Anda di halaman 1dari 32

PENDAHULUAN

1.1. LatarBelakang

Kelapasawit(Elaeis)adalahtanamanperkebunanpentingpenghasil

minyak makanan, minyak industri, maupun bahan bakar nabati (biodiesel).

IndonesiaadalahpenghasilminyakkelapasawitkeduaduniasetelahMalaysia.

Diperkirakan pada tahun 2009, Indonesia akan menempati posisi pertama

produsensawitdunia.Untukmeningkatkanproduksikelapasawitdilakukan

kegiatanperluasanarealpertanaman,rehabilitasikebunyangsudahadadan

intensifikasi. Pelaku usaha tani kelapa sawit di Indonesia terdiri dari

perusahaan perkebunan besar swasta, perkebunan negara dan perkebunan

rakyat.Usahaperkebunankelapasawitrakyatumumnyadikeloladengan

model kemitraan dengan perusahaan besar swasta dan perkebunan

negara(intiplasma). Khususuntukperkebunansawitrakyat,permasalahan

umum yang dihadapi antara lain rendahnya produktivitas dan mutu

produksinya.Produktivitaskebunsawitrakyatratarata16tonTandanBuah

Segar (TBS) per ha, sementara potensi produksi bila menggunakan bibit

unggul sawit bisa mencapai 30 ton TBS/ha/th. Produktivitas CPO (Crude

PalmOil)perkebunanrakyathanyamencapairatarata2,5tonCPOperha/th

dan 0,33 tonminyak inti sawit (PKO) perha/th, sementara diperkebunan

negararataratamenghasilkan4,82tonCPO/ha/thdan0,91tonPKO/ha/th,

danperkebunanswastarataratamenghasilkan3,48tonCPO/ha/thdan0,57

tonPKO/ha/th(BalaiPengkajianTeknologiPertanian,2008).Dalamkegiatan
perkebunanyangdilakukan,biayayangdikeluarkanperusahaanmasihtinggi.

Salahsatuupayayangdilakukanolehperusahaandalammeminimalkanbiaya

adalah memanfaatkan teknologi yang ada dengan menciptakan alat yang

berguna dalam penyemprotan tanaman mature kelapa sawit yang bernama

mikron herbi. Dengan menggunakan mikron herbi, penggunaan material

dalam penyemprotan bisa ditekan dibandingkan dengan menggunakan

knapsacksprayer.Halinidisebabkankarenamikronherbimemilikivolume

semprotyanglebihkecildaripadaknapsacksprayersehinggabiayamaterial

bisalebihrendah.

1.2.RumusanMasalah

1. Apa itu Kelapa Sawit ?


2. Bagaimana karakteristik dari Kelapa Sawit ?
3. Bagaimana sejarah penyebaran Kelapa Sawit di Indonesia ?
4. Apa saja kandungan yang terdapat dalam Kelapa Sawit ?
5. Apa saja manfaat Kelapa Sawit ?
6. Bagaimana cara pembudidayaan dan cara pemeliharaan Kelapa Sawit ?

1.3. Tujuan

Adapun tujuan dari pembuatan makalah budidaya tanaman kelapa sawit ini antara
lain :

1. Mengetahui cara budidaya tanaman kelapa sawit dengan baik dan benar.

2. Mengetahui estimasi produksi panen kelapa sawit

3. Mengetahui dan memahami syarat tumbuh dari kelapa sawit

4. Mengetahui cara budidaya tanaman kelapa sawit dan teknik pengendalian hama
dan penyakit pada kelapa sawit.
TINJAUANPUSTAKA

2.1.SejarahKelapaSawitDiIndonsia

Tanaman kelapa sawit adalah sumber utama minyak nabati sesudah kelapa
di Indonesia. Tanaman ini dikenal di dunia barat setelah orang Portugis berlayar
ke Afrika tahun 1466. Dalam perjalanan ke Pantai Gading (Ghana), penduduk
setempat terlihat menggunakan kelapa sawit untuk memasak maupun untuk
bahan kecantikan. Pada tahun 1970 untuk yang pertama kali dikapalkan sejumlah
biji kelapa sawit ke Inggris dan memasuki daratan benua Eropa tahun 1844.
Beberapa tahun kemudian Eropa mengimport inti sawit. Tahun 1848 tanaman
kelapa sawit masuk ke Indonesia dan daerah-daerah lain di Asia sebagai tanaman
hias. Ada 4 tanaman yang ditanam di Kebun Raya bogor (Botanical Garden)
Bogor, dahulu bernama Buitenzorg, dua berasal dari Bourbon (Mauritius) dan
dua lainnya dari Hortus Botanicus, Amsterdam (Belanda). Pada tahun 1853
keempat tanaman tersebut telah berbuah dan bijinya disebarkan secara gratis.
Pada pengamatan tahun 1858, ternyata keempat tanaman tersebut tumbuh subur
dan berbuah lebat. Walaupun berbeda waktu penanaman (asal Bourbon lebih
dulu dua bulan), tanaman tersebut berbuah dalam waktu yang sama, mempunyai
tipe yang sangat beragam, kemungkinan diperoleh dari sumber geneik yang sama
(Rutgers, 1922).

Kira-kira 10 tahun kemudian, diadakan uji coba penanaman kelapa sawit


pertama di Indonesia yang dilakukan di karesidenan Banyumas 14 acre dan di
karisidenan Palembang 3 acre (Sumatera Selatan). hasil uji coba tersebut
menunjukkan bahwa tanaman kelapa telah berbuah paa tahun keempat setelah
ditanam dengan tinggi batang 1,5 m, sedangkan di negeri asalnya baru berbuah
pada tahun keenam atau ketujuh. Selanjutnya uji coba dilakukan di Muara Enim
tahun 1869, Musi Ulu 1870 dan Biliton 1890 (Van Heurn, 1948) tetapi tidak
begitu baik pertumbuhannya. Hal ini baru disadari kemudian, bahwa iklim
daerah Palembang kurang sesuai untuk pertumbuan kelapa sawit. Kemudian
dikembangkan ke Sumatera Utara, ternyata sungguh baik. Keunggulan kelapa
sawit Sumatera Utara sudah dikenal sejak sebelum perang dunia ke II dengan
varietas Dura Deli (bahasa Inggirs: Deli Dura) yakni tanaman kelapa sawit yang
ditanam di Tanah Deli (Medan dan sekitarnya).

