 Captulo6

[14] Covas, M. I., RuizGutirrez, V., de la Torre, R., Kafatos, A., LamuelaRavents, R. M.,
Osada, J., Owen, R. W., Visioli, F. Minor components of olive oil: evidence to date of
healthbenefitsinhumans.Nutr.Rev.2006;64:2030.
[15] Morales,M.T.,Przybylski,R.Oxidacindelaceitedeoliva.En:Aparicio,R.,Harwood,J.,
editores.Manualdel aceite deoliva.1edicin.Madrid: A. MadridVicente,Ediciones y
EdicionesMundiPrensa;2003,p.443473.
[16] Norma COI/T.20/Doc. n 4/Rev. 1 de 16 de noviembre de 2007 Anlisis sensorial:
vocabulariogeneralbsico.
[17] NormaCOI/T.20/Doc.n5/Rev.1de16denoviembrede2007Copaparaladegustacin
deaceites.
[18] NormaCOI/T.20/Doc.n6/Rev.1de16denoviembrede2007Guaparalainstalacin
deunasaladecata.
[19] Norma COI/T.20/Doc. n 13/Rev. 1 de 16 de noviembre de 2007 Metodologa general
paralavaloracinorganolpticadelaceitedeolivavirgen.
[20] NormaCOI/T.20/Doc.n14/Rev.2de16denoviembrede2007Guaparalaseleccin,
elentrenamientoyelcontroldeloscatadorescualificadosdeaceitedeolivavirgen.
[21] Norma COI/T.20/Doc. n 15/Rev. 2 de 16 de noviembre de 2007 Metodologa general
paralavaloracinorganolpticadelaceitedeolivavirgen.
[22] Alba,J.,Izquierdo,J.R.,Gutirrez,F.Aceitedeolivavirgen.Anlisissensorial(lacatade
aceitedeolivavirgen).Madrid:EditorialAgrcolaEspaola,S.A.;1997.
[23] Viola,P.Elaceitedeolivaylasalud.Madrid:ConsejoOlecolaInternacional;1997.
[24] Morales,M.T.,Tsimidou,M.Elpapeldeloscompuestosvoltilesylospolifenolesenla
calidad sensorial del aceite de oliva. En: Aparicio, R., Harwood, J., editores. Manual del
aceite de oliva. 1 edicin. Madrid: A. Madrid Vicente, Ediciones y Ediciones Mundi
Prensa;2003,p.381441.
[25] Snchez,J.,Salas,J.J.Biognesisdelaromadelaceitedeoliva.En:Aparicio,R.,Harwood,
J.,editores.Manualdelaceitedeoliva.1edicin.Madrid:A.MadridVicente,Edicionesy
EdicionesMundiPrensa;2003,p.89107.
[26] Morales, M. T., Alonso, M. V., Ros, J. J., Aparicio, R. Virgin olive oil aroma: relationship
between volatile compounds and sensory attributes by chemometrics. J. Agric. Food
Chem.1995;43:29252931.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Elaceitedeoliva 273

[27] Angerosa, F., Mostallino, R., Basti, C., Vito, R. Virgin olive oil odour notes: their
relationships with volatile compounds from the lipoxygenase pathway and secoiridoid
compounds.FoodChem.2000;68:283287.
[28] Flath,R.A.,Forrey,R.R.,Guadagni,D.G.Aromacomponentsofoliveoil.J.Agric.Food
Chem.1973;21:948952.
[29] Lercker,G.,Capella,P.,Deserti,P.Volatileandaromaticcompoundsofextravirginolive
oils.Sc.Techn.Alim.1973;3:299303.
[30] Reiners,J.,Grosch,W.Odorantsofvirginoliveoilswithdifferentflavorprofiles.J.Agric.
FoodChem.1998;46:27542763.
[31] Aparicio,R.Caracterizacindelaceitedeolive:procedimientosmatemticosaplicablesal
anlisis qumico. En: Aparicio, R., Harwood, J., editores. Manual del aceite de oliva. 1
edicin. Madrid: A. Madrid Vicente, Ediciones y Ediciones MundiPrensa; 2003, p. 281
344
[32] Kalua,C.M.,Allen,M.S.,BedgoodJr.,D.R.,Bishop,A.G.,Prenzler,P.D.Discriminationof
olive oils and fruits into cultivars and maturity stages based on phenolic and volatile
compounds.J.Agric.FoodChem.2005;53:80548062.
[33] Guadarrama, A., RodrguezMndez, M. L., Sanz, C., Ros, J. L., de Saja, J. A. Electronic
nose based on conducting polymers for the quality control of the olive oil aroma
discrimination of quality, variety of olive and geographic origin. Anal. Chim. Acta 2001;
432:283292.
[34] Ranall, A., Gomes, T., Delcuratolo, D., Contento, S., Lucera, L. Improving virgin olive oil
qualitybymeansofinnovativeextractingbiotechnologies.J.Agric.FoodChem.2003;51:
25972602.
[35] Luaces, P., Sanz, C., Prez, A. G. Thermal stability of lypoxygenase and hydroperoxide
lyase from olive fruit and repercussion on olive oil aroma biosynthesis. J. Agric. Food
Chem.2007;55:63096313.
[36] Padilla, M. N., Hernndez, M. L., Prez, A. G., Sanz, C., MartnezRivas, J. M. Isolation,
expression,andcharacterizationofa13hydroperoxidelyasegenefromolivefruitrelated
to the biosynthesis of the main virgin olive oil aroma compounds. J. Agric. Food Chem.
2010;58:56495657.
[37] Morales,M.T.,Ros,J.J.,Aparicio,R.Changesinthevolatilecompositionofvirginolive
oilduringoxidation:flavorsandoffflavors.J.Agric.FoodChem.1997;45:26662673.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
274 Captulo6

[38] Vichi, S., Pizzale, L., Conte, L. S., Buxaderas, S., LpezTamames, E. Solidphase
microextraction in the analysis of virgin olive oil volatile fraction: modifications induced
by oxidation and suitable markers of oxidative status. J. Agric. Food Chem. 2003; 51:
65646571.
[39] Kanavouras, A., HernndezMuoz, P., Coutelieris, F., Selke, S. Oxidationderived flavor
compounds as quality indicators for packaged olive oil. J. Am. Oil Chem. Soc. 2004; 81:
251257.
[40] Luna,G.,Morales,M.T.,Aparicio,R.ChangesinducedbyUVradiationduringvirginolive
oilstorage.J.Agric.FoodChem.2006;54:47904794.
[41] DiGiovacchio,L.,Mucciarella,M.R.,Costantini,N.,Ferrante,M.L.,Surricchio,G.Useof
nitrogentoimprovestabilityofvirginoliveoilduringstorage.J.Am.OilChem.Soc.2002;
79:339344.
[42] Bacchiocca,M.,Biagiotti,E.,Ninfali,P.,Ambrogetti,M.Oxidationofextravirginoliveoils
keptundercontrolledatmosphere.Ind.Aliment.2001;409:13211325.
[43] Bendini, A., Cerretani, L., Salvador, M. D., Fregapane, G., Lercker, G. Stability of the
sensoryqualityofvirginoliveoilduringstorage:anoverview.Ital.J.FoodSci.2009;21:
389406.
[44] GmezAlonso, S., ManceboCampos, V., Salvador, M. D., Fregapane, G. Evolution of
majorandminorcomponentsandoxidation indicesof virginolive oilduring21months
storageatroomtemperature.FoodChem.2007;100:3642.
[45] Acea, L., Vera, L., Guasch, J., Busto, O., Mestres, M. Evolution of Arbequina olive oil
aroma and oxidation status over time under different atmospheres. Food Control. 2011
(enviadoparasupublicacin).


