Anda di halaman 1dari 71

BAB I

KUALITAS DAN MANAJEMEN KUALITAS

Definisi kualitas, Manajemen kualitas dan TQM

Kata kualitas memiliki banyak definisi yang berbeda, bervariasi dari konvensional
sampai yang lebih strategic.Definisi konvensional dari kualitas biasanya menggambarkan
karakteristik langsung dari suatu produk seperti kinerja (performance), keandalan
(reliability), kemudahan dalam penggunaan (easy of use), estetika (esthetics), dan sebagainya.
Bagaimanapun cara manajer dari perusahaan yang sedang berkompetisi dalam pasar global
harus memberikan perhatian serius pada definisi kualitas yang bersifat strategik yaitu
kualitas adalah segala sesuatu yang mampu memenuhi kebutuhan pelanggan (meeting the
needs of customers).

Dalam Quality vocabulary, kualitas didefinisikan sebagi totalitas dari karakteristik


suatu produk yang menunjang kemampuannya untuk memuaskan kebutuhan yang
dispesifikasikan atau ditetapkan.Kualitas seringkali diartikan sebagai kepuasan pelanggan
(customer satisfaction) atau kesesuaian terhadap kebutuhan atau persyaratan (conformance to
the requirements).
Ada beberapa elemen bahwa sesuatu dikatakan berkualitas, yaitu
1. Kualitas meliputi usaha memenuhi atau melebihi harapan pelanggan.
2. Kualitas mencakup produk, jasa, manusia, proses, dan lingkungan.
3. Kualitas merupakan kondisi yang selalu berubah (apa yang dianggap berkualitas saat
ini mungkin dianggap kurang berkualitas pada saat yang lain).
4. Kualitas merupakan suatu kondisi dinamis yang berhubungan dengan produk, jasa,
manusia, proses, dan lingkungan yang memenuhi atau melebihi harapan.

Manajemen kualitas adalah aspek-aspek dari fungsi manajemen keseluruhan yang


menetapkan dan menjalankan kebijakan mutu suatu perusahaan/organisasi. Dalam rangka
mencukupkan kebutuhan pelanggan dan ketepatan waktu dengan anggaran yang hemat dan
ekonomis, seorang manager proyek harus memasukkan dan mengadakan pelatihan
management kualitas.

1
Total Quality Manajemen diartikan sebagai perpaduan semua fungsi dari perusahaan
ke dalam falsafah holistic yang dibangun berdasarkan konsep kualitas, teamwork,
produktivitas, dan pengertian serta kepuasan pelanggan (Ishikawa dalam Pawitra, 1993).
Definisi lainnya menyatakan bahwa TQM merupakan system manajemen yang menyangkut
kualitas sebagai strategi usaha dan berorientasi pada kepuasan pelanggan dengan melibatkan
seluruh anggota organisasi (Santosa, 1992).
Berdasarkan pengertian diatas, dapat disimpulkan Totalquality management
merupakan suatu pendekatan dalam menjalankan usaha yang mencoba untuk
memaksimumkan daya saing organisasi melalui perbaikan terus-menerus atas produk, jasa,
manusia, proses, dan lingkungannya.

Pentingnya Kualitas dan Manfaat menerapkan keunggulan kualitas bagi organisasi

Kualitas merupakan elemen yang penting dalam operasi, ada tiga alasan kualitas itu
penting, yaitu:
Reputasi Perusahaan.
Kualitas akan muncul sebagai persepsi tentang produk baru perusahaan, kebiasaan
pekerjanya, dan hubungan pemasoknya.
Kehandalan Produk.
Pengadilan terus berusaha menghukum organisasi-organisasi yang merancang,
memproduksi, atau mengedarkan produk atau jasa yang penggunaannya
mengakibatkan kerusakan atau kecelakaan. Contohnya: Consumer Product Safety
Act.
Keterlibatan global.
Kualitas adalah suatu perhatian internasional. Produk-produk perusahaan yang
akan bersaing di pasar internasional harus memenuhi ekspetasi akan kualitas,
desain, dan harganya secara global.

Penerapan keunggulan kualitassangat bermanfaat baik bagi pelanggan, institusi,


maupun bagi staf organisasi.
Manfaat Total Quality Management bagi pelanggan adalah:
1. Sedikit atau bahkan tidak memiliki masalah dengan produk atau pelayanan.
2. Kepedulian terhadap pelanggan lebih baik atau pelanggan lebih diperhatikan.
3. Kepuasan pelanggan terjamin.

2
Manfaat TQM bagi institusi adalah:
1. Terdapat perubahan kualitas produk dan pelayanan
2. Staf lebih termotivasi
3. Produktifitas meningkat
4. Biaya turun
5. Produk cacat berkurang
6. Permasalahan dapat diselesaikan dengan cepat.
Manfaat TQM bagi staf Organisasi adalah:
1. Pemberdayaan
2. Lebih terlatih dan berkemampuan
3. Lebih dihargai dan diakui

Manfaat lain dari implementasi TQM yang mungkin dapat dirasakan oleh institusi di
masa yang akan datang adalah:
1. Membuat institusi sebagai pemimpin (leader) dan bukan hanya sekedar pengikut
(follower)
2. Membantu terciptanya tim work
3. Membuat institusi lebih sensitif terhadap kebutuhan pelanggan
4. Membuat institusi siap dan lebih mudah beradaptasi terhadap perubahan
5. Hubungan antara staf departemen yang berbeda lebih mudah

Dimensi dan Perspektif Kualitas

Pendekatan yang dikemukakan Davis menegaskan bahwa kualitas bukan hanya


menekankan pada aspek akhir yaitu produk dan jasa tetapi juga menyangkut kualitas
manusia, kualitas proses dan kualitas lingkungan. Sangatlah mustahil menghasilkan produk
dan jasa yang berkualitas tanpa melalui manusia dan produk yang berkualitas.
Davis dalam Yamit mengidentifikasikan lima pendekatan perspektif kualitas yang dapat
digunakan oleh para praktisi bisnis, yaitu :
1. Transcendental Approach
Kualitas dalam pendekatan ini adalah sesuatu yang dapat dirasakan, tetapi sulit
didefinisikan dan dioperasionalkan maupun diukur.
2. Product-based Approach

3
Kulitas dalam pendekatan ini adalah suatu karakteristik atau atribut yang dapat diukur.
Perbedaan kualitas mencerminkan adanya perbedaan atribut yang dimiliki produk secara
objektif, tetapi pendekatan ini tidak dapat menjelaskan perbedaan dalam selera dan
preferensi individual.
3. User-based Approach
Kualitas dalam pendekatan ini didasarkan pada pemikiran bahwa kualitas tergantung pada
orang yang memandangnya, dan produk yang paling memuaskan preferensi seseorang atau
cocok dengan selera (fitnes for used) merupakan produk yang berkualitas paling tinggi.
4. Manufacturing-based Approach
Kualitas dalam pendekatan ini adalah bersifat supply-based atau dari sudut pandang
produsen yang mendefinisikan kualitas sebagai sesuatu yang sesuai dengan persyaratan
(conformance quality) dan prosedur. Pendekatan ini berfokus pada kesesuaian spesifikasi
yang ditetapkan perusahaan secara internal. Oleh karena itu, yang menentukan kualitas
adalah standar standar yang ditetapkan perusahaan, dan bukan konsumen yang
menggunakannya.
5. Value-based Approach
Kualitas dalam pendekatan ini adalah memandang kualitas dari segi nilai dan harga.
Kualitas didefinisikan sebagai affordable ascellence. Oleh karena itu kualitas dalam
pandangan ini bersifat relatif, sehingga produk yang memiliki kualitas paling tinggi belum
tentu produk yang paling bernilai. Produk yang paling bernilai adalah produk yang paling
tepat beli.

Berdasarkan perspektif kualitas, Garvin dalam Yamit mengembangkan dimensi


kualitas ke dalam delapan dimensi yang dapat digunakan sebagai dasar perencanaan strategis
terutama bagi perusahaan atau manufaktur yang menghasilkan barang kedelapan dimensi
tersebut adalah sebagai berikut :
1. Performance ( kinerja ) :Yaitu karakteristik pokok dari produk inti.
2. .Features : Yaitu karakteristik pelengkap atau tambahan
3. Reliability ( kehandalan ) : Yaitu kemungkinan tingkat kegagalan pemakaian
4. Conformance ( kesesuaian ) : Yaitu sejauh mana karakteristik desain dan operasi
produk memenuhi standar standar yang telah ditetapkan sebelumnya.
5. Durabilty (daya tahan) : Yaitu mengukur berapa lama suatu umur teknis maupun
umur ekonomis suatu produk.

4
6. Serviceability ( pelayanan ) : Yaitu mudah untuk diperbaiki, yang meliputi kecepatan,
kompetensi, kenyamanan, kemudahan, dalam pemeliharaan dan penanganan keluahan
yang memuaskan.
7. Aesthetics( estetika ) : Yaitu menyangkut corak, rasa dan daya tarik produk
8. Percived Quality : Yaitu menyangkut Citra atau reputasi produk serta tanggung jawab
perusahaan terhadap produk.

Sejarah Kualitas dan TQM

Pada mulanya sistem untuk memonitor dan memanager kualitas hanya berupa
pengukuran (inspection), yang akhirnya banyak mengalami perkembangan sehingga dikenal
dengan adanya sistem pengendalian kualitas (Quality Control) serta jaminan kualitas (Quality
Assurance).Sejak tahun 1970, sistem-sistem tersebut diatas yaitu Inspection, Quality Control
dan Quality Assurance dikembangkan dan disempurnakan menjadi Total Quality
Management (TQM). Dimana TQM ini mengintegrasikan semua level di atas menjadi satu
kesatuan untuk menghasilkan sesuatu yang berkualitas.
TQM adalah pendekatan manajemen pada suatu organisasi, berfokus pada kualitas dan
didasarkan atas partisipasi dari keseluruhan sumber daya manusia dan ditujukan pada
kesuksesan jangka panjang melalui kepuasan pelanggan dan memberikan manfaat pada
anggota organisasi (sumber daya manusianya) dan masyarakat TQM juga diterjemahkan
sebagai pendekatan berorientasi pelanggan yang memperkenalkan perubahan manajemen
yang sistematik dan perbaikan terus menerus terhadap proses, produk, dan pelayanan suatu
organisasi. Proses TQM memiliki input yang spesifik (keinginan, kebutuhan, dan harapan
pelanggan), mentransformasi (memproses) input dalam organisasi untuk memproduksi
barang atau jasa yang pada gilirannya memberikan kepuasan kepada pelanggan (output).
Tujuan utama Total Quality Management adalah perbaikan mutu pelayanan secara terus-
menerus.Dengan demikian, juga Quality Management sendiri yang harus dilaksanakan secara
terus-menerus. Sejak tahun 1950-an pola pikir mengenai mutu terpadu atau TQM sudah
muncul di daratan Amerika dan Jepang dan akhirnya Koji Kobayashi, salah satu CEO of
NEC, diklaim sebagai orang pertama yang mempopulerkan TQM, yang dia lakukan pada saat
memberikan pidato pada pemberian penghargaan Deming prize di tahun. Banyak perusahaan
Jepang yang memperoleh sukses global karena memasarkan produk yang sangat bermutu.
Perusahaan/organisasi yang ingin mengikuti perlombaan/ bersaing untuk meraih laba/manfaat
tidak ada jalan lain kecuali harus menerapkan Total QualityManagement.