Selama 40 50 tahun sesudah tanaman kelapa sawit masuk ke Indonesia


hanya digunakan sebagai tanaman hias, barulah pada tahun 1911 diperkebunkan
di Sumatera Utara, hanya 9,1% di Lampung dan 4,1 % di Aceh (Daswir dan
Panjaitan, 1981). Sekarang ini sudah tersebar luas di berbagai propinsi lain
termasuk di P. Jawa melalui proyek PIR atau perluasan usaha Perusahaan
Perkebunan Negara (PPN) ataupun Perseoran Terbatas Perkebunan Nusantara
(PTPN) yang kebanyakan berpusat di Sumatera Utara, dan Riau serta pembukaan
lahan baru oleh perusahaan asing maupun swasta nasional. Pada awal tahun 80-
an, tanaman kelapa sawit digelari sebagai komoditi primadona karena memberi
keuntungan yang melimpah. Dengan adanya boom ini, perluasan areal dapat
terealisasi dengan kemajuan yang pesat. Kalau sebelum perang dunia ke II,
Sumatera Utara danAceh adalah penghasil munyak kelapa sawit terbesar di
dunia, tetapi setelah perang, Malaysia adalah penghasil minyak sawit yang
utama. Ini berkat kemajuan Malaysia mengelola perkebuna sawit secara efisien
dan didukung oleh penelitian dan pengembangan teknologi yang mantap.

2.2.KlasifikasiTanamanKelapaSawit

Tanaman kelapa sawit memiliki nama latin (Elaeis guineensis Jacq) saat ini
merupakan salah satu jenis tanaman perkebunan yang menduduki posisi penting
disektor pertanian umumnya, dan sektor perkebunan khususnya, hal ini disebabkan
karena dari sekian banyak tanaman yang menghasilkan minyak atau lemak, kelapa
sawit yang menghasilkan nilai ekonomi terbesar per hektarnya di dunia (Balai
Informasi Pertanian, 1990). Melihat pentingnya tanaman kelapa sawit dewasa ini
dan masa yang akan datang, seiring dengan meningkatnya kebutuhan penduduk
dunia akan minyak sawit, maka perlu dipikirkan usaha peningkatan kualitas dan
kuantitas produksi kelapasawit secara tepat agar sasaran yang diinginkan dapat
tercapai. Salah satu diantaranya adalah pengendalian hama dan penyakit.
(Sastrosayono 2003). Tanaman kelapa sawit adalah tanaman penghasil minyak
nabati yang dapat menjadi andalan dimasa depan karena berbagai kegunaannya
bagi kebutuhan manusia. Kelapa sawit memiliki arti penting bagi pembangunan
nasional Indonesia. Selain menciptakan kesempatan kerja yang mengarah pada
kesejahteraan masyarakat, juga sebagai sumberdevisa negara. Penyebaran
perkebunan kelapa sawit di Indonesia saat ini sudah berkembang di 22 daerah
propinsi. Luas perkebunan kelapa sawit pada tahun 1968 seluas 105.808 hadengan
produksi 167.669 ton, pada tahun 2007 telah meningkat menjadi 6.6 juta ha
dengan produksi sekitar 17.3 juta ton CPO (Sastrosayono 2003). Tanaman kelapa
sawit merupakan komoditas perkebunan primadona Indonesia. Di tengah krisis
global yang melanda dunia saat ini, industri sawit tetap bertahan dan memberi
sumbangan besar terhadap perekonomian negara. Selain mampu menciptakan
kesempatan kerja yang luas, industri sawit menjadi salah satu sumber devisa
terbesar bagi Indonesia. Data dari Direktorat Jendral Perkebunan (2008)
menunjukkan bahwa terjadi peningkatan luas areal perkebunan kelapa sawit di
Indonesia, dari 4 713 435 ha pada tahun 2001 menjadi 7.363.847 ha pada tahun
2008 dan luas areal perkebunan kelapa sawit ini terus mengalami peningkatan.
MenurutMangoensoekarjodanSemangun(2000),taksonomitanaman
kelapasawit(ElaeisguineensisJacq)adalah:

Divisi :Spermatophyta

Kelas :Angiospermae

Subkelas :Monocotyledoneae

Ordo :Palmales

Family :Palmae

Subfamily :Cocoideae

Genus :Elaeis
Spesies :ElaeisguineensisJacq

Pengelompokkankelapasawitdapatdilakukanberdasarkantebal

tipisnyacangkangdanwarnanya(Risza,1994).

A. BerdasarkanTebalTipisnyaCangkang

Berdasarkantebaltipisnyacangkang,tanamankelapasawitdapat

dibedakanmenjadi3tipeyaitu:

1) TipeDura

Kelapasawitinimemilikitempurung(cangkang)yangsangattebal,
tetapikandunganminyakdalambuahnyarendah.

2) TipePisifera
Memilikitempurung(cangkang)yangsangattipisbahkanhanya

berbentukbayangancincin,namunkandunganminyakdalambuahtinggi.

3) TipeTenera

Merupakan persilangan antara Dura sebagai pohon ibu, dengan

Pisiferasebagaipohonbapak.Teneramemilikitempurungyangtipisdan

kandunganminyaktinggi.

B. BerdasarkanWarnaBuah

Berdasarkan warna buah, tanaman kelapa sawit dapat dibedakan

menjadi3bentukyaitu:
1) Nigrescens
Warna buahnya lembayung (violet) sampai hitam pada waktu

masih muda,kemudian berubahmenjadi warnamerah kuning(orange)

sesudahmatang.

2) Virescens

Warnabuahnyahijaupadawaktumuda,kemudianberubah

menjadimerahkuningsesudahmatang.

3) Albescens

Warnabuahnyakuningpadawaktumudadanpucatsertatembus

cahayakarenamengandungsedikitkoraten.

2.3.KarakteristikKelapaSawit
Kelapa sawit memiliki akar serabut yang berfungsi sebagai penyerap unsur
hara dan respirasi tanaman serta sebagai penyangga berdirinya tanaman. Kelapa
sawit dewasa 8000-10000 akar primer 15-20 meter dari dasar batang dengan
diameter 4-10 mm. Sebagian besar tumbuh medatar sekitar 20-60 cm di bawah
permukaan tanah. Batang kelapa sawit tidak memiliki kambium tajuk dan tidak
bercabang. Batang kelapa sawit berfungsi sebagai penyangga tajuk dan sebagai
jalan pengangkutan air dan hara (zat makan). Pertumbuhan kelapa sawit tidak
terbatas, tapi menurut pertimbangan ekonomisnya hanya sampai umur 25 tahun
dengan ketinggian 10-11 m (Lubis et al. 1989).
Menurut MAKSI (2007), daerah pengembangan kelapa sawit yang sesuai
berada pada 150 LU 150 LS. Faktor-faktor yang terpenting dalam pertumbuhan
kelapa sawit antara lain curah hujan, suhu, udara, kelembaban udara, dan radiasi
cahaya matahari. Kelapa sawit tumbuh baik pada ketinggian 0-400 m dpl, iklim
dengan curah hujan 2000-2500 mm/tahun, jumlah bulan kering dalam 1 tahun
yaitu 1-2 bulan, suhu udara rata-rata 22-230C, kelembaban udara 50-90% dengan
kelembaban udara optimal 80%. Kelapa sawit tumbuh baik pada sebagian besar
jenis tanah di wilayah tropika seperti organosol, regosol, andosol, aluvial, latosol,
podsolik merah kuning, dan podsolik cokelat. Tanah yang baik untuk
pertumbuhan kelapa sawit yaitu tanah yang memiliki pH netral, lapisan tanah
dalam (tebal solum 80 cm), tekstur ringan, perkembangan struktur baik, dan
memiliki kandungan unsur hara yang tinggi (Lubis et al. 1989).