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

EvolutionofArbequinaoliveoilaromaandoxidationstatus
overtimeunderdifferentatmospheres

Artculoenviadoparasupublicacinenlarevista
FoodControl(2011)


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

EvolutionofArbequinaOliveOilAromaandOxidationStatusovertimeunderdifferent
Atmospheres

LauraAcea,LucianoVera,JosepGuasch,OlgaBusto,MontserratMestres

ResearchGroupofAnalyticalChemistryofWineandFood

DepartmentofAnalyticalChemistryandOrganicChemistry

CampusSescelades.FacultatdEnologiadeTarragona

UniversitatRoviraiVirgili.43007Tarragona(Spain)

ABSTRACT

InthispaperthenaturalevolutionofArbequinaextravirginoliveoilduringitsusualmaximumshelf
life (12 months) under three different atmospheres (air, nitrogen and argon) is reported.
Considering the regulations of the European Commission, this evolution was assessed by the
spectrophotometric absorbance at 232 nm and 270 nm, the peroxide values and the sensory
analysis.Tobetterunderstandthearomaticchanges,wealsoevaluatedtheevolutionofthevirgin
olive oil aromatic composition over time by gas chromatographyolfactometry (GCO). To get
representative aroma extracts to be analysed by GCO, the solidphase microextraction applied to
theheadspaceofthesample(HSSPME)wasoptimized.Theresultsobtainedshowedthatalthough
the values of the parameters evaluated worsened over time whatever the atmosphere used, this
evolution was slowed down when the extra virgin olive oil was bottled under a protective
atmosphere. However, among the different parameters considered, the sensory analysis is much
sensitive and able to detect oxidative deterioration at earlier stages than other parameters.
FurthermoreandtheapplicationoftheGCOallowedcorrelatingtheevolutionoftheoliveoilaroma
withitschemicalcomposition.

Keywords: Olive oil, aroma, evolution, oxidation, solidphase microextraction (SPME), gas
chromatographyolfactometry(GCO)


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
278 FoodControl(2011)

1.INTRODUCTION

SincethefirstcultivationofolivetreesinCreteduringtheEarlyMinoantimes,about3500BC,olive
oilhasbeenanessentialcomponentofthedietinmanyMediterraneancivilizations(MataixVerd
&BarbanchoCisneros,2008;Riley,2002).

Oliveoilisobtainedbygrindingolivesandextractingtheliquidobtainedbymechanicalorchemical
treatments,althoughonlythefirstonescanbeusedwhentheaimistoobtainextravirginorvirgin
olive oil. As they are the least processed forms of olive oil, these extra virgin and virgin olive oils
havemoremonounsaturatedfats,mainlyoleicacid.Thefattyacidprofilesofthesetwotypesofoils,
together with the presence of minor amounts of phenolic constituents, have demonstrated to
provide great health benefits (Mataix Verd et al., 2008; Preedy & Watson, 2010). However, this
monounsaturationalsopromotesashorteroliveoilshelflife,asitispronetobecomerancidfrom
oxidationwhichwillproducechangesonitshighnutritionalvalueandorganolepticcharacteristics.

Takingintoaccounttheproblemthatposesoliveoiloxidation,boththeconditionspreventingthe
spreading of this process and the presence of antioxidants play an important role on the
preservation ofolive oil quality. Thus, theeffect of various compounds on virgin olive oil stability,
suchastocopherols,carotenoids,chlorophylls,phenoliccompoundsorfattyacids,hasbeenstudied
(Aparicio, Roda, Albi & Gutirrez, 1999; Baldioli, Servili, Perretti & Montedoro, 1996; Gallardo
Guerrero, GandulRojas, Roca & MnguezMosquera, 2005; GutirrezRosales, GarridoFernndez,
GallardoGuerrero, GandulRojas & MinguezMosuera, 1992; InarejosGarca, Santacatterina,
Salvador,Fregapane&GmezAlonso,2010;Morell,Vuorela,Romero,Motilva&Heinonen,2005;
Okogeri & TasioulaMargari, 2002; Papadopoulos & Boskou, 1991; Zunin, Leardi, Bisio, Boggia &
Romusi,2010), aswellastheeffectofdifferentpackagingvariables,suchastemperature,lightor
atmosphereamongothers(Caponio,Bilancia,Pasqualone,Sikorska&Gomes,2005;DiGiovacchino,
Mucciarela,Constantini,Ferrante&Surricchio,2002;GmezAlonso,ManceboCampos,Salvador&
Fregapane,2007;Grigoriadou&Tsimidou,2006;GuilGuerrero,2009;Gutirrez&Fernndez,2002;
Kanavouras&Coutelieris,2006;Vekiari,Papadopoulou&Kiritsakis,2007).

Althoughthegreatpartofthestudiesaboutthevirginoliveoiloxidationevaluatesqualityindexes,
therearealsoseveralstudiesfocusedontheorganolepticchangesbecausethedeteriorationofthe
characteristic sensorial properties implies a loss of quality. Therefore, to emulate this oxidation
processandtodeterminetheevolutionoftheoliveoilaromacompounds,sometechniquessuchas
accelerated thermoxidation (Morales, Ros & Aparicio, 1997) or UV radiation (Luna, Morales &
Aparicio,2006)havebeenapplied.However,thereisasignificantgapintheliteratureregardingthe
naturalevolutionofvirginoliveoilaromaovertime(i.e.withnotforcedoxidation).Indeed,usually,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 279

studiesconsideringlongperiodsoftimeonlyevaluatequalityindexessuchasacidity,peroxidevalue
or extinction coefficients k232 and k270 (GallardoGuerrero et al., 2005; GmezAlonso et al., 2007;
GuilGuerrero, 2009) and, when considering the evolution of the volatile composition (Cavalli,
Fernndez, LizzaniCuvelier & Loiseau, 2004; Di Giovacchino et al., 2002), the aroma has been
evaluatedasawholewithglobalscores(DiGiovacchinoetal.,2002).

The purpose of the present paper is to study the natural evolution of olive oil during its usual
maximum shelflife (12 months) under three different atmospheres: air, nitrogen and argon.
Considering the European Union regulations (EC 2568/1991; EC 796/2002), this evolution was
assessedbyspectrophotometricabsorbanceat232nm,spectrophotometricabsorbanceat270nm,
peroxide values and sensory analysis. To better understand the aromatic changes, we also
determinedtheevolutionofthevirginoliveoilqualitativecompositionbyobtainingrepresentative
aroma extracts with the Solid Phase Microextraction applied to the headspace of the sample (HS
SPME)andanalysingthemwithgaschromatographyolfactometry(GCO).

2.MATERIALSANDMETHODS

2.1.Samples

Thevirginoliveoilusedinthisstudybelongedtotheextravirginoliveoil(EVOO)class(according
totheEuropeanCommissionregulations)andwaselaboratedinanindustrialoilmillfromfreshand
matureolivescv.Arbequinaofgoodquality,producedinnortheasternpartofSpain.Therecently
extracted EVOO was distributed in 45 different dark glass bottles: 15 of them were filled under
nitrogenatmosphere,other15werefilledunderargonatmosphereandthelast15werenormally
filled (i.e. without inert atmosphere). Samples were stored from January to December avoiding
directsunlightandconsideringanormalannualcycleoftemperatureinamarketoilstorage(which
rangedfrom30Cinsummeruntil10Cinwinter).Threesamplesstoredundereachatmosphere
wereanalysedrightafterpackagingandalsoafter3,6,9and12monthsinthebottle.

2.2.ReagentsandChemicals

The chemical standards of the aroma compounds were supplied by SigmaAldrich (Madrid, Spain)
and Lancaster (Bischheim, France) and their purity was above 90%. The other chemicals and
reagents used were purchased from Scharlab (Barcelona, Spain). All of them were of analytical
grade,except2,2,4trimethylpentane(isooctane),thatwasofspectroscopygrade.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
280 FoodControl(2011)

The synthetic sample used to evaluate the response (both SPME and sensory) over time was
obtainedbyaddingtoadeodorizedparaffinoil(usedforahighvacuumpump)somedifferentolive
oilvolatilesattheusualrangeofconcentrationofthesecompoundsinrealEVOO(Lunaetal.,2006;
Reiners & Grosch, 1998; Ouni et al., 2011; Tena, Lazzez, AparicioRuiz & GarcaGonzlez, 2007):
hexanal(2mgKg1),(E)2hexenal(10mgKg1),(E,E)2,4nonadienal(0.05mgKg1),ethylisobutyrate
(0.05mgKg1),1octen3one(0.01mgKg1),aceticacid(10mgKg1)and(Z)3hexenol(1mgKg1).