5
Di Jepang, TQM dirangkum menjadi empat langkah, yaitu sebagai berikut:
a. Kaizen: difokuskan pada improvisasi proses berkelanjutan (continuousImprovement)
sehingga proses yang terjadi pada organisasi menjadi visible (dapat dilihat), repeatable
(dapat dilakukan secara berulang-ulang), dan measurable (dapat diukur).
b. Atarimae Hinshitsu: berfokus pada efek intangible pada proses dan optimisasi dari efek
tersebut.
c. Kansei: meneliti cara penggunaan produk oleh konsumen untuk peningkatan kualitas
produk itu sendiri.
d. Miryokuteki Hinshitsu: manajemen taktis yang digunakan dalam produk yang siap untuk
diperdagangkan. Penerapan Total Quality Management dipermudah oleh beberapa piranti,
yang sering disebut alat TQM. Alat-alat ini membantu kita menganalisis dan mengerti
masalah-masalah serta membantu membuat perencanaan.

Konsep, prinsip, dan metode TQM

Konsep Total Quality Management

Konsep TQM ini memerlukan komitmen semua anggota organisasi terhadap


perbaikan seluruh aspek manajemen organisasi. Pada dasarnya, konsep Total Quality
Management mengandung tiga unsur yaitu :

1. Strategi nilai pelanggan


Nilai pelanggan adalah manfaat yang dapat diperoleh pelanggan atas penggunaan
barang atau jasa yang dihasilkan perusahaan dan pengorbanan pelanggan untuk
memperolehnya. Strategi ini merupakan perencanaan bisnis untuk memberikan nilai
bagi pelanggan termasuk karakteristik produk, cara penyampaian, pelayanan, dan
sebagainya.

2. Sistem organisasional
Sistem organisasional berfokus pada penyediaan nilai bagi pelanggan. Sistem ini
mencakup tenaga kerja, material, mesin/teknologi proses, metode operasi dan
pelaksanaan kerja, aliran proses kerja, arus informasi, dan pembuatan keputusan.

3. Perbaikan kualitas berkelanjutan

6
Perbaikan kualitas diperlukan untuk menghadapi lingkungan eksternal yang selalu
berubah, terutama perubahan selera pelanggan. Konsep ini menuntut adanya komitmen
untuk melakukan pengujian kualitas produk secara kontinu. Dengan perbaikan kualitas
produk secara kontinu, akan dapat memuaskan pelanggan.

Prinsip-prinsip TQM:
Menurut Hensler dan Brunell (1993), ada empat prinsip utama dalam TQM yakni :
a. Kepuasan pelanggan, konsep mengenai kualitas dan pelanggan diperluas. Kualitas tidak
lagi hanya bermakna kesesuaian dengan spesifikasi-spesifikasi tertentu, tetapi kualitas
tersebut ditentukan oleh pelanggan. Kebutuhan pelanggan diusahakan untuk dipuaskan
dalam segala aspek, termasuk didalamnya harga, keamanan dan ketepatan waktu.
Kualitas yang dihasilkan suatu perusahaan sama dengan nilai (value) yang diberikan
dalam rangka meningkatkan kualitas hidup para pelanggan.
b. Respek terhadap setiap orang, setiap karyawan dipandangsebgai individu yang memiliki
talenta dan kereativitas tersendiri danunik. Dengan demikian karyawan merupakan
sumber dayaorganisasi yang paling bernilai. Sehingga setiap orang dalamorganisasi
diperlakukan dengan baik dan diberi kesempatan untukterlibat dan berpartisipasi dalam
tim pengambil keputusan.
c. Manajemen berdasarkan fakta, setiap keputusan harusberdasarkan data, bukan sekedar
pada perasaan (feeling). Konseppokoknya adalah 1). Prioritisasi (prioritization) yakni
suatu konsepbahwa perbaikan tidak dapat dilakukan pada semua aspek padasaat yang
bersamaan, mengingat keterbatasan sumber daya yangada.oleh karena itu dengan
menggunakan data maka manajemendan tim dalam organisasi dapat memfokuskan
usahanya padasituasi tertentu yang vital. 2). Variasi (variation) variabilitas
kinerjamanusia. Data statistik dapat memberikan gambaran mengenaivariabilitas yang
merupakan bagian yang wajar dari setiap sistemorganisasi. Dengan demikian manajemen
dapat memprediksi hasildari setiap keputusan dan tindakan yang dilakukan.
d. Perbaikan berkesinambungan, setiap perusahaan perlu melakukanproses secara
sistematis dalam melaksanakan perbaikanberkesinambungan. Konsep yang berlaku disini
adalah sikluPDCA(plan-do-chek-act) yang terdiri dari langkah-langkahperencanaan,
pelaksanaan rencana, pemeriksaan hasilpelaksanaan rencana, dan tindakan korektif
terhadap hasil yangdiperoleh.

7
Metode TQM

Dua macam pendekatan Model TQM adalah sebagai berikut:


a. Traditional Management Approach (Model Pendekatan Tradisional)Model ini adalah
model yang palingsering digunakan, yaitu pimpinanperusahaan membuat suatu
pendekatanTQM dengan memaksakan penerapanTQM yang akan diberlakukan ke
HRDdan OM. Hal ini berarti bahwapimpinan tidak berdampingan denganHRD dan OM
dalam merancang TQMitu sendiri. Akibatnya adalahpendekatan ini dapat
mengalamikegagalan sebanyak 80%. Hal ituterjadi karena yang terkesan dari
TQMdengan pendekatan ini adalah Rat Race atau perburuan hadiah yang
akanmenimbulkan cara-cara tidak sehat atauRun end atau kinerja yang mendadakberhenti
ketika seorang karyawanmerasa tidak mampu ataupun sudahpuas.

b. Integrated Management Approach (Model Pendekatan Terpadu)TQM adalah perpaduan


danpenyeimbangan antara budaya kerjayang telah ada di OM dan HRD denganbudaya
yang akan diciptakan olehTQM sehingga tercipta suatu garistengah yang menjembatani
semuakebutuhan dan kebudayaan HRD danOM dengan alur dari TQM dengantujuan
yang dibawa oleh TQM. Dengandemikian, di antara ketiganya akantercipta suatu
integritas, kesepahaman,tanpa adanya rasa saling dirugikan danmereka akan berkinerja
lebih baik tanpaperlu merasakan aura kompetisi yangtidak sehat seperti Rat Race dan
Runs end. Tingkat keberhasilan sangat tinggimengingat akan disesuaikan antaratingkat
keberhasilan yang diinginkanperusahaan dengan kemampuan dankemauan para
pelaksana.

Delapan metode TQM yang diuraikan adalah sebagai berikut:


1. Curah Pendapat (Sumbang Saran) Brainstorming
Curah pendapat adalah alat perencanaan yang dapat digunakan untuk
mengembangkan kreativitas kelompok. Curah pendapat dipakai, antara lain untuk
menentukan sebab-sebab yang mungkin dari suatu masalah atau merencanakan
langkah-langkah suatu proyek.
2. Diagram Alur (Bagan Arus Proses)

8
Bagan arus proses adalah satu alat perencanaan dan analisis yang digunakan, antara
lain untuk menyusun gambar proses tahap demi tahap untuk tujuan analisis, diskusi,
atau komunikasi dan menemukan wilayah-wilayah perbaikan dalam proses.
3. Analisis SWOT
Analisis SWOT adalah suatu alat analisis yang digunakan untuk menganalisis
masalah-masalah dengan kerangka Strengths (kekuatan), Weaknesses (kelemahan),
Opportunities (peluang), dan Threats (ancaman).
4. Ranking Preferensi
Alat ini merupakan suatu alat interpretasi yang dapat digunakan untuk memilih
gagasan dan pemecahan masalah di antara beberapa alternatif.
5. Analisis Tulang Ikan
Analisis tulang ikan (juga dikenal sebagai diagram sebab-akibat) merupakan alat
analisis, antara lain untuk mengkategorikan berbagai sebab potensial dari suatu
masalah dan menganalisis apa yang sesungguhnya terjadi dalam suatu proses.
6. Penilaian Kritis
Penilaian kritis adalah alat bantu analisis yang dapat digunakan untuk memeriksa
setiap proses manufaktur, perakitan, atau jasa. Alat ini membantu kita untuk
memikirkan apakah proses itu memang dibutuhkan, tepat, dan apakah ada alternatif
yang lebih baik.
7. Benchmarking
Benchmarking adalah proses pengumpulan dan analisis data dari organisasi kita dan
dibandingkan dengan keadaan di dalam organisasi lain. Hasil dari proses ini akan
menjadi patokan untuk memperbaiki organisasi kita secara terus menerus. Tujuan
benchmarking adalah bagaimana organisasi kita bisa dikembangkan sehingga menjadi
yang terbaik.
8. Diagram Analisa Medan Daya (Bidang Kekuatan)
Diagram medan daya merupakan suatu alat analisis yang dapat digunakan, antara lain
untuk mengidentifikasi berbagai kendala dalam mencapai suatu sasaran dan
mengidentifikasi berbagai sebab yang mungkin serta pemecahan dari suatu masalah
atau peluang.

9
BAB II

HUBUNGAN KUALITAS, KEPUASAN PELANGGAN, DAN KEMAMPUAN


BERSAING SUATU ORGANISASI

Identifikasi Pelanggan dan Konsep Dasar kepuasan Pelanggan

Mengidentifikasi perilaku pelanggan adalah proses penelitian, mempersamakan,


mengupulkan dan menetapkan perilaku pelanggan dalam melakukan pembelian. Karena yang
ditelitinya adalah bentuk perilaku maka cara penelitian yang paling tepat dilakukan adalah
dengan cara observasi. Sedangkan yang dimaksud dengan observasi adalah penelitian dengan
cara mengamati bahasa nonverbal atau gerak-gerik tubuh, raut muka ataupun yang lainnya
dari seseorang.