2.4. MarfologiTanamanKelapaSawit

a) Akar

Akar merupakan bagian tanaman yang memiliki peranan yang

pentingpadasetiaptanamanyaitusebagaipenyerapunsurharadidalam

tanahdansebagaialatrespirasibagitanaman(Fauzi, dkk,2005).Macam

macamakarpadatanamankelapasawityaitu:

Akarprimeryaituakaryangtumbuhvertikalmaupunmendatar

dengandiameterakar510mm.

Akarsekunderyaituakaryangtumbuhdariakarprimer,arah

tumbuhnyamendatarmaupunkebawahdengandiameter14mm.

Akartertieryaituakaryangtumbuhdariakarsekunder,arah

tumbuhnyamendatar,panjangmencapai15cmdengandiameter

0,51,5mm.

AkarKuartieryaituakarakarcabangdariakartertier,berdiameter

0,20,5mmdanpanjangnyaratarata3cm.Akariniberperanaktif

dalammenyerapunsurunsurhara,airdankadangkadangoksigen

(Setyamidjaja,2000).
Calonakaryangmunculdaribijikelapasawityangdikecambahkandisebut

radikula, panjangnya 1015 mm, sedangkan calon batang disebut dengan

plumula.Pertumbuhanradikulamulamulamenggunakanmakanancadangan

yangadadalamendospernyangkemudianfungsinyadiambilaliholehakar

primer(MangoensoekarjodanSemangun,2000).

b)Batang

Kelapasawitmerupakantanamanmonokotilyaitubatangnyatidak

memilikikambiumdanumumnyatidakbercabang.Batangpadatanaman

kelapasawittumbuhluruskeatasdengandiameterbatangnormalnya40

60cmdengantinggidapatmencapai30mdanbatanginijugaberfungsi

sebagai penyangga tajuk, serta menyimpan dan mengangkut bahan

makanan.

c) Daun

Daun kelapa sawit bersirip genap dan bertulang sejajar seperti

daunpohonkelapa.Daundaunmembentuksatupelepahyangpanjangnya

mencapai lebih dari 7,59 m dengan jumlah daun pada setiap pelepah

dapat mencapai 300 helai. Daun muda yang masih berupa kuncup

berwarnakuningpucat.Daunberfungsisebagaitempatberlangsungnya

fotosintesisdansebagaialatrespirasi.Jumlahpelepah,panjangpelepah,

danjumlahanakdauntergantungpadaumurtanaman.Semakintuaumur

tanamanmakajumlahpelepahdananakdaunnyasemakinbanyak.

d)Bunga
Kelapa sawit merupakan tanaman berumah satu (monoecious),

artinyabungajantandanbungabetinaterdapatdalamsatutanamandan

masingmasing terangkai dalam satu tandan. Rangkaian bunga jantan

terpisah dengan bunga betina. Setiap rangkaian bunga muncul dari

pangkal pelepah daun. Sebelum bunga mekar dan masih diselubungi

seludang, maka bungadapat dibedakan antara bungajantandan bunga

betina yaitu dengan cara melihat bentuknya. Bunga jantan bentuknya

lonjong memanjang dengan ujung kelopak agak meruncing dan garis

tengahbungalebihkecil,sedangkanbungabetinabentuknyaagakbulat

denganujungkelopakagakratadangaristengahlebihbesar(Fauzi,dkk,

2005).

e) Buah

Buahdisebutjuga fructus. Lamaprosespembentukanbuahsejak

saatpenyerbukansampaibuahmatangadalah 6bulan.Tetapi,dapat

jugaterjadilebihlambatataulebihcepattergantungpadakeadaaniklim

setempat (Risza, 1994). Selama buah kelapa sawit masih muda, yaitu

sampaiumur4,55bulan,buahkelapasawitakanberwarnaungu.Setelah

itu warna kulit buah (exocarp) dari ungu berangsurangsur berubah

menjadi warna merah kekuningkuningan. Pada saat inilah terjadi

pembentukan minyak yang intensif pada daging buah (mesocarp), dan


butirbutirminyaktersebutmengandungzatwarnakarotin(carotein)yang

berwarnajingga(Setyamidjaja,2000).

2.5.SyaratTumbuh

a) Iklim

Kelapasawitmerupakantanamandaerahtropisyangumumnyadapat

tumbuhdidaerahyangterletakpada12LUdan12LS,dengancurahhujan

2.0002.500mm/thn,lamapenyinaranmatahari57jam/haridengansuhu

optimum2438cdanberadapadaketinggian0500mdiataspermukaan

laut.

b)Tanah

Tanamankelapasawitdapattumbuhpadaberbagaijenistanahseperti

podsolik,latosol,hidromofikkelabu,alluvial,atauregosol.Perbedaanjenis

tanahyangdigunakandalamkegiatanbudidayajugamengakibatkanunsur

hara yang terkandung dalam tiap tanah juga berbeda sehingga jumlah

poduksikelapasawitjugaakanmengalamiperbedaan.

2.6. PembibitanKelapaSawit

2.6.1. PembibitanSatuTahap(SingleStage)

Pembibitansatutahapinidilakukandengancarakecambahditanam

langsungkepolybagbesar.Tanamanberadadipolybagbesardenganukuran

38x51cmatau40x50cmselama10bulanatausampaitanamansiapuntuk
ditanamkelapangan.Pemeliharaanyangdilakukanpadapembibitan single

stage sama dengan pemeliharaan pada pembibitan dengan menggunakan

sistemdoublestage(Lubis,1982).