2.3.Analyticaldeterminations

TofollowtheEVOOevolutionwedeterminedtheperoxidevalue(PV)andtheUVspecificextinction
coefficients K232 and K270. PV was obtained after treatment of the olive oil in acetic acid and
chloroformbyasolutionofpotassiumiodideinthedark;theliberatediodinewasthentitratedwith
standardizedsodiumthiosulphatesolutionandtheresultwasexpressedasmilliequivalentsofactive
oxygenperkgofoil.TheUVspecificextinctioncoefficientswerecalculatedfromabsorptionofthe
olive oil dissolved in isooctane at 232 nm and 270 nm. In all cases we followed the analytical
methodsdescribedintheEuropeanUnionRegulation(EC2568/1991).

2.4.SensoryAnalysis

ThearomaevolutionoftheEVOOspackagedunderthethreedifferentatmosphereswasevaluated
by a panel of 8 trained assessors. The descriptors employed were selected considering the
indicationsspecifiedinAnnexXIIoftheEuropeanUnionRegulation(EC2568/1991)whichsetsthe
criteria required for organoleptic assessment of EVOO and also specify the specific vocabulary
developed for this purpose. The assessors were firstly familiarized with these descriptors and
trainedbyevaluatingdifferentoliveoilsatdifferentdegreesofoxidation.Thetrainingwascarried
outtwiceaweekduringfiveconsecutivelyweeks,lastingeachsession60minutes.Then,theywere
askedtoagreewiththemostrepresentativedescriptorsforthepositiveandalsoforthenegative
attributes. The positive descriptors were: green, fruity, bitter and pungent. Regarding to the
negativeattributes,theassessorsselectedthefollowingones:musty,vinegary,metallic,rancidand
greasy.

Relatedtotheevaluationofthesamples,assessorsevaluatedtheodourofthedifferentoliveoilson
a discontinuous scale for each descriptor from 0 (not detected) to 5 (maximum detection). The
coefficientsofvarianceofeachsinglepanellistforeverysamplereplicateswerelessthan10%.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 281

Asitcanbeobserved,thesensoryanalysesperformedinthisstudydifferfromtheonescarriedout
to get the grading of an olive oil. Indeed, although we chose some of the sensory descriptors
recommendbytheInternationalOliveOilCouncil(IOOC)andtheEuropeanUnionRegulations,the
scale used is a different one as the purpose is not to classify olive oils but to follow the aroma
evolutionofanextravirginoliveoilunderdifferentatmospheresovertime.

2.5.SamplingofvolatilesbyHSSPME

The volatile compounds of EVOOs were extracted and concentrated by using the solidphase
microextraction(SPME)appliedtotheheadspace(HS)ofthesamples(HSSPME)andemployingthe
StableFlex DivinylbenzeneCarboxenPolydimethylsiloxane (DVBCARPDMS) fibre with a film
thicknessof50/30m(Supelco,Bellefonte,PA)and2cmlong.Thus,5gofsamplewerepouredinto
a20mlglassvialwithalittlemagneticstirbar.Aftertightlycappingthevialwithasiliconseptum,it
waskept30minat40Cinathermostaticbath.Then,thefibrewasexposedtotheheadspacefor1
h.Afterextraction,itwasremovedfromthevialandinsertedintothesplitsplitlessinjectionportof
theGCforthermaldesorptionoftheanalytesat270Cfor1minuteinthesplitlessmode.Allthe
fibreswereconditionedbeforeuseandthermallycleanedbetweenanalysesbyinsertingtheminto
theGCinjectionportatthetemperaturerecommendedbythesupplier.

2.6.GasChromatographyOlfactometry(GCO)

The olfactometric analyses were performed with a HewlettPackard (HP, Palo Alto, USA) 6890 gas
chromatographequippedwithaflameionizationdetector(FID)andanolfactorydetector.Thesplit
splitlessinjectionportoperatedinthesplitlessmodeat270Cfor1min,usinganinletlinerof0.75
m i.d. to minimize peak broadening. The temperature of the FID was set at 250 C.
Chromatographic separations were performed using a Chrompack (Varian, Middelburg, The
Netherlands)CPWax57CB(50mx0.25mmi.d.,0.2mfilmthickness)fusedsilicacapillarycolumn
withheliumascarriergasataconstantflowrateof1mLmin1.Theoventemperatureprogramwas:
40C(2min),6Cmin1to225C(30min).Thecolumnusedtoverifytheidentityofthecompounds
wasaHP5MS(AgilentTechnologies,USA)(30mx0.25mmi.d.,0.25mfilmthickness)fusedsilica
capillary column with helium as carrier gas at a constant flowrate of 1 mL min1. The oven
temperature program was 40 C (5 min), 2 C min1 to 120 C and then 10 C min1 to 210 C (30
min).


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
282 FoodControl(2011)

The olfactory detector employed to carry out the GCO analyses was commercialized by SGE
International(Ringwood,Australia).Thisdevicehasanoutletsplittersystem(ODOI)thatprovidesa
variable range of split ratios by a micro control valve (OSS2). The split ratio used in the
olfactometric analysis was 1:10 into the FID and into the sniffing port, respectively, achieved by
using two deactivated and uncoated fused silica capillaries (40 cm x 0.25 mm) as transfer lines
between the valve and the detectors. The olfactory detector also incorporates a heated transfer
sectionfromtheGCoventotheglassdetectionconethatmaintainstheunitatatemperaturehigh
enough to transfer the compounds to the detection cone without losses due to condensation.
Moreover,theglassconeispurgedwithhumidifiedairtopreventnasalmucousmembranesfrom
dryingoutoverlongperiodsofsniffing,whichhelpsmaintainingolfactorysensitivity.

Timing,intensityanddescriptionofaromaswererecordedbythreetrainedresearchersreplacedat
15minintervals.Eachsamplewasolfactometricallyanalysedsixtimesusingdifferentfibresandin
suchwaythateveryanalystsniffedallthechromatographicregionstwice.

2.7.CompoundsIdentification

Theodorantsdetectedwereidentifiedbycomparisonwithreferencesubstancestakingintoaccount
the odour quality perceived at the sniffing port, the retention index (RI) on the two stationary
phases of different polarity above specified and the mass spectra obtained. To calculate the RI
values,weaddedaseriesofnalkanes(from6to26carbonatoms)toanEVOOsamplewhichwas
extractedbySPMEandanalysedundertheGCconditionsaforementioned.

The mass spectra of the different odorants were obtained using a HewlettPackard 6890 gas
chromatograph coupled to a HewlettPackard 5973 quadrupole mass spectrometer. Mass spectra
were recorded by electronic impact ionization at 70 eV. The interface, ion source and mass
quadrupole temperatures were 200 C, 230 C and 150 C respectively. The masstocharge (m/z)
ratiorangeusedwas35300.Thesplitsplitlessinjectionportoperatedinthesplitlessmodeat270
Cfor1minandchromatographicseparationwascarriedoutunderthesameconditionspreviously
describedforGCO.

3.RESULTSANDDISCUSSION

WechosetheSpanishcultivarcv.Arbequinabecause,asreportedinliterature(Moralesetal.,1997),
itisrepresentativeofasubstantialproportionofthebottledoliveoiltradedinEurope.Moreover,


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 283

sincethisvarietyshowsmajorqualitychangesthoroughthestoragethanothersusuallycultivatedin
SpainsuchasPicualorHojiblanca(GuilGuerrero,2009),itseemedtobemoreappropriatetobetter
detectthepossiblechangesproducedduringthestorageperiod.

Inaddition,sincelightisoneofthemostimportantvariablesthatinfluencesontheEVOOoxidation
(GuilGuerrero,2209;Gutirrezetal.,2002;Velasco&Dobarganes,2002),sampleswerestoredin
dark glass bottles. In that way, we avoided the main contribution to the oxidation of the samples
duringstoragewhichcoulddistorttheevaluationoftheeffectofthedifferentatmospheres.