Cara Mengidentifikasi Pelanggan


Cara mengidentifikasi pelanggan dibedakan kedalam 2 tipe cara pengidentifikasian.
Pembedaan tersebut didasarkan pada situasi yang dihadapi oleh perusahaan, apakah
perusahaan menghadapi situasi pasar kosumen atau situasi pasar bisnis. Untuk lebih
memperjelas tentang cara perusahaan dalam mendapatkan informasi yang detail mengenai
pelanggannya, maka akan dijelaskan lebih lanjut sebagai berikut:

Mengidentifikasi Pelanggan pada Situasi Pasar Konsumen

Dalam mengidentifikasi pelanggan pada pasar konsumen (consumer markets),


perusahaan akan menghadapi 2 jenis keadaaan yaitu: dimana perusahaan dapat bertatap muka
secara langsung dan keadaaan dimana perusahaan tidak dapat bertatap muka secara langsung.
1. Situasi Tatap Muka Secara Langsung
Jika perusahaan mempunyai kesempatan untuk bertatap muka secara langsung
dengan pelanggan maka cara mengidentifikasi pelanggan adalah sebagai berikut.
1. Memakai database komputer yang dihubungkan secara langsung dengan tempat kasir
sehingga perusahaan dapat mengetahui dan merekam semua produk yang dibeli oleh
pelanggan, dan bila suatu saat nanti pelanggan kembali lagi staf perusahaan dapat
memberikan rekomendasi atas suatu produk kepada pelanggan berdasarkan pada kebutuhan
pelanggan tersebut (Peppers et al.1999, h. 29).
2. Garansi perbaikan seumur hidup secara gratis yang meliputi semua perbaikan, seperti yang
dilakukan oleh toko sepeda Zane`s di Branford, Connecticut. Toko ini menawarkan setiap

10
pembeli sepeda sebuah garansi perbaikan seumur hidup, sehingga dengan cara ini toko ini
dapat mengidentifikasi pelanggan dari formulir garansi yang diisi oleh pelanggan dan
memastikan bahwa setiap pelangganya akan dilayani dengan baik secara personal (Peppers et
al.1999, h. 29).
3. Dapat pula dilakukan melalui telepon daftar pemesanan berupa nama dan nomor seperti yang
dilakukan oleh Indigo sebuah restauran terkenal di Atlanta. Dimana rumah makan ini hanya
memberikan layanan reservasi meja kepada pelanggan setianya atau pelanggan yang sering
mengunjugi rumah makan ini (Peppers et al. 1999, h. 29).
4. Bila perusahaan mempunyai banyak cabang, maka perusahaan dapat melakukanya dengan
menerapkan frequencymarketing plan, yaitu: suatu taktik yang dapat membantu pemasar
untuk mendapatkan informasi dari pelanggan. Dan memberikan balas jasa berupa point atau
diskon kepada pelanggan setiap kali mereka mengidentifikasikan diri mereka (Peppers et al.
1999, h. 30).

2. Situasi Tatap Muka Secara Tidak Langsung


Jika perusahaan tidak mempunyai kesempatan untuk melakukan tatap muka secara
langsung dengan pelanggan maka perusahaan dapat melakukan hal-hal sebagai berikut.
1. Product web sites and registrations
2. Recipies and cooking clubs for food product consumer
3. Contest and sweeptakes
4. Toll- free product information and comment centers

Mengidentifikasi Pelanggan pada Situasi Pasar Bisnis


Sebagaimana perusahaan yang berada pada situasi pasar konsumen,perusahaan yang
berada pada situasi pasar bisnis juga harus tetap mengidentifikasi pelangganya.
Permasalahan yang dihadapi oleh pemasar pada situasi pasar bisnis adalah mengidentifikasi
pemakai akhirdari produk mereka, menurut Peppers et al (1999, h. 43) untuk memecahkan
masalah tersebut, maka perusahaan dapat melakukan hal-hal berikut.
1. Jika perusahaan memproduksi produk pelengkap seperti tinta dan recording paper dan lain-
lain. Maka perusahaan akan mendapatkan informasi mengenai pelanggan tersebut pada saat
pemakai akhir melengkapi formulir pemesanan atau ketika menghubungi lewat telepon atau
mungkin melalui web site.
2. Jika perusahaan memproduksi produk yang membutuhkan petunjuk lengkap pemakaian
manual. Maka untuk memperoleh identitas pemakai akhir adalah dengan cara menawarkan
11
petunjuk pemakaian yang terformat sesuai dengan kebutuhan dari pemakai akhir yang
bersangkutan.
3. Jika produk dari perusahaan memerlukan perawatan secara rutin, maka perusahaan dapat
mendapatkan identitas dari pemakai akhir pada saat mereka melakukan perawatan secara
rutin tersebut.
4. Melengkapi produk dengan fasilitas koneksi melalui web site (web enabled connectivity).
Melengkapi produk dengan kemampuan untuk terhubung secara langsung dengan perusahaan
melalui web site.
5. Menganjurkan pada pemakai akhir agar mendaftarkan produk yang dibelinya kepada
perusahaan yang membuat produk yang bersangkutan, yang dapat dilakukan melalui telepon,
web site, atau melalui surat.
6. Menawarkan katalog kepada pelanggan, sehingga mereka bisa mendapatkan informasi
mengenai produk atau menyertakan formulir berlangganan majalah khusus untuk pengguna
produk tersebut secara gratis.

Mekanisme Memahami dan Memenuhi Harapan Pelanggan

Ekspektasi pelanggan dapat juga ditentukan melalui mengajukan pertanyaan tentang


berapa tingkat kinerja yang dibutuhkan untuk memenuhi Harapan pelangan itu. karakteristik
produk yang diharapkan oleh pelanggan dapat dipandang sebagai suatu hirarki progresif dari
tiga tingkat, yaitu ;

Ekspektasi dasar dari pelanggan atau yang disebut ekspektasi implisit, yaitu
tingkatan terendah dalam model hirarki ekspektasi pelanggan, yang mencakup tingkat
kinerja minimum yang selalu diasumsikan ada, dan jika karakteristik produk ini
hilang maka pelanggan akan selalu tidak puas. Contohnya produk mobil adalah badan
mobil yang anti karat telah diasumsikan merupakan atribut dasar yang otomatis ada
pada mobil itu sehingga diharpkan tidak akan berkarat dalam selang waktu tertentu.

Ekspektasi tingkat kedua dari pelanggan atau yang disebut ekspektasi eksplisit,
dimana mencakup spesifikasi dan kebutuhan, yang terdiri dari pilihan-pilihan dan
trade-offs yang tersedia untuk dipilih oleh pelanggan. Pada tingkat ini spesifikasi
dan kebutuhan ditentukan dan dinegoiasikan antara pelanggan dan pihak penjual atau
pembuat produk. Contohnya pada pembelian mobil, terdapat karakteristik seperti

12
hemat bahan bakar, akselerasi yang tinggi, warna mobil, kemampuan tenaga, harga,
dan proteksi jaminan, dimana semua spesifikasi dan kebutuan ini merupakan features
dari mobil itu.
Ekspektasi pelanggan pada tingkat tertinggi atau yang disebut ekspektasi
tersembunyi, merupakan nilai tambah dari karakteristik dan features yang tidak
diketahui sebelumnya oleh pelanggan, sehingga apabila karakteristik ini ada pada
produk itu maka pelanggan akan sangat senang. Kinerja pada tingkat ini dapat
mencakup semua kebutuhan eksplisit dan yang tersembunyi. Kebutuhan ini tidak jelas
dan tidak diketahui pelanggan, tetapi pelanggan akan merasakan manfaatnya apabila
ada.

Pemahaman terhadap ekspektasi adalah prasyarat untuk peningkatan kualitas dan


mencapai kepuasan total pelanggan.mekanisme untuk memahami ekspektasi pelanggan dapat
menggunakan suatu kerangka kerja berdimensi dua, dimana dimensi pertama
mengklasifikasikan pendekatan yang dilakukan oleh pemasok (supplier) bergerak dari mode
reaktif ke proaktif, sedangkan dimensi kedua mengindikasikan tingkat pemahaman yang
mungkin dicapai oleh setiap mekanisme. Untuk memahami ekspektasi pelanggan dapat
dibagi kedalam tiga tingkat, yaitu ;

Pemahaman tingkat (level) 1 Menampung Keluhan


Merupakan tingkat pemahaman terendah dari pemasok terhadap ekspektasi
pelanggan yang dicirikan oleh mode reaktif. Pendekatan ini terutama ditujukan hanya
menampung keluhan dari pelanggan, kemudian baru dicari langkah penyelesaiannya.

Pemahaman tingkat (level) 2 Survei Tidak Terstruktur, Analisis data Penjualan,


Umpan Balik dari pelanggan.
Merupakan pemahaman terhadap ekspektasi pelanggan pada tingkat yang
lebih tinggi, dicirikan melalui pendekatan aktif dari pemasok untuk mendengarkan
pelanggan. Mekanisme ini didefinisikan sebagai pendekatan yang
mengkomunikasikan dengan pelanggan, tetapi masih memandang ekspektasi
pelanggan sebagai tujuan kedua, bukan sasaran utama yang ingin dipahami. Tujuan
utama dari pemasok dalam pendekatan ini sering hanya utnuk menjawab pertanyaan-
pertanyaan pelanggan atau menjual lebih banyak produk atau memperkenalkan
produk baru.

13
Pemahaman tingkat (level) 3 wawancara pribadi,kelompok focus, survey terstruktur.
Merupakan pemahaman terhadap ekspektasi pelanggan pada tingkat yang
paling tinggi, dicirikan melalu pendekatan proaktif dari pemasok untuk mendengarkan
ekspektasi pelanggan. Pendekatan ini mencakup wawancara pribadi dengan
pelanggan, kelompok fokus, dan melaksanakan survei yang didesain khusus untuk
menjaring informasi dari pelanggan. Mekanisme lain pada tingkat tertinggi ini adala
mystery shopper, dimana pihak pemasok menempatkan diri mereka sebagai
pelanggan yang akan menggunakan produk yang dihasilkan itu. Benchmarking dapat
dikategorikan sebagai pendekatan level 3, dimana benchmarking merupakan seuatu
pendekatan proaktif yang memungkinkan pihak manajemen perusahaan memahami
bisnis yang dilakukan, pasar yang dilayani, serta dapat memotivasi manajemen
memfokuskan perhatian pada usaha-usaha perbaikan terus-menerus dan
mengimplementasikan manajemen perubahan. Benchmarking menjadi alat
manajemen yang mendasar yang dapat membimbing pihak manajemen perusahaan
untuk melihat keluar perusahaan, dan juga dapat meningkatkan kinerja perusahaan
untuk menjadi lebih unggul dari perusahaan pesaing yang unggul itu.