Keuntungandaripembibitansinglestageadalah:

Tidakmemerlukanpolybagkecil

Tidakmemerlukanbedengandanatappelindung

- Tidakmemerlukanbiayapemindahankepolybagbesar

2.6.2. Pembibitanduatahap(DoubleStage)

Pembibitan ini dilakukan dengan cara memindahkan bibit

Prenursery yang telah berumur 3 bulan ke polybag besar. Dengan

menggunakansisteminibiasanyasetelahkecambahditanamdipolybagkecil

yangberukuran13x21cm,kemudianpolybagtersebutdisusundalamsatu

bedengandanditempatkandibawahnaungan.Setelahbibitberumur3bulan

baruditanamkepolybagbesar.

MenurutLubis(1982),keuntungandaripembibitandoublestageadalah:

Karena ditanam di polybag kecil, bibit tahap awal berkumpul

dalamsuatuluasanyangkecilsehinggamemudahkanpengawasan,

pemupukan,danpengendalianhamadanpenyakit.
Penggunaanpolybagbesarlebihsedikitkarenaseleksiawalsekitar

10%telahdilakukandanlamapembibitandalamkantongplastik

besarlebihsingkat.

Kebutuhantanahlebihsedikit.

Biayapenyiramanlebihmurah.

2.7. Panen(Harvesting)

Tanaman kelapa sawitmulaiberbuah setelah 2,5tahundan masak5,5

bulansetelahpenyerbukan.Dapatdipanenjikatanamantelahberumur31bulan,

sedikitnya60%buahtelahmatangpanen,dari5pohonterdapat1tandanbuah

matangpanen.Ciritandanmatangpanenadalahsedikitnyaada5buahyang

lepas/jatuh (brondolan) dari tandan yang beratnya kurang dari 10 kg atau

sedikitnyaada10buahyanglepasdaritandanyangberatnya10kgataulebih.

Disampingituadakriterialaintandanbuahyangdapatdipanenapabilatanaman

berumurkurangdari10tahun,jumlahbrondolanyangjatuhkuranglebih10

butir,jikatanamanberumurlebihdari10tahun,jumlahbrondolanyangjatuh

sekitar1520butir.

Gambar1.Tandanbuahyangsiappanen
Waktupanenbuahkelapasawitsangatmempengaruhijumlahdanmutu

minyakyangdihasilkan.Waktupanenyangtepatakandiperolehkandungan

minyakmaksimal,tetapipemanenanbuahkelewatmatangakanmeningkatkan

asam lemak bebas (ALB), sehingga dapat merugikan karena sebagian

kandungan minyaknya akan berubah menjadi ALB dan menurunkan mutu

minyak. Sebaliknya pemanenan buah yang masih mentah akan menurunkan

kandunganminyak,walaupunALBnyarendah.

Untuk memudahkan pemanenan, sebaiknya pelepah daun yang

menyanggabuahdipotongterlebihdahulu.Pelepahdaunyangtelahdipotong

diaturrapiditengahgawangan.Untukmempercepatprosespengeringanserta

pembusukan,makapelepahpelepahdauntersebutdipotongpotongmenjadi23

bagian.Carapemanenantandanbuahyangmatangdipotongsedekatmungkin

dengan pangkalnya, maksimal 2 cm. Tandan buah yang telah dipanen

diletakkanteraturdipiringandanbrondolandikumpulkanterpisahdaritandan.

KemudiantandanbuahatauTBS(tandanbuahsegar)danbrondolantersebut

dikumpulkan ditempatpengumpulan hasil(TPH).TBS hasil panenanharus

segera diangkut ke pabrik untuk diolah lebih lanjut. Pada buah yang tidak

segera diolah, maka kandungan ALB nya semakin meningkat. Untuk

menghindarihaltersebut,maksimal8jamTBSsetelahdipanenharussegera

diolah.
Gambar2.Tandanbuahsegarkelapasawityangtelahdipanen

Besarnya produksi kelapa sawit sangat tergantung pada berbagai

faktor,diantaranyajenistanah,jenisbibit,iklimdanteknologiyangditerapkan.

Dalamkeadaanyangoptimal,produktivitaskelapasawitdapatmencapai2025

ton TBS/ha/tahun atau sekitar 45 ton minyak sawit. Sebagai gambaran

produksiTBS,minyaksawitdanintisawitberbagaiumurtanamanperhektar,

dapatdilihatpadatableberikut:

Tabel1.PerkiraanproduksiTBS,minyaksawitdanintisawit
padaberbagaiumurtanamankelapasawit

UmurTanaman ProduksiTbs ProduksiMinyak ProduksiInti


(tahun) (ton) Sawit(ton) Sawit(ton)
3 4,00 0,52 0,11
4 7,00 1,20 0,18
5 9,67 1,80 0,40
6 11,75 2,30 0,52
7 13,40 2,72 0,59
8 14,67 3,03 0,65
9 17,67 3,37 0,78
10 19,67 4,23 0,87
11 20,83 4,53 0,92
12 21,50 4,70 0,95
13 21,83 4,77 0,96
14 22,00 4,80 0,97
15 21,83 4,77 0,96
16 21,67 4,73 0,95
17 21,33 4,67 0,94
18 21,00 4,60 0,92
19 20,50 4,50 0,90
20 20,00 4,40 0,88
21 19,50 4,30 0,86
22 19,00 4,20 0,84
23 18,50 4,10 0,81
24 18,00 4,00 0,79
25 17,50 3,90 0,77
Sumber:BalaiPengkajianTeknologiPertanian2008

2.8. Budidaya Tanaman Kelapa Sawit

2.8.1.Pembibitan(nursery)

Pembibitan merupakan tahap awal yang sangat menentukan dalam

budidaya kelapa sawit. Karena, bibit yang baik akan menghasilkan tanaman

kelapasawityangbaiksehinggakualitasCPOyangdihasilkanjugabagus.Hal

halyangharusdiperhatikanadalahsepertikegiatanberikut:

A. PemilihanTempat

Dalam persiapan pembibitan, kita harus melakukan pemilihan

tempat yang baik untuk pembibitan. Halhal yang perlu diperhatikan

dalampemilihantempatpembibitanadalahharusdekatdengansumber

air, dekat denganlahantanaman,tanahnya rata(tidakmereng),mudah

diawasi dari pencurian dan gangguan binatang, tidak ternaungi oleh

tanamantinggidanarealpembibitanharusbebasdaribahayabanjir.
B. PersiapanArealPembibitan

Setelah melakukan pemilihan tempat pembibitan, kegiatan


selanjutnya adalah mempersiapkan areal pembibitan yang terdiri dari
pembersihanarealdarivegetasiyangada,meratakanareal,membuatjalan
supayadirancangsempurnaagaradaakseskesetiapbagianpembibitandan
membuat drainase jika diperlukan. Selain itu kita juga harus membuat
instalasiairdengancarapemasangansprinkler,jarakdalambarisan12m
danjarakantarbarisan18m.