3.1.AnalyticalDeterminations

Figure1showstheevolutionoftheperoxidevalues(PVs)that,ascanbeseen,presentedadifferent
behaviour depending on the atmosphere considered. Thus, when the EVOO was stored under air,
thePVsignificantlyincreased(<0.05)throughoutthetimestudied,butmainlyuntilthe9thmonth.
The last stretch seemed to reach a decrease in oxygen availability which would avoid further
peroxide production and, therefore, slow down the increase of the PV. However, when the EVOO
wasstoredwithaninertgas,itcouldbeobservedasignificantincrease(<0.05)onthePVsalong
the first trimester for both the argon (Ar) and the nitrogen (N2) samples but then, this parameter
raisedmoreslightlyanditsvalueswerealwayssignificantlylower(<0.05)thanthosecorresponding
totheair.ThisbehaviourcouldbeattributedtothefactthattheEVOOpouredintothedarkbottles
under inert atmosphere contained oxygen dissolved which could have oxidized the oil at the
beginningofthestorage.Ontheotherhand,whencomparingthetwoinertgasesevaluated,itcan
be stated that, although the PVs corresponding to the Ar atmosphere were always slightly lower
than the ones obtained for the N2 atmosphere, the differences between both gases were not
significant(<0.05).

Peroxid Value

20,0

15,0
Air
10,0 Ar
N2
5,0

0,0
0 months 3 months 6 months 9 months 12 months

Figure1.Evolutionoftheperoxidevaluesovertimeandunderthethreedifferentatmospheresstudied


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
284 FoodControl(2011)

When evaluating K232 values, there was a correlation with peroxide values that agreed with other
studies(DiGiovacchinoetal.,2002;GmezAlonsoetal.,2007;Grigoriadouetal.,2006).Thetrend
ofk232valueissimilartothatofPVasitalsoincreasedprogressivelywhenairwastheatmosphere
considered (Figure 2). Indeed, the sample without protective atmosphere slightly exceeded the
maximumvalueallowedforanEVOO(2.5)after12monthsofstorage.Therefore,sincethek232was
thefirstindexexceedingtheupperlimitestablishedbytheEuropeanUnionregulationforEVOO,it
couldbeausefulindextodeterminethecommercialclassificationofoliveoil.However,asoccurred
whendealingwithPVs,themostimportantincrementtookplaceafter69monthsofstorage.This
couldbeduetothefactthatthisperiodoftimecoincidedwiththewarmermonthsandthehigher
temperatures could enhance this increment (Di Giovacchino et al., 2002; Gutirrez et al., 2002;
Vichi,Pizzale,Conte,Buxaderas&LpezTamames.,2003a).Relatedtothepresenceofaninertgas,
itcouldbecheckedthatthisfacthelpedtoreducetheincreaserateoftheK232and,althoughduring
thefirstmonthsofstorageweobservedaslightincreaseofthisparameter,after36months,this
parameter nearly became constant. Thus, from the third month it could be observed that the
highestK232valuescorrespondedtotheEVOOstoredunderairand,fromthesixthone,thevaluesof
this parameter coming from samples stored under inert atmosphere were significantly lower
(<0,05)thanthevaluescomingfromsamplesstoredwithair.

K232

3,00

2,50

2,00 Air
1,50 Ar
1,00 N2

0,50

0,00
0 months 3 months 6 months 9 months 12 months

Figure2.EvolutionoftheK232valuesovertimeandunderthethreedifferentatmospheresstudied

RegardingK270valuechangesduringEVOOstorage,thesearegraphicallypresentedinFigure3.Inall
cases,K270valueswereunderthelimitsestablishedbytheEuropeanUnionregulations(K2700.20).
Asitcanbeseen,whenthestorageatmospherewasaninertgas,theslightincrementoftheK270
value observed was not significant for any period of time evaluated. However, when using air as
storageatmosphere,thevalueofthisparameterincreasedsignificantlyovertimeexceptduringthe
last trimester. Nevertheless, although some studies state that this variation during storage makes
this parameter suitable for determining the time at which an EVOO will lose its extra category


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 285

(Gutirrezetal.,2002),inthisstudy,andaccordingtootherresearchers(GmezAlonsoetal.,2007;
GuilGuerrero,2009),thisbehaviourwasnotobserved.Moreover,thesestudiesalsoconcludethat
low temperatures help the stability of this parameter. This temperature effect could be also
observed in Figure 3 where it is shown that the slighter increase of the K270 parameter occurred
throughout the first and the last trimesters which corresponded to the cooler months (January
March)and(OctoberDecember).

K270

0,20

0,15
Air
0,10 Ar
N2
0,05

0,00
0 months 3 months 6 months 9 months 12 months

Figure3.EvolutionoftheK270valuesovertimeandunderthethreedifferentatmospheresstudied

3.2.SensoryAnalysis

The results obtained by the panel when evaluating the fresh packaged EVOO showed an olive oil
aromawithcleargrass,green,almond,artichokeandtomatoconnotationsaswellasnotesofapple,
ripebananaandgreennuttogetherwithaslightlypungentsensation.Thesesensorycharacteristics
aresimilartotheonesdescribedinpreviousstudiesrelatedtoArbequinavariety(Lunaetal.,2006).
As expected, the evaluation of the olive oils over time showed a decrease in the intensity of the
positiveattributeswiththestoragetimewhatevertheatmospheretested.However,theintensityof
the negative ones, which showed very low values initially, did not display important variations
except for the rancid and greasy attributes that showedan increase mainly when dealing without
inertatmosphere.Theresultsareshowedgraphicallyinthespiderwebdiagrams(Figure4).Morales
etal.(1997)foundsimilarresultswhenEVOOwassubjectedtoathermoxidationprocesssincethe
initialflavouralsodisappearedinafewhours.TheEVOObecamethenrancidandwasdescribedas
used oil. However, in that case the oxidation was forced and prolonged for several hours, what
resulted in unpleasant, rancid and penetrating aromatic notes that we did not find because our
EVOOwasonlysubjectedtonaturaloxidation.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
286 FoodControl(2011)

3months 6months

Pungent Pungent
4,0 4,0
Vinegary 3,0 Fruity Vinegary 3,0 Fruity

2,0 2,0
1,0 Musty 1,0 Bitter
Musty Bitter
0,0 0,0

Metallic Green
Metallic Green
Rancid Greasy/fatty
Rancid Greasy/fatty

9months 12months

Pungent Pungent
4,0 4,0
Vinegary 3,0 Fruity Vinegary 3,0 Fruity
2,0 2,0
Musty 1,0 Bitter 1,0
Musty Bitter
0,0 0,0

Metallic Green Metallic Green

Rancid Greasy/fatty Rancid Greasy/fatty

Air; N2; Ar

Figure4.EvolutionoftheAromaovertimeunderthethreedifferentatmospheresstudied

3.3.HSSPMEandGCO

3.3.1.OptimizationofHSSPMEsamplingconditions

ThedifferentparametersthatinfluenceontheSPMEprocesshavebeenstudiedbyevaluatingnot
onlythenumberofcompoundsextractedandtheirchromatographicresponsebutalsothenumber
and intensity of the odorants detected. All the analyseswere performed in triplicate and to avoid
oxidationofthesamplesduetothehandling,whenwepreparedthesamples,weworkedunderN2
atmosphere.

Inpreviousstudiesseveralfibresweretested(Jimnez,Aguilera,Beltrn&Uceda,2006;Vichietal.,
2003b)andtheDivinylbenzeneCarboxenPolydimethylsiloxane(DVB/CAR/PDMS)coatingwasfound
tobethemostsuitablefortheanalysisofvirginoliveoilsvolatiles.Wealsocorroboratedthisbetter
behaviour as occurred when analysing other foods (Acea, Vera, Guasch, Busto & Mestres., 2010;
Mart,Mestres,Sala,Busto&Guasch,2003).

Toevaluatetheinfluenceofsamplevolume,2.5g,5gand10gwerepouredina20mLvial.The
results showed that, whereas 2.5 g of sample gave the highest variability on the response (RSD


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 287

between 10 and 20%) the amounts of 5 and 10 g provided responses no significantly different
(<0.05).So,forpracticalreasons,thesmallestamountofsamplewaschosen.Relatedtothetime
necessary to reach the equilibrium between the three phases (sample, headspace and fibre), it is
wellknownthattheextractionrateisstronglyinfluencedbythetemperature,sobothparameters
(time and temperature) were studied simultaneously. With this aim we designed a 2^2 factorial
design plus an experiment in the centre of the domain which ranged from 30 C to 50 C for the
temperature and from 30 min to 3 hours for the time. The different experiments were randomly
performed and the optimal conditions corresponded to 2 hours at 40 C. It has to be noted that
shortertime(30min)providedsuitablechromatographicresponsesbutlowernumberandintensity
ofodorants.