Terdapat empat jenis bencmarking, antara lain ;


1. Internal benchmarking, merupakan investigasi benchmarking yang paling
mudah melalui membandingkan operasi-operasi di antra fungsi-fungsi dalam
organisasi itu sendiri. Internal benchmarking dapat dikatakan sebagai suatu paket
upayah perbaikan terus-menerus untuk mengidentifikasi praktek bisnis terbaik
yang ada didalam lingkungan perusahan sendiri. Dengan melakukan internal
enchmarking dapat diperoleh informasi yang lebih jelas, kritis, dan obyektif,
tentang adanya kesenjangan kinerja antar-unit bisnis atau bagian didalam
perusahaan, serta penyebab terjadi kesenjangan kinerja itu. Melalui implementasi
internal benchmarking akan mendorong semakin berkembangnya komunikasi
internal dan pemecahan masalah secara bersama diantra unit bisnis atau bagian
yang ada di dalam organisasi itu.
2. Competitive benchmarking, berfungsi untuk memposisikan produk dari
perusahaan terhadap produk dari pesaing. Competitive benchmarking diterapkan
untuk menciptakan atau meningkatkan daya saing serta mampu memperbaiki
posisi produk dalam pasar yang kompetitif. Melalui competitive benchmarking
14
akan diperoleh informasi tentang kinerja terbaik dari pesaing, dimana infomasi
tentang kinerja terbaik dari pesaing, dimana informasi ini dapat dipergunakan oleh
perusahaan untuk menciptakan produk yang lebih baik dari yang baik itu. Dalam
competitive bechmarking, target pembanding berada diluar perusahaan dan juga
bersifat fleksibel, tergantung pada tujuan. Implementasi competitive
benchmarking relatif lebih sulit dibndingkan internal benchmarking, karena
informasi yang diperlukan berada diluar perusahaan. Competitive benchmarking
sering juga disebut sebagi external benchmarking.
3. Functional benchmarking, merupakan jenis benchmarking yang tidak harus
membatasi pada pembandingan terhadap pesaing langsung.functional
benchmarking dapat melalkukan investigasi pada perusahaan-perusahaan yang
unggul dalam industri yang tidak sejenis. Functional benchmarking perlu
dipertaankan melalui mendefinisikan karakteristik kinerja yang harus serupa
dengan fungsi-fungsi dari perusahaan. Dalam functional benchmarking nilai target
pembanding dapat berasl dari perusahaan tidak sejenis yang unggul. Implementasi
functional benchmarking lebih sulit dilakukan karena informasi yang diperlukan
pada umumnya lebih sulit diperoleh serta benchmark targes memerlukan
imajinasi dan kreativitas yang tinggi.
4. Generic benchmarking, yaitu jenis benchmarking dimana beberapa fungsi bisnis
dan proses adalah sama tanpa mempedulikan ketidak serupaan atau ketidak
sejenisan diantara industri lainya. Generic benchmarking membutuhkan
konseptualisasi yang komprehensif, serta merupakan jenis benchmarking yang
paling sulit.

Walaupun benchmarking sering disederhanakan dengan istilah menjiplak atau meniru,


tetapi proses implementasi ternyata tidak mudah, membutuhkan pendekatan yang
komprehensif dari manajemen perusaaan secara keseluruhan.

Penyebaran Fungsi Kualitas (QDF)

QFD (Quality Function Deployment ) merupakan salah satuteknik yang digunakan


untuk menterjemah kebutuhan konsumen kedalam karakteristik produk serta
mempertimbangkan kemampuan perusahaan untuk memenuhinya.penyebaran fungsi kualitas
QDF memudahkan terjemahan memprioritaskan satuan persyaratan pelanggan subyektif ke

15
satu set systemlevel persyaratan selama sistem desain konseptual. QFD adalah metode yang
digunakan untuk mengembangkan suatu produk yang kompleks dengan menghubungkan
unsur perencanaan daridesain dan proses pembuatan berdasarkan kebutuhan pelanggan.
Tujuannya adalah untuk mendapatkan kepuasan pelanggan. Metode QFD di pakai oleh
perusahaan manufaktur dan perusahaan jasa. Selain itu kualitas fungsi penyebaran (QFD)
adalah metode membantu mentransformasi kebutuhan pelanggan (dengan suara pelanggan)
kekarakteristik teknik dalam bentuk produk atau layanan. Sedangkan menurut buku total
quality management, QFD dapat diartikan sebagai alat perencanaan yang digunakan untuk
memenuhi kepuasan pelanggan. Hal ini termasuk dengan desain produk, keteknikan dan
produksi produk.

QFD dapat memberikan beberapa keuntungan jangka pendek seperti mengurangi


hambatan lintas-fungsional yang terkait dengan tim pengembangan produk dan membantu
perubahan budaya perusahaan. Dalam jangka panjang, QFD telah terbukti manfaat-manfaat
nyata seperti lebih mengurangi waktu siklus, mengurangi biaya pembangunan, dan
produktivitas meningkat. Manfaat terpenting dari QFD adalah efektivitas dalam menangkap,
memprioritaskan dan menstabilkan kebutuhan pelanggan.

Menurut Lou Cohen, manfaat utama yang diperoleh dari penerapan QFD yaitu:

1. Terciptanya rangcangan produk dan jasa berbasis kepuasan pelanggan, karena


keinginan pelanggan diketahui.
2. Akan lebih mudah dalam merancang produk yang fokus pada pelanggan
3. Membandingkan produk/jasa terhadap pesaing untuk saling memenuhi kebutuhan
pelanggan.
4. Lebih fokus dalam mendesain produk untuk memuaskan pelanggan sehingga waktu
pemasaran cepat.
5. Membantu dalam merencanakan desain terbaru untuk di masa depan, biaya tidak
terlalu tinggi.
6. Mendorong terciptanya kerja sama antara departemen
7. Data terkumpul dengan baik dalam membantu mengambil keputusan.

Tahapan QFD

Tahap perencanaan dan pengembangan fase model QFD dapat disebut juga matriks,
adapun matriks perencanaan dan pengembangan QFD adalah sebagai berikut:

16
1. Matriks perencanaan produk (house of quality) .
Menjelaskan tentang customer needs, technical requirements, co-relationship,
relationship, customer competitive evaluation, competitive technical assement, dan
targets. HOQ terdiri dari tujuh bagian utama tersebut.
2. Matriks perencanaan part (part of deployment) .
Merupakan faktor-faktor teknis yang critical terhadap pengembangan produk.
3. Matriks perencanaan proses (process planning)
Merupakan matriks proses pembuatan pengembangan suatu produk
4. Matriks perencanaan produksi (production plannning)
Memaparkan tindakan yang perlu diambil didalam perbaikan kualitas produk.

Mengukur Kepuasan dan kesetiaan Pelanggan

Kepuasan Pelanggan menurut Kotler, seorang ahli pemasaran adalah tingkat perasaan
seseorang setelah membandingkan kinerja atau hasil yang ia rasakan dibandingkan dengan
harapannya.Dapat dikatakan bahwa kepuasan pelanggan adalah suatu keadaan dimana
keinginan, harapan dan kebutuhan pelanggan dapat dipenuhi.
Perkembangan dunia bisnis yang semakin pesat membuat semakin beraneka
ragamnya barang dan jasa yang ditawarkan oleh pasar dan ini memberikan peluang bagi
masyarakat untuk membeli produk dan jasa yang sesuai dengan keinginannya. Tingkat
persaingan dalam bisnis semakin tinggi, sehingga para pelaku bisnis tidak lagi bisa hanya
menjual produk tanpa ada planning dan strategi. Pelaku bisnis harus mampu merebut hati
konsumen supaya bisnis mereka dapat berjalan terus bahkan memberikan keuntungan yang
diharapkan. Merebut hati konsumen dengan memberikan pelayanan yang mampu
memuaskan hati konsumen menjadi hal yang penting bagi suatu bisnis.

Kotler (1996) mengidentifikasi 4 metode untuk mengukur kepuasan pelanggan, yakni :


A. Sistem Keluhan dan Saran.
Setiap organisasi yang berorientasi kepada pelanggan (customer oriented) perlu
memberikan kesempatan yang luas kepada para pelanggannya untuk menyampaikan saran,
pendapat dan keluhan mereka. Media yang digunakan dapat berupa kotak saran yang
diletakan di tempat-tempat strategis, kartu komentar, saluran telepon khusus bebas pulsa dan
sebagainya. Informasi-informasi yang diperoleh melalui metode ini dapat memberikan ide-

17
ide baru dan masukan yang berharga kepada perusahaan, sehingga memungkinkannya untuk
bereaksi dengan tanggap dan cepat untuk mengatasi masalah-masalah yang timbul.
B. Ghost Shopping.
Salah satu cara untuk memperoleh gambaran mengenai kepuasan pelanggan adalah
dengan cara mempekerjakan beberapa orang (ghost shopper) untuk berperan atau bersikap
sebagai pelanggan atau pembeli potensial produk perusahaan dan pesaing. Kemudian mereka
memberikan laporan mengenai hasil kekuatan dan kelemahan produk perusahaan dan pesaing
berdasarkan pengalaman mereka dalam pembelian produk-produk tersebut.
C. Lost Customer Analysis.
Perusahaan ada baiknya menghubungi para pelanggan yang telah berhenti membeli
atau yang telah pindah pemasok agar dapat memahami mengapa hal itu terjadi, dan juga agar
dapat mengambil kebijakan perbaikan atau penyempurnaan selanjutnya. Bukan hanya
exitinterview saja yang diperlukan, melainkan customer loss rate juga penting, dimana
peningkatan customer loss rate menunjukan kegagalan perusahaan dalam memuaskan
pelanggannya.
D. Survey Kepuasan Pelanggan.
Banyak penelitian mengenai kepuasan pelanggan yang dilakukan dengan cara
penelitian survey dengan berbagai macam media. Melalui survey perusahaan akan
memperoleh tanggapan dan umpan balik (feed back) secara langsung dari para pelanggan dan
juga memberikan tanda positif bahwa perusahaan memberikan perhatian terhadap
parapelanggannya.

18
BAB III
ALAT DAN METODE PENGUKURAN KUALITAS, SERTA IDENTIFIKASI
MASALAH KUALITAS

Pengenalan data dan variabilitas

Salah saatu elemen penting dari manajemen kualitas terpadu (Total Quality Management)
adalah membuat keputusan berdasarkan data (fakta) bukan opini. Data diperoleh melalui
pengukuran kinerja kualitas.

Pengukuran kinerja kualitas yang dilakukanoleh produsen akan sangat bermanfaat


sebagai langkah positif dalam memacu kinerja bisnis itu sendiri. Pengukuran kualitas paling
sedikit akan memberikan duamanfaat untuk pembuatan keputusan, yaitu informasi tentang
status kinerja bisnis saat sekarang, dan identifikasi untuk pervaikan kinerja bisnis itu.
Secara konseptual pengukuran kinerja dari perusahaan kelas dunia berfokus pasar dan
pelanggan. Secara sederhana sistem pengukuran kinerja terdiri dari dua elemen fungsional,
yaitu elemen komunikasi yang menghubungkan kebutuhan pelanggan dengan proses bisnin
dan umpan balik yang menghubungkan persepsi pelanggan tentanng kepuasan yang diterima
dari produk dan pelayanan yang diberikan oleh proses bisnis dengan pemilik proses (orang
yang bertanggung jawab dalam menendalikan dan meningkatkan kinerja proses).

Kebutuhan spesifik pelanggan dapat diterjemahkan secara tepat ke dalam karakteristik


kinerja yang ditetapkan oleh manajemen organissasi, selanjutnya karakteristik kinerja itu
diuni atau diperbandingkan terhadap karakteristik proses, untuk mengetahui apakah
karakteristik proses yang ada mampu memenuhi standar-standar karakteristik kinerja yang
telah ditetapkan itu. Pemahaman secara konseptual terhadap sistem metric dalam pengukuran
kinerja sangat memainkan peranan penting untuk melaksanakan proyek peningkatan kinerja
kualitas.

Pengukuran proses-proses kerja menggunakan sistem metric merupakan satu-satunya cara


untuk meningkatkan kualitas, kepuasan pelanggan, keuntungan dan pertumbuhan perusahaan
sepanjang wakut. Peningkatan-peningkatan kinerja tidak dapat dilakukan tanpa data.Produk
dan pelayanan yang diberikan harus dapar diterjemahkan ke dalam bentuk data kinerja.