C. PersiapanKecambah

Kegiatanselanjutnyaadalahmempersiapkankecambah.Kecambah
/benihadalahfaktoryangsangatpentingdalamsuatupembibitan.Kerusakan
kecambahyangtidakbaikakanmengakibatkankerugianyangsangatbesar,
karenakelapasawitmerupakantanamantahunansehinggajikadariawalkita
tidakmerencanakandenganbaikmakahasilkedepannyaakanmengalami
kerugian. Pada perkebunan Bah Lias Estate, kacambah yang digunakan
berasal dari Bah Lias Riset (BLRS) yang menghasilkan kecambah jenis
Tenera.Kecambahinidiperolehdaripersilanganjenisdura(sebagaipohon
ibu)danserbukPsifera(sebagaipohonbapak).KegiatanpersilangandiBah
LiasEstatedilakukanolehpihakBLRS.
Tahapan kegiatan persilangan yaitu pemilihan pohon induk,

pemilihan pohon induk ini dilakukan setelah dilakukan serangkaian

kegiatantesterhadapsuaupohonsepertikadarminyak,danmelakukan

kegiatanpersilangan(polynasi)dengantahapansebagaiberikut:

a) Isolasibungabetina
Ciriciribungabetinayangsiapdiisolasiyaitumembuka.

Pelaksanaankegiatanisolasidilakukandengancaramembungkusbunga

tersebutdenganmenggunakankarungyangsudahdiberijendela

transparan.Tujuanpemberianjendelainiadalahagarsinarmataharidapat

menembuspembungkustersebutdanmemudahkanpemantauanbunga

receptif.Bungareceptifadalahbungayangtelahsiapdibuahiatau

disilangkan.Bungayangreceptifditandaidenganbungatersebut

berbentukseperticengkehataupadabagianujungtandantelahpecah

pecah,bungatelahmengeluarkanaromanektar.Nektarmerupakancairan

yangdikeluarkanolehbungabetinayangberfungsiuntukmenarik

seranggauntukmembantupenyerbukan.

b) Polynasi

Kegiataninidilakukansetelahbungabetinadiisolasiselama9hari.Polynasi
tidak boleh dilakukan dibawah 9 hari, hal ini disebabkan karena
kekhawatiranbahwamasihadaserbuklainyangmasihhidupyangnantinya
dapatmengakibatkanpenyerbukanyangdilakukangagalatautidakberhasil.
Setelah9harimakadapatdipastikanserbuklainyangtidakdiharapkantelah
mati. Polynasi ini dilakukan dengan menggunakan alat yang bernama
pooper.Polen(bungajantan)yangdigunakandalamkegiataninitergantung
darijenisapayangingindiperolehdikemudianhari.

D. PersiapanTanah

Syarattanahuntukmengisipolybagadalahtopsoilyangsubur,bebas
dari hama dan penyakit, remah dan cukup mengandung pasir, jangan
menggunakantanahbekasbakarankarenaakanmerusakkeseimbanganhara
dalamtanah,tanahharusdiayakagarbebasdarikayudansampahlain,tanah
yangdigunakantidakberasaldaridaerahgawanganmati,halinibertujuan
untukmencegahterserangnyaganodherma,jikatanahyangtersediahanya
tanahliat,tanahiniharusditambahdenganpasirsebanyak20%,dengan
tujuanagarakartanamandapattumbuhdenganbaikdanjugamemperbaiki
aerasetanahtersebut.
E. Prosespengisiantanahkedalampolybag

Halhalyangperludiperhatikanadalahtanahharusdiisisedikitdemi
sedikit sementara polybag diguncang agar tanah merata, pengisian tanah
harus penuh karena akan mengalami penyusutan ketika dipindah dan
disusun, 2/3 bagian tanah pada polybag dicampur pupuk Rock fosfat (60
gr/polybagdenganukuranpolybag38x51cm),setelahpenyusunandan
tanahsusut,sisabibirpolybag35cmdibiarkanuntukmenahanpupukatau
mulsa.Produktivitas;1wd(workingdays)=300polybag(ukurankecil),1
wd=150200polybag(ukuranbesar).
F. PenyusunanPolybag

Untukpre nursery(dua tahap), carapenyusunanpolybagnyaadalah


polybagkecildisusunrapatdalam10baris,tiapbaris berisi100polybag,
sehinggatotalsetiapbedenganadalah1000polybag.Sedangkanuntuksatu
tahap,carapenyusunanpolybagnyaadalahpolybagbesarukuran38x51cm
digunakanlangsungdalamcaraini.Susunpolybagsekitarsprinklersetiap
kelompok25polybag,dalamluas12x18mharusadasekitar300bibit.

G. PenanamanKecambah

Kecambah harus ditanam segera setelah sampai di pembibitan.


Sebelumpenanamandipolybag,harusdipastikanbahwaasistenpembibitan,
mandor dan semua pekerja penanaman mengerti teknik penanaman dan
dapat membedakanantararadikula (akar)danplumula (calondaun). Biji
yang akan ditanam harus sudah dapat dibedakan radikula dan plumula.
Radikulaberwarnalebihsuramdibandingplumula.Bijiyangbelumdapat
dibedakan antara radikula dan plumula dimasukkan kembali dan dijaga
kelembaban dengan menyemprot dengan air bersih. Kecambah yang
beradikula/ plumula panjang harus hatihati dalam penanaman. Ketika
menanamkecambah,janganmengambilterlalubanyakkarenasebagianakan
terkenasinarmataharilangsungterlalulama.Kegiatanpenanamanterdiri
darimembuatlubangditengahpolybagdenganjarijari22,5cm,masukkan
kecambah kedalam lubang dengan radikula menghadap kebawah dan
plumulamenghadapkeatas,tutupdengantanahdantekandenganjarihati
hati,sebelumdansesudahpenanaman,polybagharusdisiram.Produktivitas;
1wd=1000kecambah.