3.3.2.GCO

AccordingtotheUEandIOOCregulations,peroxidevalues,k232,k270andsensoryevaluationassess
theoxidativedeteriorationofoliveoil.Therearesomestudiesstatingthatthesensoryevaluation
detects oxidative deterioration before changesin the otherparameters can beobserved (Kalua et
al., 2007; Vichi et al., 2003b). However, these studies only emphasise the importance of volatile
compoundstodetecttheearlystagesofoliveoildeteriorationbuttheydonotchecktherealimpact
of these volatiles on the sensory analysis changes. Indeed, some oxidation compounds such as
nonanalorhexanalhavebeenselectedasmarkersofoxidativestatusofEVOObecauseofitshigh
rate of formation but no sensory consideration has been taken into account (Kiritsakis, 1998;
Moralesetal.,1997;Vichietal.,2003a).

Thus,todeterminethecompoundsresponsibleforaromachanges,thearomaofthedifferentEVOO
sampleswasalsoextractedandanalysedbyGCOsothetrainedresearchersprovidedthedescriptor
ofeachindividualodourperceivedtogetherwithitsintensity.However,sincethestudywascarried
out over a year, one of the most important drawbacks was to ensure that the researchers would
evaluate the samples considering a similar intensity scale over time. To get reliable results, in the
presentstudyweproposedtheuseofasyntheticsamplewhichwasanalysedbeforeeachoneofthe
quarterly GCO analysis sessions. This sample consisted on a paraffin oil which was spiked with
different compounds at similar concentrations to those found in real EVOO, as explained in the
chemical and reagents section.Fromthe intensities perceived in theGCO effluent when analysing
thissample,thethreetrainedresearchersrefreshedthescaleofintensities.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
288 FoodControl(2011)

Table 1 shows the odouractive compounds detected by GCO and their intensity evolution when
analysingtheoliveoilstoredunderdifferentatmospheresalongdifferentperiodsoftime.Asitcan
be observed, we found a similar behaviour for most of the compounds whatever the atmosphere
used although it has to be noted that, when dealing with air, changes were usually more
pronounced. A comparison with literature data is difficult because of the great variability of the
volatilecompositions,whichdependonseveralparameterssuchastheripenessstageoftheolives
when processed, the extraction technique followed or the analytical method employed (Cavalli et
al.,2004;Flamini,2007;Vichietal.,2003a).

Amongthedifferentodouractivecompoundsdetectedintheoliveoilstudied,aldehydeswerethe
mostabundant.Ingeneral,thesecompounds,andmainlythelongchainaldehydes,arelinkedtoan
increaseofitsconcentrationandalsoofitsaromaticperceptionduetotheoxidationofthesamples
over time. However, although the amount of the saturated aldehydes suffered a greater increase
duringtheoxidationprocessmainlynonanalandhexanalasithasbeenpreviouslydescribed(Luna
etal.,2006;Moralesetal.,1997)theunsaturatedoneshave,sometimes,agreatercontributionto
theoverallaromabecauseoftheirmuchlowerodourthresholds(Angerosaetal.,2004).This fact
can explain why, although octanal and nonanal gave chromatographic peaks in all the stages
studied,theiraromaticcontributionwasonlydetectableatanintermediateoradvancedoxidation
stage,whenthechromatographicsignalhadincreasedthreetimes.Theodourthresholdeffectwas
also found when we considered the Z and E isomers of 2nonenal. In this case, although both
compoundsshowedanincreaseonitschromatographicpeakalongthetime,theconcentrationof
the Z isomer was almost 10 times lower than the concentration of the E isomer. However, in the
GCOanalysis,theintensityofthearomaperceivedisverysimilarforbothcompoundsandonlyfor
theZisomerwedetectedanincreaseonitsperception.Thisisduetothelowerthresholdvaluethat
showstheZisomer(Zisomer:4.5gkg1andEisomer:900gkg1(Kaluaetal.,2007;Reinersetal.,
1998)).Anotherveryimportantaldehydetobeconsideredwas(E)2hexenal.Thiscompound,which
presented very high intensities on the GCO analyses, dominates in the composition of the good
qualityEuropeanEVOOs(Flamini,2007;Kaluaetal.,2004;Kirisakis,1998).Itschromatographicpeak
showed a negative trend over time that was translated in a decreasing behaviour of its sensory
evolutionasoccurswith(Z)3hexenal.

On the other hand, in a general way, oxidation promotes a content decrease of the different
identified esters (Morales et al., 1997) and, as shown in Table 1, this fact implied an intensity
diminutionoftheirindividualperceptions.Thiscommonsensoryreductionwasperfectlycorrelated
with the loss of the fruity character of the EVOO studied over time, since these compounds are
usuallyrelatedtothisattribute.Thisbehaviour,togetherwiththeoneobservedforthealdehydes,

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 289

coincides with Morales et al. (1997) findings that related the offflavour of oxidized EVOOs to the
absenceofestersandthepresenceofmanyaldehydeswithlowodourthresholds.Nevertheless,we
foundsomeexceptions,suchastheslightincreaseofintensityperceptionof(Z)3hexenylacetate,
whichagreedwithotherstudieswhereitwascheckedthatsomecompounds,normallypresentin
nonoxidized EVOO, were noted to increase their concentration when the oxidation was induced
(Vichietal.,2003a).

Whenconsideringtheodouractiveacids,itisknownthatcarboxylicacidshigherthanC3arelinked
to oxidative rancidity and also to high oxidation degrees, as these compounds come from the
aldehydesoxidation(Kaluaetal.,2007;Morales,Luna&Aparicio,2005).However,sincetheoliveoil
herestudieddidnotsufferfromsuchstrongoxidativeprocess,thesensoryperceptionoftheacids
detectedwasnearlyconstant.

Ontheotherhand,accordingtoKaluaetal.(2007),mostofthesmallestketones,withfivetoseven
carbon atoms, are linked to positive sensory characteristics. As it is specified in Table 1, both 1
penten3oneand1hexen3oneareperceivedaspungentaromaswhichcontributetothepositive
pungent descriptor of olive oil. However, the contents and also the aromatic intensity of these
compoundsslowlydecreasedduringthestoragebuttheirinteractionwithothercompoundscanbe
relatedtosomedefects.Thus,forexample,(Z)4heptenalpresentsasynergiceffectinpresenceof
1pentenonethatresultsonthedevelopmentofametallicdefect.

AlltheseGCOresultsovertimeallowedanindividualstudyofeachodourthatcontributedto the
overall aroma of the EVOOs studied. Thus, it could be checked that, in general, the individual
behaviourofthearomatic compoundsthataredescribedbymeansoffruitynotesorgreennotes
presentedanegativetrendovertimeinasimilarwayastheglobalfruitynotedetectedintheoils
considered(Figures4,5and6).Wecouldalsoseethatthearomaticcompoundsdescribedwiththe
descriptorfattyshowedanincreaseintheirperceptionovertimeashappenedwhenthisattribute
wasoverallconsideredintheoliveoilsanalysed(Figures4and7).Therefore,althoughtheevolution
ofthesensoryperceptiondoesnotonlydependontheodourofthesinglecompoundsbutalsoon
the interaction among the different aromatic compounds and also with other components of the
samplematrix,wecanconcludethattheresultsobtainedwhenanalysingthearomaextractswith
GCO allowed to correlate the sensory perception of the whole aroma with the aroma of each
individualcomponentofthatwholearoma.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
290 FoodControl(2011)

fruity attribute

5,0

sensory intensity
4,0

3,0

2,0

1,0

0,0
0 months 3 months 6 months 9 months 12 months

ethyl isobutyrate methyl 2-methylbutanoate


ethyl 2-methylbutanoate hexyl acetate
Z-3-hexenyl acetate

Figure5.EvolutionofthesensoryintensityovertimeforthecompoundsrelatedtothefruitynoteinEVOO
bottledwithoutprotectiveatmosphere

green attribute
5,0
sensory intensity

4,0

3,0

2,0

1,0

0,0
0 months 3 months 6 months 9 months 12 months

hexanal E-2-hexenal
Z-3-hexenal Z-3-hexen-1-ol
isopropylmethoxypyrazine

Figure6.EvolutionofthesensoryintensityovertimeforthecompoundsrelatedtothegreennoteinEVOO
bottledwithoutprotectiveatmosphere

fatty attribute

5,0
sensory intensity

4,0

3,0

2,0

1,0

0,0
0 months 3 months 6 months 9 months 12 months

Z-2- nonenal E-2- nonenal


E,E-2,4-nonadienal E,Z-2,4-decadienal
trans-4,5-epoxy-E-2-decenal

Figure7.EvolutionofthesensoryintensityovertimeforthecompoundsrelatedtothefatnoteinEVOObottled
withoutprotectiveatmosphere