19
Melalui data kinerja yang diringkaskan dan dilaporkan secara mudah, akan menciptakan
pemahaman terhadap kegagalan dan mengapa terjadi kegagalan itu.
Pengukuran yang dilakukan terhadap performansi kualitas saja tidak cukup, tetapi perlu
juga menganalisis bagaimana keadaan dalam suatu proses berdasarkan dari hasil pengukuran
kualitas itu. Dalam konteks pengendalian proses statistikal, penting juga untuk mengetahui
bagaimana suatu proses itu bervariasi dalam menghasilkan output sehingga dapat diambil
tindakan-tindakan perbaikan terhadap proses itu secara tepat.

Selain mengacu kepada data yang harus diperoleh dalam melakukan pengukuran kualitas,
juga harus memperhatikan variabilitas data yang ada. Variabilitas adalah ketidakseragaman
dalam sistem produksi atau operasional sehingga menimbulkan perbedaan dalam kualitas
pada output (barang dan/atau jasa) yang dihasilkan. {Pada dasarnya dikenal dua sumber atau
penyebab timbulnya variabilitas, yang diklasifikasikan sebagai berikut :

1. Variabilitas penyebab khusus (Special-causes variation) adalah kejadian-


kejadian diluar sistem yang mempengaruhi variasi dalam sistem. Penyebab khusus
dapat bersumber dari faktor-faktor : manusia, peralatan, material, lingkungan,
metode kerja, dll. Penyebab khusus ini mengambil pola-pola nonacak (non
random paterns) sehingga dapat diidentifikasi/ditemukan, sebab mereka tidak
selalu aktif dalam proses tetapi memiliki pengaruh yang lebih kuat pada proses
sehingga menimbulkan variasi. Dalam konteks pengendalian proses statistikal
menggunakan peta-peta kendali atau kontrol (control charts), jenis variasi ini
sering ditandai dengan titik-titik pengamatan yang melewati atau keluar dari
batas-batas pengendalian yang didefinisikan (defined control limits).

2. Variabilitas penyebab umum (Common-causes Variation) adalah faktor-faktor di


dalam sistem atau yang melekat pada proses yang menyebabkan timbulnya variasi
dalam sistem serta hasil-hasilnya. Penyebab umum sering disebut juga sebagai
penyebab acak (random causes) atau penyebab sistem (system causes). Karena
penyebab umum ini selalu melekat pada sistem, untuk menghilangkan kita harus
menelusuri elemen-elemen dalam sistem itu dan hanya pihak manajemen yang
dapat memperbaikinya, karena pihak manajemenlah yang mengendalikan sistem
itu. Dalam konteks pengendalian proses statistikal dengan menggunakan peta-peta
kendali atau kontrol (control charts), jenis variasi ini sering ditandai dengan titik-
titik pengamatan yang berada dalam batas-batas pengendalian yang didefinisikan
(defined control limits).

20
Suatu proses yang hanya mempunyai variabilitas penyebab umum (common-causes
variation) yang mempengaruhi output atau outcomes merupakan proses yang stabil karena
penyebab sistem yang mempengaruhi variasi biasanya relatif stabil sepanjang waktu. Variasi
penyebab-umum dapat diperkirakan dalam batas-batas pengendalian yang ditetapkan secara
statistikal. Sedangkan apabila variasi penyebab-khusus terjadi dalam proses, maka akan
menyebabkan proses itu menjadi tidak stabil. Upaya-upaya menghilangkan variasi penyebab-
khusus akan membawa proses ke dalam pengendalian statistikal.

Pemahaman dan pengendalian variasi merupakan inti dari teori Deming. Dr. W.
EdwardsDeming menyatakan bahwa sasaran dan sasaran dari pengendalian kualitas adalah
mengurangi variasi sebanyak mungkin. Pendekatannya adalah menstandarisasikan proses
dengan cara bahwa setiap orang menggunakan prisedur kerja, material, dan peralatan yang
sama. Di samping itu pihak manajemen industri harus mempelajari proses, mencari sumber-
sumber potensial dari variasi, mengumpulkan variasi, mengumpulkan data, dan kemudian
menghilangkan variasi penyebab khusus. Sedangkan variasi penyebab umum merupakan
tiondakan konkret berikut sebagai bkti komitmen dari manajemen industri untuk perbaikan
proses terus menerus (continounsimprovement) setelah variasi penyebab-khusus dihilangkan
dari proses itu.

2. Alat Untuk data Numerik dan Verbal

Terdapat beberapa alat yang sering digunakan dalam memperbaiki kondisi perusahaan
untuk dapat meningkatkan mutu produk atau jasa yang dihasilkan. Teknik dan alat tersebut
terbagi dalam 2 jenis, jenis pertama menggunakan data verbal, sedangkan jenis yang kedua
menggunakan data numerik. Beberapa alat perbaikan mutu yang menggunakan data verbal,
adalah sebagai berikut:
Flowchart adalah gambaran skematik atau diagram yang menunjukkan seluruh
langkah dalam suatu proses dan menunjukkan bagaimana langkah tersebut saling
berinteraksi satu sama lain. Tujuan penggunaan flowchart adalah sebagai berikut:
1) Memberikan pengertian dan petunjuk tentang jalannya proses.
2) Membandingkan proses sesungguhnya dengan proses yang ideal.
3) Mengetahui langkah-langkah yang duplikatif dan langkah-langkah yang tidak
perlu.

21
4) Mengetahui dimana pengukuran dapat dilakukan.
5) Menggambarkan sistem secara keseluruhan.
Brainstorming adalah cara untuk memacu pemikiran kreatif guna mengumpulkan ide-
ide dari suatu kelompok dalam waktu yang relatif singkat. Ide dalam brainstorming
dapat digunakan untuk analisis selanjutnya. Alat yang sering membantu analisis
tersebut antara lain cause and effect diagram, affinity diagram, dan tree diagram.
Cause and effect diagram digunakan untuk menganalisis persoalan dan faktor-faktor
yang menimbulkan persoalan tersebut. Diagram tersebut dapat digunakan untuk
menjelaskan sebab-sebab suatu persoalan. Cause and effect diagram ini
dikembangkan oleh Dr. Kaoru Ishikawa yang juga disebut sebagai Ishikawa Diagram.
Diagram tersebut juga disebut Fishbone Diagram karena berbentuk seperti kerangka
ikan.
Affinity diagram dikembangkan oleh Jiro Kawakita pada tahun 1950-an dan sering
menggunakan hasil brainstorming untuk mengorganisasikan informasi sehingga
mudah dipahami untuk mengadakan perbaikan proses. Affinity diagram ini sangat
berguna untuk menyaring data yang berjumlah besar dan menciptakan pola pikir
baru.

Terdapat enam macam alat yang menggunakan data numerik, diantaranya adalah
lembar pengamatan (check sheet), diagram pareto (pareto chart), Histogram, diagram sebaran
(Scatter diagram), run chart, dan peta kontrol (control chart).
Check sheet adalah alat yang sering digunakan untuk menghitung seberapa sering
sesuatu itu terjadi dan sering digunakan dalam pengumpulan dan pencatatan data.
Data yang sudah terkumpul tersebut kemudian dimasukkan ke dalam grafik seperti
pareto chart ataupun histogram untuk kemudian dilakukan analisis terhadap hasil
tersebut.
Pareto chart merupakan diagram yang dikembangkan oleh seorang ahli yang
bernama Vilfredo Pareto. Pareto chart adalah alat yang digunakan untuk
membandingkan berbagai kategori kejadian yang disusun menurut ukurannya untuk
menentukan prioritas kategori kejadian-kejadian atau sebab-sebab kejadian yang
akan dianalisa, sehingga dapat memusatkan perhatian pada sebab-sebab yang
mempunyai dampak terbesar terhadap kejadian tersebut.

22
Histogram adalah alat yang digunakan untuk menunjukkan variasi data pengukuran
dan variasi setiap proses. Berbeda dengan pareto chart yang penyusunannya menurut
urutan yang memiliki proporsi terbesar hingga proporsi terkecil, histogram ini
penyusunannya tidak menggunakan urutan apapun.
Scatter diagram adalah gambaran yang menunjukkan kemungkinan hubungan
(korelasi) antara pasangan dua variabel tersebut yang sering diwujudkan sebagai
koefisien korelasi. Diagram ini juga dapat digunakan untuk mencek apakah suatu
variabel dapat digunakan untuk mengganti variabel yang lain.
Run chart adalah grafik yang menunjukkan variasi ukuran sepanjang waktu,
kecenderungan, daur, dan pola-pola lain dalam suatu proses, misalnya perubahan
dalam proses dan membandingkan performansi beberapa kelompok, tetapi tanpa
menyebutkan sebab-sebab terjadinya kecenderungan, daur, atau pola-pola tersebut.
Control chart adalah grafik yang menyerupai run chart yang digunakan untuk
menentukan apakah suatu proses berada dalam in control atau out of control. Control
limit yang meliputi batas atas (upper control limit) dan batas bawah (lower control
limit) dapat membantu untuk menggambarkan performansi yang diharapkan dari
suatu proses, yang menunjukkan bahwa proses tersebut konsisten (Dorothea, 1999).

Persyaratan Kondisional pengukuran Kualitas

Salah satu elemen penting dari manajemen kualitas terpadu (Total Quality
Management = TQM) adalah membuat keputusan berdasarkan pada opini. Data diperoleh
melalui pengukuran performa kualitas. Pengukuran performa kualitas yang dilakukan oleh
produsen akan sangat bermanfaat sebagai langkah positif guna memacu performansi bisnis
itu sendiri. Pengukuran kualitas paling sedikit akan memberikan dua manfaat untuk
pembuatan keputusan, yaitu: Informasi tentang status performansi bisnis saat sekarang, dan
Identifikasi untuk perbaikan performansi bisnis itu.
Karena hasil dari pengukuran kualitas akan menjadi landasan dalam membuat
kebijakan perbaikan kualitas secara keseluruhan dalam proses bisnis, maka kondisi yang
diperlukan untuk mendukung pengukuran kualitas yang sahih (valid) antara lain adalah:
1. Pengukuran harus dimulai pada permulaan program. Berbagai masalah yang
berkaitan dengan kualitas serta peluang untuk memperbaikinya harus dirumuskan
secara jelas.