H. Penyiraman

Kriteriadalampenyiramanadalahdibawahumur12bulanperlu1liter
perhariperpolybag,setaradengan20mmhujan.10mmpagidan10mm
sore,dandiatasumur12bulandiperlukan1,5literperhariperpolybag,
setaradengan30mmhujan.15mmpagidan15mmsore.Kegiatanini
dilakukandenganmenggunakanselangyangterhubungdenganselangutama
denganujungselangyangdipasangmatagembor.Sistempenyiramannya
adalah tulang ikan atau mengikuti selang utama agar mudah dalam
penyiraman.
I. Penyiangan(Weeding)

Penyiangandilakukan2kalidalam1bulan.Kegiataninidilakukan
dengancaramembersihkangulmayangtumbuhdalamdanluarpolybagdan
tergantung juga pada kondisi gulma yang tumbuh di areal pembibitan.
Penyiangan rumput dalam polybag dilakukan dengan cara manual yaitu
dengan mencabut rumput yang tumbuh dalam polybag. Sedangkan
penyiangandiluarpolybagdilakukandenganduacarayaitumanualdan
chemical. Penyiangan secara manual dilakukan dengan cara mencangkul
rumputyangtumbuhdisekitarpolybag.Setelahdicangkulrumputtersebut
dikumpulkandalambeberapabedengandenganmenggunakangaru.
Pengendaliangulmadengancarachemicaldilakukandengancara

penyemprotanyangmenggunakanherbisidadenganbahanaktif glifosat

seperti Round Up dan Smart. Herbisida yang akan digunakan ditakar

sesuaidengandosis6 cc/Liter.Sebelumdicampurdenganair,herbisida

dicampurdenganairyangperbandingannya1:1.Setelahherbisidaditakar,

kemudiandicampurdenganairdandiaduksupayamerata.Penyemprotan

dilakukandibarisanantarpolybag denganjaraksemprot 15cm agar

percikan herbisida tidak mengenai daun atau bagian lainnya pada

tanaman.

J. Seleksi

Seleksimerupakankegiatanyangsangatpentingkarenakesalahan
dalamseleksidapatmengakibatkanterjadinyakerugiandimasaakandatang.
Dalampelaksanaanseleksikitaharusmengetahuikriteriakriteriatanaman
yangharusdiseleksi.Dalampelaksanaannyaseleksidilakukansebanyak3
kaliyaitupadasaattanamanberumur3bulan,6bulan,dan9bulan.

K. Pemupukan(manuring)

DosisdanjadwalberdasarkansirkulardariED.Produktivitas;Pupuk
cair,1wd 3.000polybag(umur13bulan).Pupukgranular;1wd=1500
2000polybag(umur39bulan).
M) PengendalianHamadanPenyakit(pestanddiseasecontrol)

Pengendalian hama dan penyakit perlu dilakukan karena akan


berpengaruhterhadaphail/produksi.Pengendalianhamadanpenyakityamg
terlambat akan mengakibatkan kerugian yang besar. Bah Lias Estate
menetapkansystempengendalianhamaterpadu(PHT)yangdikenaldengan
Early warning system (EWS) yaitu penerapan pengendalian biologis dan
apabilaterjadidalamkondisidaruratbarusecarakimia.Pengendalianalami
inidilakukandengancaramenanamtanamanyangnantinyamenjadisarang
predator yang merupakan musuh alami dari hamahama yang ada di
pembibitansepertibungapukuldelapan(Turnerasubulata),bungaair mata
pengantin(antigononleptopus). Pengendaliansecarakimiawidilakukanjika
tingkatseranganhamayangada sudah sangat tinggi. Hama yang
sering menyerangbibit kelapa sawit adalah apogonia,
adoratuscompresus,aphids,tetranycuspiercey,hypomecessqomacus,
dll.Hamahamayangmenyerangpadapembibitankelapasawitadalah:
Tabel2.Namanamahamapadapembibitankelapasawit
No NamaHama Ciriciri
1 Adoratus Tubuh berwarna coklat,
compresus panjangtubuh1,5cmdan
punyabulubuluhalus

2 Apogonia Tubuh berwarna hitam


mengkilap,panjang tubuh
1,2cmdantidakberbulu
3 Apids Tubuh berwarna hijau,
ukurantubuhkecil

4 Hypomece Tubuhberwarnakuning
sqomacus
Pengendalian hamahama dapat dilakukan dengan menggunakan
pestisida Regen, Decis, marsal, Mitac, matador, Dipel, dll. Cara
aplikasinya dengan disemprot menggunakan Conventional knapsack
Sprayer (CKS),dan mistblower. Jenispenyakityangmenyerangadalah
Batriodiplodiadanculvuria.Gejalaseranganbatriodilpodiaterdapatnya
bercakbercakkuningdariujungdaundanbagiantengahbercakberubah
menjadimenjadiabuabu/hitam.Gejala Culvularia yaituadanyabercak
kuningdantembuscahaya,semakinlamabercakakansemakinbesardan
mengakibatkan daun keriting dan kering. Pengendaliannya biasanya
dilakukan dengan menggunakan antrakol sebanyak 2 gr. Pengendalian
hamapenyakitinibiasanyadilakukan2kalidalam1bulan.

2.8.2. PemeliharaanTanaman(upkeep)

Pemeliharaanpadatanamankelapasawitdibedakanpadaduafaseyaitu

pada tanaman belum menghasilkan (TBM/immature) dan tanaman

menghasilkan(TM/mature).

Kegiatanpemeliharaanyangdilakukanadalah:

a. Penyisipan(Suplying)

Penyisipanharusdilakukanpalinglama23tahunsetelahtanam.
Halini

dilakukanuntukmencegahtidakterjadinyakeseragamantumbuh.Dalam

kegiataninibibityangdigunakanharussejenisdenganpohonyangsudah

ditanamsebelumnya.Pohonyangdisisipyaitupohonyangmatikarena

terseranghamaOryctes,tikusataupunhamayanglainnyadanpohonyang

belummatitapikondisinyakurangterjamindanbengkok.
b. Konsolidasi

Konsolidasisebaiknyadilakukan1minggusetelahbibitditanamdi
lapangan.

Tujuannya untuk memperbaiki penanaman tanaman yang kurang

sempurnasepertiadanyatanamanyangmiringkarenatanahyangkurang

padat.Konsolidasidilakukandengancaramemadatkantanahdisekeliling

pohondenganmenggunakantugalsampaitanahbenarbenarpadat,tanah

disekitarpohontelahberbentukcekungansepertikuali.

c. Pemupukan(manuring)

Kegiatanpemupukanbertujuanuntukmemberikannutrisibagi
tanamanyang

berguna untuk pertumbuhan tanaman tersebut. Kegiatan ini dilakukan

sebanyak 2 kali dalam 1 bulan yaitu pada bulan JanuariFebruari dan

bulanJuliAgustus.Jumlahpupukuntuksetiaptanamanberdasarkanumur

tanamandandanayangtelahdisiapkanperusahaan.Sebelumdilakukan

pemupukanharusdilakukankegiatansensuspohonterlebihdahuluyang

dilakukan pada bulan Juni, tujuan sensus pohon ini adalah untuk

mengetahui jumlah pohon yang ada nantinya digunakan untuk

menentukan pemesanan pupuk, dll. Pelaksanaan pemupukan ini harus

sesuaidenganSOP(standarOperatingProcedure).