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 291

4.CONCLUSIONS

Fromtheresultsobtainedwecanconcludethat,duringstorage,peroxidevaluesandalsoK232and
K270 values strongly depend on the atmosphere olive oil was bottled with, in such a way that the
valuesoftheseparametersweresignificantlylowerwheninertatmosphereswereused.However,
duringthestoragetimestudied(12months),onlytheK232valueforEVOObottledwithoutaninert
gasreachedtheupperlimitwhichimpliesthelossoftheextraqualityfortheoil.Thisisconsistent
with the results given by other authors, according to whom EVOO collected from the previous
harvestingseasonandstoredundernitrogenatmospheredidnotshowappreciablequalitychanges,
intermsofqualityindices.

On the contrary, a different behaviour was observed if the sensory evaluation was taking into
account.Whenstoredunderaninertatmosphere,theoliveoilcouldbeconsideredEVOOduringall
the period of time studied. However, when storing EVOO together with air in the bottle, samples
losttheirextraqualityonlyafter9monthsofstorage.Thisbehaviourisduetotheimportantloss
of positive notes and the appearance of some negative attributes over time. Moreover, the GCO
analyses which allowed the individual evaluation of the aromatic compounds showed a great
correspondence with the global impression in such a way that the EVOO stored under an inert
atmosphereshowedalongerpreservationofitssensoryproperties.

Therefore,theseresultscorroboratethefactthatthesensoryanalysisismuchsensitiveandableto
detectoxidativedeteriorationatearlierstagesthanotherchemicalparameters.

Acknowledgments

ThisstudywassupportedbytheSpanishMinistryofScienceandTechnology(projectsAGL200761550and
AGL201019688)



Laura Acea Muoz

Table1.OdouractivecompoundsdetectedbyGCOandtheirintensityevolutionunderthedifferentatmospheresstudiedovertime

RI freshoil 3months 6months 9months 12months

CPWax HP5 aroma compound Air Ar N2 Air Ar N2 Air Ar N2 Air Ar N2 Air Ar N2

910 a malty 2/3methylbutanal 3.6 4.2 4.0 4.0 4.0 3.6 4.0 4.0 4.0 4.0 4.0 4.0 4.0 4.0 3.0
ISBN:9788469432341/DL:T. 1040-2011

961 760 fruity ethylisobutyrate 3.0 3.5 3.0 3.0 3.2 3.2 2.4 2.8 2.6 2.0 2.4 2.3 1.9 2.1 2.0

974 b butter diacetyl 4.6 4.6 5.0 4.2 4.6 4.6 3.8 4.2 4.4 3.6 4.0 3.6 3.0 3.6 3.6

1020 778 fruity methyl2methylbutanoate 2.0 2.0 2.0 2.0 2.0 2.0 1.7 1.8 1.8 1.5 1.6 1.6 1.3 1.5 1.6

1030 a pungent,mustard 1penten3one 3.6 3.4 3.6 3.6 3.5 3.5 3.6 3.5 3.7 3.7 3.6 3.6 3.7 3.5 3.6

1055 850 pineaple ethyl2methylbutanoate 4.0 4.0 4.0 3.4 3.6 3.6 3.0 3.4 3.2 2.4 3.0 3.0 2.0 2.2 2.3
1090 803 green hexanal 3.0 3.0 3.0 3.0 3.0 3.0 3.6 3.0 3.0 4.0 3.6 3.8 4.2 4.0 4.0

1112 781 rubber,pungent 1hexen3one 2.5 2.5 2.4 2.5 2.4 2.4 2.2 2.3 2.4 2.1 2.2 2.2 2.0 2.1 2.1

1152 806 green, (Z)3hexenal* 3.0 3.0 3.0 3.0 3.0 3.0 2.8 3.0 3.0 2.0 2.2 2.4 1.0 1.2 1.2

1201 859 green (E)2hexenal 4.0 4.0 4.0 4.0 4.0 4.0 3.0 3.5 3.5 2.4 2.9 2.8 1.4 1.8 1.8

1215 740 malty,bitteralmonds 2and3methyl1butanol 2.4 2.4 2.6 2.6 2.4 2.6 2.2 2.2 2.4 2.0 2.0 2.2 1.8 1.8 1.9

1239 906 fishy (Z)4heptenal 2.2 2.0 2.4 3.0 2.8 3.0 3.2 2.8 2.8 3.8 3.2 3.4 4.2 3.6 3.6
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

1280 1020 fruity hexylacetate 1.8 1.6 1.6 1.6 1.4 1.4 1.2 1.4 1.1 1.0 1.0 1.0 1.0 1.0 1.0

1287 1012 citrus,fatty octanal nd nd nd nd nd nd 2.0 1.8 2.2 3.0 2.6 3.0 4.0 3.6 3.4
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

1295 1045 mushroom 1octen3one 3.0 3.2 3.0 3.0 3.0 3.0 3.6 3.4 3.6 3.6 4.0 3.6 3.6 4.0 4.0

1335 1015 banana (Z)3hexenylacetate 3.4 3.3 3.4 3.5 3.5 3.5 3.7 3.7 3.6 3.7 3.8 3.8 3.9 3.7 3.8

1378 991 geranium (Z)1,5octadien3one* 2.0 2.0 2.0 2.0 2.0 2.0 2.4 2.4 2.8 2.0 3.0 3.0 2.0 2.0 2.0

1389 861 green (Z)3hexen1ol* 3.6 3.6 3.6 3.4 3.6 3.6 3.0 3.0 3.2 2.6 3.0 3.0 2.2 2.8 3.0

1395 1108 citrus,fatty nonanal nd nd nd nd nd nd 1.0 1.0 1.0 1.7 1.4 1.4 2.4 1.7 1.9

1451 912 boiledpotatoes methional 2.0 2.0 2.0 2.0 2.0 2.0 1.0 1.0 1.0 nd nd nd nd nd nd


Laura Acea Muoz

1455 1105 paprika isopropylmethoxypyrazine 2.0 2.0 2.0 1.6 2.0 2.0 1.6 2.0 2.0 1.4 2.2 2.0 1.9 2.0 2.0

1460 b aceticacid aceticacid 4.0 4.0 4.0 4.0 4.0 4.0 4.2 3.6 4.0 3.6 4.0 4.0 3.0 3.6 3.4

1519 1155 fatty,green (Z)2nonenal* 2.4 3.0 3.4 3.0 3.0 3.4 3.2 3.0 3.4 3.6 3.4 3.6 3.6 3.6 3.4

1535 1168 paperlike,fatty (E)2nonenal 3.0 3.0 3.0 3.0 3.0 3.0 3.2 3.1 3.1 3.4 3.2 3.2 3.5 3.3 3.4

1625 824 cheese,vomit butyricacid 2.4 2.0 2.0 2.4 2.4 1.9 2.0 2.0 2.0 2.0 2.0 2.2 2.0 2.0 2.0
ISBN:9788469432341/DL:T. 1040-2011

1665 880 cheese 2/3methylbutiricacid 4.5 4.5 4.0 4.5 4.6 4.1 4.4 4.6 4.4 4.5 4.5 4.5 4.6 4.4 4.4