23
2. Pengukuran kualitas dilakukan pada sistem itu. Fokus dari pengukuran kualitas
terletak pada sistem secara keseluruhan. Pengukuran tidak hanya diletakan pada
proses akhir saja yang biasanya telah menghasilkan produk, tetapi harus dimulai dari
perencanaan awal pembuatan produk, selama proses berlangsung, proses akhir yang
menghasilkan output, bahkan sampai pada penggunaan produk itu oleh pelanggan.
Dengan demikian pengukuran kualitas seyogjanya dimulai sejak adanya gagasan
untuk membuat produk sampai masa berakhir penggunaan produk itu.
3. Pengukuran kualitas seharusnya melibatkan semua individu yang terlibat
dalamproses itu. Dengan demikian pengukuran kualitas bersifat partisipatif. Orang-
orang yang bekerja dalam proses harus memahami secara baik akan nilai pengukuran
kualitas dan bagaimana memperoleh nilai itu. Setiap orang harus dilibatkan sehingga
memberi hasil yang terbaik. Dengan demikian tanggung jawab pengukuran kualitas
berada pada semua orang yang terlibat dalam proses itu. Pelaksanaan pengukuran
kualitas boleh saja dilakukan oleh Departemen Kualitas atau suatu tim yang dibentuk
untuk maksud itu, tetapi pada dasarnya mereka hanya merupakan koordinator saja.
Karena pengukuran kualitas berorientasi pada proses kerja, seyogjanya
tanggungjawab dari pengukuran kualitas berada pada setiap individu yang terlibat
dalam proses kerja pada sistem itu.
4. Pengukuran seharusnya dapat memunculkan data, dimana nantinya data itu dapat
ditunjukkan atau ditampilkan dalam bentuk peta, diagram, tabel, hasil perhitungan
statistik, dan lain-lain. Data seharusnya dipresentasikan dalam cara yang termudah.
5. Pengukuran kualitas yang menghasilkan informasi-informasi utrama
seharusnyadicatat tanpa distorsi, yang berarti harus akurat.
6. Perlu adanya komitmen secara menyeluruh untuk pengukuran performansikualitas
dan perbaikannya. Kondisi ini sangat penting sebelum aktivitas pengukuran kualitas
mulai dilaksanakan.
7. Program-program pengukuran dan perbaikan kualitas seharusnya dapat dipecah-
pecah atau diuraikan dalam batas-batas yang jelas sehingga tidak tumpang tindih
dengan program yang lain.

Pengukuran kualitas dapat dilakukan pada tiga tingkat, yaitu: pada tingkat proses
(process level), tingkat output (output level), dan tingkat outcome (outcome level).

24
Pengukuran pada tingkat proses mengukur setiap langkah atau aktivitas dalam proses
dan karakteristik input yang diserahkan oleh pemasok (supplier) yang mengendalikan
karakteristik output yang diinginkan. Tujuan dari pengukuran pada tingkat ini adalah
mengindentifikasikan perilaku yang mengatur setiap langkah dalam proses, dan
menggunakan ukuran-ukuran ini untuk mengendalikan operasi serta memperkirakan output
yang akan dihasilkan sebelum output itu diproduksi atau diserahkan ke pelanggan. Beberapa
contoh ukuran pada tingkat proses yang menggambarkan kualitas adalah: lama waktu
menjawab panggilan telepon, banyaknya panggilan telepon yang tidak dikembalikan ke
pelanggan, konformasi terhadap waktu penyerahan yang dijanjikan, presentase material cacat
yang diterima dari pemasok, siklus waktu produk (product cycle times), banyaknya inventori
barang setengah jadi (work-in-process inventory), dan lain-lain.
Pengukuran pada tingkat output mengukur karakteristik output yang dihasilkan
dibandingkan dengan spesifikasi karakteristik yang diinginkan pelanggan. Beberapa contoh
ukuran pada tingkat output adalah banyaknya unit output yang tidak memenuhi spesifikasi
tertentu yang ditetapkan (banyak produk cacat), tingkat efektivitas dan efisiensi produksi,
kualitas dari produk yang dihasilkan, dan lain-lain.
Pengukuran pada tingkat outcome mengukur bagaimana baiknya suatu produk
memenuhi kebutuhan dan ekspektasi pelanggan, jadi mengukur tingkat kepuasan pelanggan
dalam mengkonsumsi produk yang diserahkan. Pengukuran pada tingkat outcome merupakan
tingkat tertinggi dalam pengukuran kualitas. Beberapa contoh ukuran pada tingkat outcome
adalah: banyaknya keluhan pelanggan yang diterima, banyaknya produk yang dikembalikan
oleh pelanggan, tingkat ketepatan waktu penyerahan produk sesuai dengan waktu yang
dijanjikan, dan lain-lain.

Pengukuran Performansi Kualitas

Pada dasarnya suatu pengukuran performansi kualitas dapat dilakukan pada tiga
tingkat, yaitu : pada tingkat proses (proses level), tingkat output (output level), dan tingkat
outcome (outcomelevel). Pengendalian proses statistikal (Statistical Process Control =
SPC) dapat diterapkan pada ketiga tingkat pengukuran performasi kualitas itu. Ketiga
tingkat pengukuran performansi kualitas tersebut adalah :

a. Pengukuran pada tingkat proses, yang mengukur setiap langkah atau aktivitas dalam
proses dan karakteristik input yang diserahkan oleh pemasok (supllier) yang

25
mengendalikan karakteristik output yang diinginkan. Tujuan dari pengukuran pada
tingkat ini adalah mengidentifikasi perilaku yang mengatur setiap langkah dalam proses,
dan menggunakan ukuran-ukuran ini untuk mengendalikan operasi serta memperkirakan
output yang akan dihasilkan sebelum output itu diproduksi atau diserahkan ke pelanggan.
Beberapa contoh ukuran pada tingkat proses yang menggambarkan performansi kualitas
adalah : lama waktu menjawab panggilan telepon, banyaknya panggilan telepon yang
tidak dikembalikan ke pelanggan, konfirmasi terhadap waktu penyerahan yang dijanjikan,
persentasematerial cacat yang diterima dari pemasok, siklus waktu produk (product cycle
times), banyaknya inventori barang setengah jadi (work-in-processinventory), dan lain-
lain.

b. Pengukuran pada tingkat output, yangmengukur karakteristik output yang dihasilkan


dibandingkan terhadap spesifikasi karakteristikyang diinginkan pelanggan. Beberapa
contoh ukuran pada tingkat output adalah banyaknya unit produk yang tidak memenuhi
spesifikasi tertentu yang ditetapkan (banyaknya produk cacat), tingkat efektivitas dan
efisiensi produksi, karakteristik kualitas dari produk yang dihasilkan, dan lain-lain.

c. Pengukuran pada tingkat outcome, yang mengukur bagaimana baiknya suatu produk
yang memenuhi kebutuhan dan ekspektasi pelanggan, jadi mengukur tingkat kepuasan
pelanggan dalam mengkonsumsi produk yang diserahkan. Pengukuran pada tingkat
outcome merupakan tingkat tertinggi dalam performansi kualitas. Beberapa contoh
ukuran pada tingkat tertinggi dalam pengukuran performansi kualitas. Beberapa contoh
ukuran pada tingkat outcome adalah : banyaknya keluhan pelanggan yang diterima,
banyaknya produk yang dikenbalikan oleh pelangan, tingkat ketepatan waktu sesuai
dengan waktu yang dijanjikan, dan lain-lain.

Aspek-Aspek Yang Perlu Diukur Dalam Pengukuran Kualitas

Dalam melaksanakan pengukuran performansi kualitas, pada dasarnya harus


memperhatikan aspek internal dan aspek eksternal dari suatu organisasi. Dalam organisasi
bisnis, aspek internal dapat berupa tingkat kecacatan produk, biaya-biaya karena kualitas
jelek (non-quality costs) seperti pekerjaan ulang, cacat dan lain-lain, sedangkan aspek
eksternal dapat berupa kepuasan pelanggan, pangsa pasar (market share), dan lain-lain. Pada
perusahaan yang telah maju biasanya melaksanakan program riset kepuasan pelanggan, di

26
mana hasil-hasil dari riset itu akan dipergunakan untuk mendukung manajemen puncak
dalam mengambil keputusan-keputusan strategis guna menyamakan tujuan dari perusahaan
itu dengan keinginan pelanggan.

Contoh yang baik mengenai keterlibatan manajemen puncak dalam riset kepuasan
pelanggan adalah Total Quality Fitness Review (TQFR) yang dilakukan oleh Westinghouse
Electric Corp. Metode TQFR melibatkan seluruh karyawan internal dalam proses wawancara
yang mengukur dari setiap divisi untuk dibandingkan terhadap performansi kualitas total dari
perusahaan. Komitmen manajemen terhadap proyek riset kepuasan pelanggan oleh
Westinghouse Electric Corp. ditandai dengan gugus tugas yang mengatur kelangsungan
proyek. Gugus tugas itu terdiri dari anggota-anggota manajemen senior. Riset kepuasan
pelanggan sebagai suatu alat untuk menjaring informasi tentang keinginan pelanggan, harus
dirancang mengikuti beberapa aspek berikut:
Riset harus berfokus pada harapan pelanggan yang berkaitan dengan kualitas dan
jenis produk yang diinginkan serta persepsi pelanggan tentang apa yang pelanggan
yakini akan diperolehnya kalau mereka mengkonsumsi produk itu, bukan pada
persepsi produsen (perusahaan) terhadap apa yang sedang ditawarkannya.
Riset harus berfokus pada kualitas dari produk, bukan pada kesalahan-kesalahan
individual atau perusahaan.
Seluruh karyawan harus dilibatkan dalam mengembangkan ukuran-ukuran kepuasan
pelanggan sehingga ukuran-ukuran itu akan menjadi lebih relevan dengan pekerjaan
mereka sehari-hari.
Data kualitatif dan kuantitatif harus dikumpulkan.
Pertanyaan-pertanyaan dalam survai atau wawancara harus spesifik serta bersifat
mudah untuk mengumpulkan dan mencatat data itu.
Instrumen riset harus dirancang sedemikian rupa sehingga manajemen dan/atau
karyawan dapat mengambil tindakan berdasarkan hasil dari riset itu.
Penghargaan atau sistem insentif terhadap perubahan positif yang didasarkan pada
hasil-hasil dari survai harus konkrit dan cukup berharga atau bernilai.

Pengukuran yang dilakukan seharusnya mempertimbangkan setiap aspek dari proses


operasional yang mempengaruhi persepsi pelanggan tentang nilai kualitas. Melalui suatu
survai pendahuluan yang bersifat eksploratif, dapat diidentifikasi semua atribut produk yang

27
menentukan kepuasan pelanggan dan persepsi pelanggan tentang nilai kualitas dari produk
itu. Atribut-atribut ini kemudian merupakan basis dari instrumen riset. Atribut-atribut yang
sesuai dalam pengukuran akan berbeda untuk setiap perusahaan, tetapi pada umumnya atribut
yang dipertimbangkan dalam pengukuran kualitas adalah sebagai berikut:

1. Kualitas produk, yang mencakup:


a. Performansi (performance), berkaitan dengan aspek fungsional dari produk itu.
b. Features, berkaitan dengan pilihan-pilihan dan pengembangannya.
c. Keandalan (reliability), berkaitan dengan tingkat kegagalan dalam penggunaan
produk itu.
d. Serviceability, berkaitan dengan kemudahan dan ongkos perbaikan.
e. Konformansi (conformance), berkaitan dengan tingkat kesesuaian produk
terhadap spesifikasi yang telah ditetapkan sebelumnya berdasarkan keinginan
pelanggan.
f. Durability, berkaitan dengan daya tahan atau masa pakai dari produk itu.
g. Estetika (aesthetics), berkaitan dengan desain dan pembungkusan dari produk itu.
h. Kualitas yang dirasakan (perceived quality) bersifat subjektif, berkaitan dengan
perasaan pelanggan dalam mengkonsumsi produk itu seperti: meningkatkan harga
diri, moral, dan lain-lain.