Setelahtanamanmemasukiusia mature yaknipadasaattanaman

berumur32bulanmakakebutuhanpupukyangakandiberikandilakukan

berdasarkanLSU(leafsampleunit)yaitupengambilancontohdaunyang
dilakukan oleh pihak BLRS. Berdasarkan hasil uji laboratorium yang

dilakukan, maka pihak riset memberikan rekomendasi dosis dan jenis

pupuk yang harus diberikan untuk tanaman pada areal yang telah

ditentukan.

d. Pengendaliangulma

Dilakukansetiap6bulansekali.Kegiataninidapatdilakukandengan
cara

manualweedingdanchemicalweedingsepertiselektifweeding.Kegiatan

selektifweedingdilakukandengancaramendongkelgulmayangtumbuh

padaarealperkebunansepertianakkayu,pohonpisangliar,keladi,dll.

Kegiatanlainnyaadalahmemotongkacanganyangmerambatpadapohon

kelapasawitdenganmenggunakanbahanherbisidaberbahanaktifglifosat

danamin.

e. Kastrasi(Castration)

Kegiataninidilakukandengancaramembuangbungajantandan
bungabetina

yangterdapatpadatanamankelapasawit.Kegiataninidilakukandengan

menggunakan alat seperti tojok/dodos. Kastrasi dilakukan sekali yaitu

pada saat tanaman berumur 21 bulan. Kegiatan yang dilakukan adalah

membuang seluruh bunga jantan dan bunga betina, serta membuang

seluruhpelepahbusukyangada,inidilakukanpadaarealyangberdekatan

pohon yang didekatnya sudah ada pohon yang menghasilkan, berbeda

dengan areal new planting dimana belum ada tanaman yang


menghasilkan.Dalamproseskastrasiharusditinggalkansebagianbunga

jantanuntukprosespenyerbukan.Halinidilakukandengantujuanuntuk

merangsangEladibiluskameronicusdatangkepohontersebut.

Tujuandilakukankastrasiyaitu:

Mempercepatpertumbuhanvegetativesehinggatanamanakan
lebihsehat.

Membesarkan batang kelapa sawit itu sendiri dan

menyeragamkanwaktupanen.
Memperoleh kondisi tanaman yang bersih sehingga akan

mengurangikemungkinanseranganhamadanpenyakit.

f. Pemangkasan(pruning)

Caranyamasukkanmataegrekdiantarapelepahyangingindipruning
dan mepet ke batang, tujuannya agar berondolan tidak terselip diantara
pelepah.Pelepahyangdipotongyaitusangga3atau3pelepahdaribuah
yang paling tua. Pelaksanaan pruning dilakukan oleh 2 orang (1 geng)
dimanasatuorangmelakukanpruningdan1lagimenyusunpelepah.Pelepah
yangsudahdipangkas diletakkandiantara pohonmenghadap pasarpanen
yangtujuannyauntukmemperudahpekerjadalammelaksanakanprunning.
g. Pemeliharaanpiringandan

pasarpanenTujuandari

kegiataniniadalah:

1) Memudahkandalampengutipanberondolan

2) Mempermudahkegiatanpanendankegiatanpemeliharaan
lainnya
3) Menghindarkanpersaingandalampengambilanunsurhara
olehtanaman.

Pemeliharaanpiringandilakukandenganduacarayaitu:

1) Manual

Dilakukandengancaramenggarukgulmayangadadengan
menggunakan

garusampaijarijaripiringandaripangkalpohon.

2) Mekanis

Pemeliharaansecaramekanisdilakukandengan
menggunakanherbisida

seperti smart dan diamin dengan cara penyemprotan. Kegiatan

penyemprotandipiringandilakukandenganmenggunakanherbisida

berbahan dasar glifosat (smart) dan diamin. Herbisida yang akan

digunakanterlebihdahuluditakardenganmenggunakangelasukur.

Konsentrasismartyangdigunakanadalah3,75cc/Ldandiamin2,5

cc/L. Kedua herbisida ini dimasukkan kedalam drigen 20 L dan

diadukdenganmenggunakankayusampaikeluarbuih.

Setelah tercampur rata, campuran tersebut dituan kedalam

knapsack sprayer sebanyak 10 L. Penyemprotan ini dilakukan di

sekelilingpohonkelapasawitdanpasarpanen.
2.9. Panendanproduksi

A. UmurPanen

Tanaman kelapa sawit mulai berbuah pada umur 2,5 tahun dan
buahnya masak 5,5 bulan setelah penyerbukan. Saat umur 18 bulan setelah
tanamkelapasawitmenghasilkanbuahyangdikenaldenganbuahpasir,tetapi
buahyangdihasilkanmemilikiukuranyangsangatkecildanmemilikikadar
minyakyangsangatsedikit.Untukitulahpihakperkebunanmelakukankegiatan
kastrasiuntukmembuangbuahyangbelumdiharapkan.Kegiatanpanenkelapa
sawitdimulaijikatanamantelahberumur30bulan.
B. KriteriaPanen

Perkebunan Bah Lias Estate menerapkan peraturan bahwa buah yang


dapat dipanenadalahbuahyangtelahmasakdengankriteriatelahterdapat5
berondolan di piringannya. Tujuan dari penetapan kriteria ini adalah untuk
memperolehCPOyangberkualitaskarenajikabuahyangdipanenmasihbelum
masak atau terlalu masak akan mengakibatkan kualitas dari CPO yang
dihasilkanmenurun.
Kriteriabuahdalamkegiatanpanenyaitu:

Immature :buahyangmentahatautidakada
berondolannya.