1715 1220 fatty,grassy (E,E)2,4nonadienal 1.0 1.0 1.0 1.2 1.0 1.0 1.6 1.2 1.1 2.0 1.4 1.2 2.0 1.6 1.4

1760 1301 metallic,rancid (E,Z)2,4decadienal* 4.3 4.1 3.9 4.5 4.3 4.2 4.6 4.4 4.4 4.7 4.5 4.5 4.7 4.6 4.5

1815 1421 melmelada damascenone 1.0 1.0 1.0 1.0 1.0 1.0 nd nd nd nd nd nd nd nd nd

1865 1095 smoky guaiacol 4.0 4.0 4.0 4.0 4.0 4.0 3.4 3.6 3.4 3.0 3.1 3.0 2.5 3.0 2.8

1932 1123 roses 2phenyletanol 3.0 3.0 3.0 3.0 3.0 3.0 2.0 2.0 2.0 1.4 1.5 1.6 1.0 1.0 1.0

2031 1390 metallic,rancid trans4,5epoxy(E)2decenal* 3.8 3.9 3.8 3.9 4.0 4.0 3.8 3.8 3.8 3.6 3.6 3.6 3.5 3.5 3.5

2115 1481 sweet,lactone decalactone nd nd nd 1.0 1.0 1.0 1.0 1.0 1.0 nd nd nd nd nd nd

2181 1172 animal 4ethylphenol 2.0 2.0 2.0 2.0 2.0 2.0 1.4 1.8 1.6 1.0 1.0 1.0 1.0 1.0 1.0
RI:Retentionindexondifferentstationaryphases
a:RInotcalculatedduetosolventinterference
b:RI<RIofthefirstalkane(C6)
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA

nd:notdetected
*:standardnotcommerciallyavailable
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN

APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN


DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
294 FoodControl(2011)

REFERENCES
Acea,L.,Vera,L.,Guasch,J.,Busto,O.&Mestres,M.(2010).Comparativestudyoftwoextraction
techniques to obtain representative aroma extracts for being analysed by gas chromatography
olfactometry: Application to roasted pistachio aroma. Journal of Chromatography A, 1217 (49),
77817787.
Angerosa, F., Selvaggini, M.S.R., Taticchi, A.; Esposto, S. & Montedoro, G. (2004). Volatile
compounds in virgin olive oil: occurrence and their relationship with the quality. Journal of
ChromatographyA,1054,1731.
Aparicio,R.,Roda,L.,Albi,M.A.&Gutirrez,F.(1999).Effectofvariouscompoundsonvirginolive
oilstabilitymeasuredbyrancimat.JournalofAgriculturalandFoodChemistry,47,41504155.
Baldioli, M., Servili, M., Perretti, G. & Montedoro, G.F. (1996). Antioxidant activity of tocopherols
andphenoliccompoundsofvirginoliveoil.JournaloftheAmericanOilChemistsSociety,73,1589
1593.
Caponio,F.,Bilancia,M.T.,Pasqualone,A.,Sikorska,E.&Gomes,T.(2005).Influenceoftheexposure
tolightonextravirginoliveoilqualityduringstorage.EuropeanFoodResearchandTechnology,221,
9298.
Cavalli, J.F., Fernandez, X., LizzaniCuvelier, L. & Loiseau, A.M. (2004).Characterization of volatile
compounds on French and Spanish virgin olive oils by HSSPME: Identification of qualityfreshness
markers.FoodChemistry,88,151157.
Di Giovacchino, L., Mucciarella, N., Constantini, N., Ferrante, M.L. & Surricchio, G. (2002) Use of
nitrogentoimprovestabilityofvirginoliveoilduringstorage.JournaloftheAmericanOilChemists
Society,79,339344.
European Union Commission. (1991). Regulation EC 2568/91. Official Journal of the European
Communities.
European Union Commission. (2002). Regulation EC 796/2002. Official Journal of the European
Communities.
Flamini,G.(2007).HeadspaceAnalysesinvaluableandfunctionalfoods:applicationofSPMEinthe
qualitycontrolandcharacterizationofoliveoils.CurrentAnalyticalChemistry,3,149159.
Frankel, E. N. (2010). Chemistry of Extra Virgin Olive Oil: Adulteration, Oxidative Stability, and
Antioxidants.JournalofAgriculturalandFoodChemistry,58,59916006.
GallardoGuerrero, L., GandulRojas, B., Roca, M. & MnguezMosquera, M.I. (2005). Effect of
storage on the original pigment profile of spanish virgin olive oil. Journal of the American Oil
Chemists'Society,82(1),3339.
GmezAlonso,S.,ManceboCampos,V.,Salvador,M.D.&FregapaneG.(2007).Evolutionofmajor


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 295

andminorcomponentsandoxidationindexesofvirginoliveoilduring21monthsstorageatroom
temperature.FoodChemistry,100,3642.
Grigoriadou, D. & Tsimidou, M.Z. (2006). Quality control and storage studies of virgin olive oil:
ExploitingUVspectrophotometrypotential.EuropeanJournalofLipidScienceandTechnology,108
(1),6169.
GuilGuerrero,J.L.(2009).Efectosdealgunasvariablesdelenvasadoenlacalidaddeaceitedeoliva
virgenextra.GrasasyAceites,60(2),125133.
GutirrezRosales, F., GarridoFernandez, J., GallardoGuerrero, L., GandulRojas, B. & Minguez
Mosuera, M.I. (1992). Action of chlorophylls on the stability of virgin olive oil. Journal of the
AmericanOilChemistsSociety,69,866871.
Gutirrez, F. & Fernndez, J.L. (2002). Determinant parameters and components in the storage of
virginoliveoil.Predictionofstoragetimebeyondwhichtheoilisnolongerofextraquality.Journal
ofAgriculturalandFoodChemistry,50,571577.
InarejosGarca,A.M.,Santacatterina,M.,Salvador,M.D.,Fregapane,G.&GmezAlonso,S.(2010).
PDO virgin olive oil quality Minor components and organoleptic evaluation. Food Research
International,43,21382146.
Jimnez, A., Aguilera, M.P., Beltrn, G. & Uceda, M. (2006). Application of solidphase
microextractiontovirginoliveoilqualitycontrol.JournalofChromatographyA,1121(1),140144.
Kalua,C.M.,Allen,M.S.,BedgoodJrD.R.,Bishop,A.G.,Prenzler,P.D.&Robards,K.(2007).Oliveoil
volatile compounds, flavour development and quality: A critical review. Food Chemistry, 100, 273
286.
Kanavouras, A. & Coutelieris, F.A. (2006). Shelflife predictions for packaged olive oil based on
simulations.FoodChemistry,96,4855.
Kiritsakis, A.K. (1998). Flavor components of olive oil A review. Journal of Americal Oil
ChemistsSociety,6,673681.
Luna,G.,Morales,M.T.&Aparicio,R.(2006).ChangesinducedbyUVradiationduringvirginoliveoil
storage.JournalofAgriculturalandFoodChemistry,54(13),47904794.
Mart,M.P.,Mestres,M.,Sala,C.,Busto,O.&Guasch,J.(2003).Solidphasemicroextractionandgas
chromatography olfactometry analysis of successively diluted samples. A new approach of the
aromaextractdilutionanalysisappliedtothecharacterizationofwinearoma.JournalofAgricultural
andFoodChemistry,51,78617865.
Mataix Verd, J. & Barbancho Cisneros, F.J. (2008). El aceite de oliva, alma del Mediterrneo. (1st
ed.). Jan (Spain): Instituto de Estudios Giennenses Diputacin de Jan. Universidad de Jan
ServiciodePublicaciones(Chapter4).