2. Dukungan purna-jual terutama yang berkaitan dengan waktu penyerahan dan bantuan
yang diberikan, mencakup beberapa hal berikut:
a. Kecepatan penyerahan, berkaitan dengan lamanya waktu antara waktu pelanggan
memesan produk dan waktu penyerahan produk itu.
b. Konsistensi, berkaitan dengan kemampuan memenuhi jadwal yang dijanjikan.
c. Tingkat pemenuhan pesanan, berkaitan dengan kelengkapan dari pesanan-pesanan
yang dikirim.
d. Informasi, berkaitan dengan status pesanan.
e. Tanggapan dalam keadaan darurat, berkaitan dengan kemampuan menangani
permintaan-permintaan non standar yang bersifat tiba-tiba.
f. Kebijakan pengembalian, berkaitan dengan prosedur menangani barang-barang rusak
yang dikembalikan pelanggan.

3. Interaksi antara karyawan (pekerja) dan pelanggan, mencakup:

28
a. Ketepatan waktu, berkaitan dengan kecepatan memberikan tanggapan terhadap
keperluan-keperluan pelanggan.
b. Penampilan karyawan, berkaitan dengan kebersihan dan kecocokan dalam
berpakaian.
c. Kesopanan dan tanggapan terhadap keluhan-keluhan, berkaiatan dengan bantuan
yang diberikan dalam menyelesaikan masalah-masalah yang diajukan pelanggan.

Di samping berbagai atribut utama di atas, setiap organisasi bisnis seharusnya


mengevaluasi elemen-elemen kunci dari operasi yang mempengaruhi kepuasan pelanggan.
Sebagai contoh, Uniroyals Rubber Division dalam membuat ranking terhadap pemasoknya
(suppliers) berdasarkan pada: 40% aspek kualitas, 25% aspek harga, 20% aspek ketepatan
waktu penyerahan, dan 15% aspek pelayanan (Schonberger, 1986). Sebagai contoh terlampir
dikemukakan daftar pertanyaan dari beberapa perusahaan yang secara khusus dipergunakan
untuk mengukur performansi kualitas.

29
BAB IV

KUALITAS PELAYANAN DAN MANAJEMEN PROSES

Defenisi, Klasifikasi dan Karakteristik Jasa

Jasa adalah semua tindakan atau kegiatan yang dapat tawarkan oleh satu pihak kepada
pihak lainnya yang tidak berwujud dan tidak menyebabkan kepemilikan apapun. Kotler dan
Armstrong (1993:494) Jasa adalah setiap kegiatan atau manfaat yang ditawarkan kepada
pihak lain, yang pada dasarnya tidak berwujud dan tidak menghasilkan kepemilikan sesuatu.
Sementara itu Robert D. Reid (1989:29) memberikan penjelasan mengenai jasa adalah
sesuatu yang tidak berwujud, tidak seperti produk yang berwujud Jasa bukan barang fisik,
tetapi sesuatu yang menghadirkan kegiatan atau perbuatan. Kehadirannya ini umumnya
dilakukan atas dasar personal sering berhadap-hadapan langsung antara individu. Christian
Gonroos (1990:27) mencoba memadukan pengertian jasa sebagai aktivitas dari suatu hakikat
yang tidak berwujud yang berinteraksi antara konsumen dan pemberi jasa dan/sumber daya
fisik atau barang dan sistem yang memberikan jasa, yang memberikan solusi bagi masalah-
masalah konsumen.

Ada lima klasifikasi jasa, yaitu:


1. Barang berwujud murni yaitu penawaran yang terdiri dari barang berwujud, tidak ada
jasa yang menyertai produk itu. Contoh : garam, gula, merica, sabun, pasta gigi.
2. Barang berwujud disertai layanan yaitu penawaran berupa barang berwujud yang
disertai dengan satu atau beberapa jenis jasa untuk meningkatkan daya tarik konsumen.
Contoh : perusahaan dealer mobil tidak hanya menjual produknya saja tetapi disertai
jasa pendukung dari awal, proses dan sesudah produk tersebut terjual.
3. Campuran yaitu penawaran terdiri barang dan jasa dalam proporsi yang sama. Contoh :
orang datang ke restoran untuk mendapatkan makanan dan pelayanan yang diberikan.
4. Jasa utama yang disertai barang dan jasa tambahan yaitu penawaran terdiri dari jasa
utama yang disertai dengan jasa tambahan atau barang pendukung. Contoh :
penumpang pesawat terbang membeli jasa transportasi udara
5. Jasa murni yaitu penawaran hanya terdiri dari jasa. Contoh : psikiater, guru, laundry,
psikolog

30
Dari pengertian tentang jasa, dapat dikatakan bahwa jasa, mempunyai beberapa
karkteristik. Menurut Philip Kotler (1994:466), ada empat karekteristik utama jasa yang
berpengaruh besar pada perencanaan program pemasaran yaitu:

1. Intangibility (tidak berwujud) yaitu jasa tidak dapat dilihat, dirasa, dicium, didengar,
atau diraba sebelum dibeli dan dikonsumsi. Bila barang merupakan suatu objek, alat,
material, atau benda; maka jasa justru merupakan perbuatan, tindakan, pengalaman,
proses, kinerja (performance), atau usaha
2. Inseparability (tidak dapat dipisahkan) yaitu Kegiatan jasa tidak dapat dipisahkan dari
pemberi jasa, baik perorangan ataupun organisasi serta perangkat mesin/teknologi.
3. Variability (berubah-ubah/aneka ragam) yaitu Bahwa kualitas jasa yang diberikan oleh
manusia dan mesin/peralatan berbedabeda, tergantung pada siapa yang memberi,
bagaimana, memberikannya, serta waktu dan tempat jasa tersebut diberikan.
4. Perishability (tidak tahan lama) yaitu Bahwa jasa tidak bisa disimpan untuk kemudian
dijual atau digunakan, sehingga pada dasarnya jasa langsung dikonsumsi pada saat
diberi. Daya tahan suatu jasa tidak akan menjadi masalah jika permintaan selalu ada
dan mantap karena menghasilkan jasa di muka dengan mudah. Bila permintaan turun,
maka masalah yang sulit akan segera muncul.

Sementara itu Lovelock (1984:30) menyatakan bahwa jasa mempunyai tiga


karakteristik utama :

1. More intangible than tangible (cenderung tidak berwujud) yaitu Jasa merupakan
perbuatan, penampilan, atau suatu usaha sehingga bila konsumen membeli jasa maka
umumnya jasa tersebut tidak berwujud, tetapi bila konsumen membeli suatu barang
maka pada umumnya barang tersebut berwujud sehingga dapat dipakai atau
ditempatkan disuatu tempat.
2. Simultaneous production and consumption (produksi dan konsumsi serentak) yaitu Jasa
diproduksi dan dikonsumsi dalam waktu yang sama artinya penghasil jasa hadir secara
fisik pada saat konsumsi berlangsung.
3. Less standardized and uniform (kurang terstandarisasi dan seragam) yaitu Industri jasa
cenderung dibedakan berdasarkan orang (people based) dan peralatan (equipment
based).

31
Strategi Mengelola Mutu Jasa

Mutu jasa suatu perusahaan diuji dalam setiap pertemuan jasa. Jika karyawan-karyawan
eceran merasa bosan, tidak dapat menjawab pertanyaan-pertanyaan sederhana, atau saling
berkunjung pada saat pelanggan sedang menunggu, pelanggan akan berfikir dua kali untuk
melakukan bisnis lagi dengan penjual tersebut. Ada 10 faktor yang signifikan dalam
mengelola mutu jasa, yaitu :

1. Kesiapan sarana jasa (access)


2. Komunikasi harus baik (communication)
3. Karyawan yang terampil (competence)
4. Hubungan baik dengan konsumen (courtesy)
5. Perusahaan dan karyawan harus berorientasi pada konsumen (credibility)
6. Harus konsisten dan cermat (responsiveness)
7. Cepat tanggap (responsiveness)
8. Keamanan konsumen terjaga (security)
9. Harus bisa dilihat (tangibles)
10. Memahami keinginan konsumen (understanding knowing the costumer)

Selain 10 faktor di atas, untuk dapat mengelola mutu jasa dengan baik maka dapat
dilakukan dengan cara mengidentifikasi lima kesenjangan yang mengakibatkan kegagalan
Penyampain jasa, yaitu :

1. Kesenjangan antara harapan konsumen dan persepsi manajemen : Manajemen tidak


selalu memahami secara tepat apa yang diinginkan pelanggan.
2. Kesenjangan antara persepsi manajemen dan spesifikasi kualitas jasa : Manajemen
mungkin memahami secara tepat keinginan pelanggan tetapi tidak menetapkan suatu
set standar spesifikasi.
3. kesenjangan antara spesifikasi kualitas jasa dan penyampaian jasa : para personil
mungkin kurang terlatih atau tidak mampu atau tidak mau memenuhi standar.
4. Kesenjangan antara penyampaian jasa dan komunikasi eksternal : Harapan konsumen
dipengaruhi oleh pernyataan yang dibuat para wakil perusahaan.
5. Kesenjangan antara jasa yang dialami dan jasa yang diharapkan : Kesenjangan ini
terjadi bila memiliki persepsi yang keliru tentang kualitas jasa tersebut.

32
Jadi untuk meningkatkan kualitas pelayanan, manajemen kualitas jasa menfokuskan
perhatian pada strategi pelayanan 7P

1. Product.
Terdiri dari Ide pengembangan produk, Variasi dan model produk ,Spesifikasi
kualitas produk, Pengepakan, Logo produk / merk dagang dan Pelayanan pendukung.
2. Price
Terdiri dari Analisa kompetitif, penetapan harga, Diskon.
3. Place :
Teriri dari Rencana saluran distribusi, Alokasi tempat pamer, Manajemen gudang /
persediaan, Kebijakan dan standar tingkat pelayanan, Kenyamanan lokasi.
4. Promotion :
Terdiri dari Strategi periklanan, Media iklan yang digunakan, Penjualan langsung
bersifat pribadi, Posisi pasar, Posisi produk.
5. Phisical Evidence :
Terdiri dari Kebersihan dan penerangan, Kesehatan karyawan, Kenyamanan dalam
menggunkan peralatan, Kredibilitas professional.
6. Process Design:
Terdiri dari Deskripsi pekerjaan, Prosedur menangani masalah pelanggan, Prosedur
pelatihan, Penetapan standar performance
7. Participants :
Terdiri dari Pelatihan tentang keterampilan interaksi dengan pelanggan, Sistem dan
prosedur balas jasa karyawan, Personal Selling, Prosedurpartisipasi sesuai norma
berlaku.