Unripe :berondolan19

Underripe:berondolan1024

Normalripe:berondolanlebihdari25

Overripe :50%buahberondolan

Abnormal :janjanganbuahterbelah,dalamsatuTBSadabuah

jantandanbetina.
C. Rotasipanen

Dalamperkebunanrotasipanenseringjugadisebutdenganpusingan
panen yang artinya merupakan jarak waktu memanen disatu blok sampai
kembalikeblokyangsama.Rotasipanenjugaberhubungandenganancak
panen(wilayahpanen).Rotasipanenyangterlalurendahakanmengakibatkan
berkurangnyajumlahbuahyangdipanensehinggapembagianancakpanen
semakinlebaragarpemanenbisamencapaitarget.DalambahLiasEstate,
rotasipanenyangdilakukanadalah7hari.Jikakondisibuahbanyakmaka
dilakukan Sunday harvesting yaitu pelaksanaan panen diluar hari kerja
(minggu).
D. SistemAncakPanen

Ancak panen adalah luasan areal yang menjadi tanggung jawab


setiap pemanen untuk mengambil buah/hasil panen setiap hari. Pembagian
ancakpanendilakukandenganmelihatkerapatanbuahyangmatangdalam
suatublok/fieldyangakandipanenbesokharinyamelaluisensuskerapatan
buah.Sistemancakpanenyangdigunakanadalahancakgiringdimanasetiap
pemanenmemanenbuahpadafieldyangberbedasetiapharinya.Namun,jika
panendilakukandifieldyangsamapemanentersebutakankembalikeancak
sebelumnya.

2.10.PascaPanenKelapaSawit
1. Perebusan (sterilisasi) TBS
TBS yang masuk kedalam pabrik selanjutnya direbus di
dalam sterilizaer. Buah direbus dengan tekanan 2,5-3 atm dan suhu 130o C
selama 50-60 menit. Tujuan perebusan TBS adalah: Menonaktifkan
enzim lipase yang dapat menstimulir pembekuan freefatty acid Membekukan
protein globulin sehingga minyak mudah dipisahkan dari air. Mempermudah
perontokan buah Melunakkan buah sehuingga mudah diekstraksi
2. Periontokan buah
Dalam tahap ini buah selanjutnya dipisahkan dengan menggunakan
mesintresher. Tandan kosong disalurkan ke temapat pembakaran atau
digunakan sebagai bahan pupuk organic. Sedangkan buah yang telah
dirontokkan selanjutnya dibawa kemesin pelumatan. Selama proses perontokan
buah, minyakl dan kernel yang terbuang sekitar 0,03%.

3. Pelumatan buah
Proses pelumatan buah adalah dengan memotong dan mencacah buah di
dalamsteam jacket yang dilengkapi dengan pisau berputar. Suhu didalam steam
jacket sekitar 85-90oC.
Tujuan dari pelumatan buah adalah:
Menurunkan kekentalan minyak, membebaskan sel-sel yang mengandung
minyak dari serat buah, menghancurkan dinding sel buah sampai
terbentuk pulp
4. Pengempaan (ekstraksi minyak sawit).
Proses pengempaanb bertujuan untuk membantu mengeluarkan minyak
dan melarutkan sisa-sisa minyak yang terdapat didalam ampas. Proses
pengempaan dilakukan dengan melakukan penekanan dan pemerasan pulp
yang dicampur dengan air yang bersuhu 95oC. Selain itu proses ekstraksi
minyak kelapa sawit dapat dilakukan dengan cara sentrifugasi, bahan pelarut
dan tekanan hidrolis.
5. Pemurnian (klarifikasi minyak )
Minyak kelapa sawit yang dihasilkan dari mesin ekstraksi minyak sawit
umumnya masih mengandung kotoran berupa tempurung, serabut dan air ekitar
40-45% air. Untuk itu perlu dilakukan pemurnian minyak kelapa sawit.
Presentase minyak sawit yang dihasilkan dalam oproses pemurnian sekitar
21%. Proses pemurnian minyak kelap sawit terdiri dari beberapa tahapan yaitu
a. pemurnian minyak di dalam tangki pemisah (clarification tank)
prinsip dari proses pemurnian minyak di dalam tangki pemisah
adalah melakukan pemisahan bahan berdasarkan berat jenis bahan
sehingga campuran minyak kasar dapat terpisah dari air.
b. Sentrifugasi minyak
dalam tahap ini minyak dimurnikan dari berbagai macam
kotoran yang lebih halus lagi. Hasil akhir dari proses sentrifugasi ini
adalah minyak dengan kadar kotoran kurang dari 0,01%.

c. Pengeringan hampa
Dalam tahap ini kadar air diturunkan sampai 0,1%. Proses
penngeringan hampa dilakukan dalam kondisi suhu 95oC dan tekanan-
75cmHg.
d. Pemurnian minyak dengan tangki lumpur
Proses pemurnian didalam tangki lumpur bertujuan untuk
memisahkan minyak dari lumpur.
e. Strainer
Dalam tahap ini minyak dimurnikan dari sampah halus
f. precleaner
proses precleaner bertujuan untuk memisahkan pasir pasir harus
dari sludge.
g. Sentrifugasi lumpur
Dalam tahap ini minyak dimurnikan kembali dari air dan
kotoran. Prinsip yang digunakan adalah dengan memisahkan bahan
berdasarkan berat jenis masing-masing bahan.
h. Setrifugasi pemurnian minyak
Tahap ini hampir sama dengan sentrifugasi lumpur, hanya
putaran sentrifugasi lebih cepat.
6. Pemberian merek
Nama barang jenis mutu, identitas penjual, produce of Indonesia,
berat bersih, nomor karung, identitas pembeli, pelabuhan/negara tujuan.
KESIMPULAN

Dari uraian diatas dapat saya simpulkan bahwa kelapa sawit adalah
tanaman penghasil minyak nabati yang dapat menjadi andalan dimasa depan
karena berbagai kegunaannya bagi kebutuhan manusia. Kelapa sawit termasuk
tanaman daerah tropis yang umumnya dapat tumbuh di daerah antara 120 Lintang
Utara 120 Lintang Selatan. Curah hujan optimal yang dikehendaki antara 2.000-
2.500 mm per tahun dengan pembagian yang merata sepanjang tahun. Lama
penyinaran matahari yang optimum antara 5-7 jam per hari dan suhu optimum
berkisar 240-380C.
Tanaman kelapa sawit mulai berbuah setelah 2,5 tahun dan masak 5,5
bulan setelah penyerbukan. Dapat dipanen jika tanaman telah berumur 31 bulan,
sedikitnya 60% buah telah matang panen, dari 5 pohon terdapat 1 tandan buah
matang panen. Ciri tandan matang panen adalah sedikitnya ada 5 buah yang
lepas/jatuh dari tandan yang beratnya kurang dari 10 kg atau sedikitnya ada 10
buah yang lepas dari tandan yang beratnya 10 kg atau lebih. Tanaman dengan
umur kurang dari 10 tahun, jumlah brondolan kuran lebih 10 butir dan tanaman
dengan umur lebih 10 tahun, jumlah brondolan sekitar 15-20 butir. Tanaman
kelapa sawit akan menghasilkan tandan buah segar (TBS) yang dapat dipanen
pada saat tanaman berumur 3 atau 4 tahun.