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
296 FoodControl(2011)

Morales,M.T.,Rios,J.J.&Aparicio,R.(1997).ChangesinthevolatilecompositionofVirginOliveOil
duringoxidation:FlavorsandOffFlavors.JournalofAgriculturalandFoodChemistry,45,26662673.
Morales,M.T.,Luna,G.&Aparicio,R.(2005).Comparativestudyofvirginoliveoilsensorydefects.
FoodChemistry,91,293301.
Morell,J.R.,Vuorela,S.,Romero,M.P.,Motilva,M.J.&Heinonen,M.(2005).AntioxidantActivityof
OlivePulpandOliveOilPhenolicCompoundsoftheArbequinaCultivar.JournalofAgriculturaland
FoodChemistry,53(6),20022008.
Okogeri, O. & TasioulaMargari, M. (2002). Changes occurring in phenolic compounds and
tocopherolofvirginoliveoilduringstorage.JournalofAgriculturalandFoodChemistry,50,1077
1080.
Ouni,Y.,Flamini,G.,Issaouni,M.,NabilBen,Y.,Cioni,P.L.,Hammami,M.,Douja,D.&Zarrouk,M.
(2011). Volatile compounds and compositional quality og virgin olive oil from Oueslati variety:
Influenceofgeographicalorigin.FoodChemistry,124(4),17701776.
Papadopoulos,G.&Boskou,D.(1991).Antioxidanteffectofnaturalphenolsonoliveoil.Journalof
theAmericanOilChemists'Society,68(9),669671.
Preedy,V.R.&Watson,R.R.(2010).Olivesandoliveoilinhealthanddiseaseprevention.(1sted.).
London,Burlington,SanDiego:AcademicPress.Elsevier,(Section2).
Reiners,J.&Grosch,W.(1998).OdorantsofVirginOliveOilswithDifferentFlavorProfiles.Journalof
AgriculturalandFoodChemistry,46(7),27542763.
Riley, F.R. (2002). Olive Oil Production on Bronze Age Crete: Nutritional properties, Processing
methods,andStoragelifeofMinoanoliveoil.OxfordJournalofArchaeology,21(1),6375.
Tena, N., Lazzez, A., AparicioRuiz, R. & GarcaGonzlez, D.L. (2007). Volatile compounds
characterizing Tunisian Chemlali and Chtoui virgin olive oils. Journal of Agricultural and Food
Chemistry,55(19),78527858.
Vekiari,S.A.,Papadopoulou,P.&Kiritsakis,A.(2007).Effectsofprocessingmethodsandcommercial
storageconditionsontheextravirginoliveoilqualityindexes.GrasasyAceites,58,237242.
Velasco,J.&Dobarganes,C.(2002).Oxidativestabilityofvirginoliveoil.EuropeanJournalofLipid
ScienceTechnology,104,661676.
Vichi, S., Pizzale, L., Conte, L.S., Buxaderas, S. & LpezTamames, E. (2003a). SolidPhase
Microextraction in the Analysis of Virgin Olive Oil Volatile Fraction: Modifications Induced by
OxidationandSuitableMarkersofOxidativeStatus.JournalofAgriculturalandFoodChemistry,51
(22),65646571.
Vichi,S.,Castellote,A.I.,Pizzale,L.,Conte,L.S.,Buxaderas,S.&LpezTamames,E.(2003b).Analysis
of virgin olive oil volatile compounds by headspace solidphase microextraction coupled to gas


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
EvaluationofArbequinaoliveoilaromaovertime 297

chromatography with mass spectrometric and flame ionization detection. Journal of


ChromatographyA,983,933.
Zunin,P.,Leardi,R.,Bisio,A.,Boggia,R.&Romussi,G.(2010).Oxidativestabilityofvirginoliveoil
enrichedwithcarnosicacid.FoodResearchInternational,43,15111516.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


UNIVERSITAT ROVIRA I VIRGILI
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011

CONCLUSIONES
APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Conclusiones 301

Como ya se ha comentado en los objetivos de esta tesis doctoral, y se ha


constatadoalolargodeestamemoria,elaromadelosalimentosestntimamente
relacionado con la calidad y su anlisis constituye uno de los mayores retos para
quienes trabajan en el mundo de los aromas. No slo por la gran cantidad de
compuestos voltiles implicados, cada uno con una cualidad aromtica y unas
propiedades qumicas diferentes, sino tambin por el amplio rango de
concentraciones en las que estos odorantes aparecen, a lo que hay que aadir las
dificultadesqueintroducelapropianaturalezadelasmatricesalimentarias.

Por este motivo, los trabajos desarrollados y aqu presentados pretenden


contribuir de algn modo al avance en este campo de investigacin. Adems de
haberseestudiadolaidoneidaddedostcnicasdistintasparaextraerloscompuestos
voltiles de los alimentos, tambin se ha aplicado la cromatografa de gases
olfatometra para caracterizar los odorantes responsables del aroma de ciertos
productostpicosdeladietamediterrnea,ascomoparaevaluarlaevolucinenel
tiempodesucalidadsensorial.

A continuacin se exponen las conclusiones que se han obtenido, fruto del


trabajoexperimentalllevadoacaboduranteeldesarrollodeestatesisdoctoral.

EXTRACCINYCONCENTRACINDECOMPUESTOSAROMTICOS

1.Las dos tcnicas de extraccin y concentracin empleadas, la microextraccin en


fase slida sobre el espacio de cabeza (HSSPME) y la extraccin directa con
disolventes (DSE) seguida de highvacuum transfer (HVT), han demostrado ser
vlidasparalaobtencindeextractosaromticosrepresentativos.

2.Unavezoptimizadasycomparadaslasdostcnicasentrminosderepetitividady
reproducibilidad, se ha comprobado que ambas permiten llevar a cabo mtodos
de anlisis precisos, con coeficientes de variacin de la repetitividad (2,9% para


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
302 Conclusiones

SPMEy5,1%paraDSE)ydelareproducibilidad(5,2%paraSPMEy8,2%paraDSE)
adecuados.Sinembargo,yapesardelosbuenosresultadosdelaDSEHVT,laHS
SPME ha demostrado ser una tcnica ms precisa, al proporcionar valores de
coeficientesdevariacinconsiderablementemenores.

3.De entre las distintas fibras de SPME utilizadas, se ha comprobado que las
recubiertas por una fase estacionaria de Divinilbenzeno/Carboxen/
Polidimetilsiloxano (DVB/CAR/PDMS) son las ms eficaces, ya que permiten
extraer un mayor nmero de compuestos aromticos. Y este hecho se ha
confirmado tanto para la extraccin de matrices alimentarias lquidas como
slidas.

4.Se ha constatado la necesidad de trabajar con matrices sintticas semejantes a


aqullas que se estn analizando. De otro modo, la extraccin de los distintos
odorantesparallevaracabolosestudiosdecuantificacinolaevaluacindelas
propiedades sensoriales no se hace en condiciones que permitan extrapolar los
resultadosobtenidos.

CROMATOGRAFADEGASESOLFATOMETRA

1.TantolaHSSPMEcomolaDSEHVTpermitenobtenerextractosaromticosaptos
para el anlisis mediante la GCO. Sin embargo, la SPME constituye una tcnica
mucho ms rpida y sencilla, que apenas precisa manipulacin de la muestra.
Debidoaquenorequieredisolventes,proporcionaextractosmuchomslimpios,
sin olores ajenos al producto que se analiza o a artefactos generados durante la
extraccin,conloquenohayinterferenciasenladeteccindelosaromas.

2.Las dos variantes de la tcnica de dilucin AEDA empleadas con la SPME han
resultadovlidasparaestablecerunajerarquizacindeloscompuestosaromticos
delosdistintosalimentosanalizadosenfuncindesupotenciaaromtica.


APLICACIN DE LA CROMATOGRAFA DE GASES-OLFATOMETRA EN LA CARACTERIZACIN
DEL AROMA DEL VINAGRE DE VINO, DE LOS PISTACHOS Y DEL ACEITE DE OLIVA
Laura Acea Muoz
ISBN:9788469432341/DL:T. 1040-2011
Conclusiones 303

3.EnelcasodelanlisisdelaromadelvinagredevinoconDOPVinagredeJerezse
ha comprobado que el mtodo de pretratamiento de las muestras desarrollado
paraelanlisisolfatomtricopuedeutilizarseconfinescuantitativos,apesardela
diversidad qumica de los odorantes implicados y del amplio abanico de
concentracionesenlasqueestosaparecen.

4.Asimismo, se ha verificado que la GCO es una tcnica indispensable para la


caracterizacin del aroma de los alimentos, la nica que permite detectar de
forma individual aquellos compuesto