Prinsip prinsip Manajemen Jasa

Menurut Tjiptono (2006:75) untuk menciptakan suatu gaya manajemen dan lingkungan
yang kondusif bagi perusahaan jasa untuk memperbaiki kualitas, perusahaan harus mampu
memenuhi enam prinsip utama yang berlaku baik bagi perusahaan manufaktur maupun
perusahaan jasa. Keenarn prinsip tersebut sangat bermanfaat dalarn membentuk dan
mempertahankan lingkungan yang tepat untuk melaksanakan penyempurnaan kualitas secara
berkesinambungan dengan didukung oleh pemasok, karyawan, dan pelanggan. Enam prinsip
pokok tersebut meliputi:

33
1. Kepemimpinan
Strategi kualitas perusahaan harus merupakan inisiatif dan komitmen dari
manajemen puncak. Manajemen puncak hams memirnpin perusahaan untuk
meningkatkan kinerja kualitasnya. Tanpa adanya kepemimpinan dari manajemen
puncak, maka usaha untuk meningkatkan kualitas hanya berdampak kecil terhadap
perusahaan.
2. Pendidikan
Personil perusahaan dari manajer puncak sampai karyawan operasional harus
memperoleh pendidikan mengenai kualitas. Aspek-aspek yang perlu mendapatkan
penekanan dalam pendidikan tersebut meliputi konsep kualitas sebagai strategi
bisnis, alat dan teknik implementasi strategi kualitas, dan peranan eksekutif dalam
implementasi strategi kualitas.
3. Perencanaan
Proses perencanaan strategik harus mencakup pengukuran dan tujuan kualitas yang
dipergunakan dalam mengarahkan perusahaan untuk mencapai visinya.
4. Review
Proses review merupakan satu-satunya alat yang paling efektil bagi manajemen
untuk mengubah perilaku organisasional. Proses ini merupakan suatu mekanisme
yang menjamin adanya perhatian yang konstan dan terus- menerus untuk mencapai
tujuan kualitas.
5. Komunikasi
lmplementasi strategi kualitas dalam organisasi dipengaruhi oleh proses komunikasi
dalam perusahaan. Komunikasi harus dilakukan dengan karyawan, pelanggan, dan
stakeholder perusahaan lainnya, seperti pemasok, pemegang saham, pemerintah,
masyarakat umum, dan lain-lain.
6. Penghargaan dan pengakuan (Total Human Reward)
Penghargaan dan pengakuan merupakan aspek yang penting dalam implementasi
strategi kualitas. Setiap karyawan yang berprestasi balk perlu diberi penghargaan
dan prestasinya tersebut diakui. Dengan demikian dapat meningkatkan motivasi,
moral kerja, rasa bangga, dan rasa kepemilikan setiap orang dalam organisasi, yang
pada gilirannya dapat memberikan kontribusi besar bagi perusahaan dan bagi
pelanggan yang dilayani.

34
Defenisi Proses dan Manajemen Proses

Suatu proses dapat didefenisikan sebagai integrasi sekuensial dari orang, material,
metode, dan mesin atau peralatan, dalam suatu lingkungan guna untuk menghasilkan nilai
tambah output untuk pelanggan. Manajemen proses adalah Suatu proses mengkonversi input
terukur ke dalam output terukur melalui sejumlah langkah sekuensial yang terorganisasi.
Terdapat empat kelompok orang yang terlibat dalam operasi dan perbaikan proses, yaitu:

1. Pelanggan (Customers), merupakan orang yang akan menggunakan output secara


langsung atau orang yang akan menggunakan output itu sebagai input dalam proses
kerja mereka.
2. Kelompok kerja (work group), merupakan orang-orang yang bekerja dalam proses
untuk menghasilkan dan menyerahkan output yang diinginkan itu.
3. Pemasuk (supplier), merupakan orang yang memberikan input ke proses kerja. Orang-
orang yang bekerja dalam proses pada kenyataannya merupakan pelanggan dari
pemasok.
4. Pemilik proses (process owner), merupakan orang yang bertanggung jawab untuk
operasi dari proses dan untuk perbaikan proses itu.

Konsep dari manajemen proses berkaitan dengan perbaikan kualitas. Terdapat enam
komponen yang penting untuk manajemen proses, yaitu:

1. Kepemilikan (ownership), menugaskan tanggung jawab untuk desain, operasi, dan


perbaikan proses.
2. Perencanaan (planning), menetapkan suatu pendekatan terstruktur dan terdisiplin
untuk mengerti, mendefenisikan, dan mendokumentasikan semua komponen utama
dalam proses dan hubungan antar komponen utama itu.
3. Pengendalian (control), menjamin efektivitas, semua output dapat diperkirakan dan
konsisten dengan ekspektasi pelanggan.
4. Pengukuran (measurement), memetakan kinerja atribut terhadap kebutuhan pelanggan
dan menetapkan kriteria untuk akurasi, presisi, dan frekuensi perolehan data.
5. Perbaikan atau peningkatan (improvement), meningkatkan efektivitas dari proses
melalui perbaikan-perbaikan yang diidentifikasi secara tetap.
6. Optimisasi (optimization), meningkatkan efisiensi dan produktivitas melalui
perbaikan-perbaian yang diidentifikasi secara tetap.

35
Keenam komponen di atas merupakan landasan untuk keberhasilan manajemen dari
suatu proses apa saja. Komponen-komponen itu dibutuhkan untuk proses kerja yang
menghasilkan dan menyerahkan produk ke pelanggan, untuk proses yang menspesifikasikan
kebutuhan dan kepuasan sepanjang rantai pelanggan-pemasok (customer-supplier chain), dan
untuk proses yang mendukung pekerja dalam pekerjaan mereka.

Langkah-langkah Perbaikan Proses

Model perbaikan proses pada umumnya terdiri dari enam langkah, yaitu :

1. Mendefenisikan masalah dalam konteks proses


Model perbaikan proses dimulai dari penetapan atau spesifikasi sistem mana
yang terlibat, agar usaha-usaha dapat terfokus pada proses bukan pada output.
Aktivitas spesifik dalam langkah 1 ini adalah:
Identifikasi output
Identifikasi pelanggan
Defenisi kebutuhan pelanggan
Identifikasi proses yang menghasilkan output ini
Identifikasi pemilik proses.
2. Identifikasi dan dokumentasi proses
Diagram alir (flowchart) merupakan alat yang umum dipergunakan untuk
mendeskripsikan proses. Pembuatan diagram alir dari proses akan memungkinkan kita
untuk melakukan lima aktivitas perbaikan, yaitu:
Mengidentifikasi peserta (partisipants) dalam proses, berdasarkan nama,
posisi, atau organisasi.
Memberikan kepada semua peserta dalam suatu pemahaman umum tentang
semua langkah dalam proses dan peranan individual mereka.
Mengidentifikasi inefisiensi, variasi, pemborosan, dan langkah-langkah
redundant (berlebihan atau tidak perlu) dalam proses.
Menawarkan suatu kerangka kerja untuk mendefenisikan pengukuran proses.
Proses yang telah diidentifikasi harus didokumentasikan secara baik agar
dapat dipergunakan sebagai bahan informasi yang berguna dalam perbaikan
proses secara terus-menerus.
3. Mengukur kinerja

36
Pengukuran kinerja dimaksudkan untuk dapat mengkuantifikasikan bagaimana
baik atau jelek suatu sistem sedang berjalan atau beroperasi. Ukuran-ukuran kinerja
harus didefenisikan dan dievaluasi dalam konteks ekspektasi pelanggan, dengan kata
lain setiap ukuran kinerja yang dipergunakan harus mengacu pada ekspektasi
pelanggan. Pada dasarnya pengukuran kinerja dapat dilakukan pada tiga tingkat, yaitu
: proses, output,dan outcome.
4. Memahami mengapa suatu masalah dalam konteks proses terjadi
Masalah merupakan deviasi atau penyimpangan yang terjadi antara kinerja
yang diharapkan (target) dan kinerja aktual (hasil aktual). Untuk memahami suatu
masalah terjadi dan agar langkah-langkah menuu perbaikan proses menjadi efektif
dan efisien, kita dapat mengajukan beberapa pertanyaan dasar, antara lain :
Apa yang menjadi masalah utama dalam proses itu?
Apa yang menjadi akar penyebab dari masalah dalam proses itu?
Apa yang merupakan sumber variasi dan pemborosan dari proses itu?
5. Mengembangkan dan menguji ide-ide
Ide-ide untuk perbaikan proses harus ditujukan langsung pada akar penyebab
masalah. Agar ide-ide yang dipilih untuk perbaikan proses itu menjadi efektif, maka
ide-ide itu perlu diuji terlebih dahulu sebelum ide-ide tersebut
diimplementasikan.eksperimentasi dari ide-ide itu akan membantu menghindari
kegagalan pada waktu ide-ide tersebut diimplementasikan dalam proses.
6. Implementasi solusi dan evaluasi
Langkah ini dimulai melalui perencanaan dan implementasi perbaikan yang
diidentifikasi dan diuji dalam langkah sebelumnya. Langkah ini dilakukan untuk
mengukur dan mengevaluasi efektifitas dari proses yang diperbaiki

Model Perbaikan Kualitas Berorientasi Proses

Proses perbaikan kualitas membutuhkan studi tertentu, model yang digunakan


disesuaikan dengan metode-metode yang diperlukan untuk memenuhi kebutuhan pelanggan.
Proses perbaikan kualitas biasanya dimulai dengan perencanaan, pengorganisasian, dan
pemantauan kualitas. Contoh: Perusahaan xerox, Xerox mengembangkan suatu model yang
dikenal sebagai model proses solusi masalah ( problem-solving process, PSP ). Model PSP
dari xerox terdiri dari enam langkah, yaitu:

37
1. Identifikasi dan memilih masalah
2. Analisis masalah
3. Membangkitkan solusi potensial
4. Memilih dan merencanakan solusi
5. Menerapkan solusi
6. Menilai solusi

Selain model tersebut di atas, Dr Douglas Montgomey pada tahun 1990 mengemukakan
suatu model yang disebut sebagai modelm perbaikan kualitas proses bisnis ( business process
quality improrement, BPQI ) dapat dilihat pada bagan berikut ini :

INPUT AKTIVITAS OUTPUT


(PROSES)
PEMASOK PELANGGAN

PENGUKURAN
Pengujian identifikasi
dan evaluasi kecacatan

MENGHILANGKAN CACAT
PENYEBAB
KECACATAN
Analisis penyebab
AKAR
Mengembangkan kecacatan
PENYEBAB
tindakan korektif

Dari bagan di atas tampak bahwa model perbaikan kualitas proses bisnis mengkaji
keseluruhan rantai pemasok-pelanggan, dimana suatu kebutuhan dari pelanggan merupakan
masukan bagi industri untuk diteruskan kepada pemasok.pengukuran dilakukan pada
keseluruhan sistem, dimana apabila ditemukan suatu kecacatan maka harus diidentifikasi
kecacatan itu, lalu dianalisis penyebab kecatatan yang terjadi dalam proses secara
keseluruhan. Hasil temuan berupa akar penyebab kegagalan/keacatan itu selanjutnya melalui
pengembangan tindakan korektif harus dihilangkan. Kemudian dilakukan tindakan pengujian

38
dan evaluasi untuk mengetahui apakah tindakan korektif tersebut telah efektif menghilangkan
kecacatn tersebut.

Proses Perbaikan dan Pengendalian

Beberapa atribut yang harus diperhatikan dalam perbaikan kualitas jasa adalah:
1. Ketepatan waktu pelayanan. Yang perlu diperhatikan di sini adalah berkaitan dengan
waktu tunggu dan waktu proses.
2. Akurasi pelayanan, yang berkaitan dengan reliabilitas pelayanan dan bebas kesalahan-
kesalahan.
3. Kesopanan dan keramahan dalam memberikan pelayanan. Terutama mereka
yang berinteraksi langsung dengan pelanggan.
4. Tanggung jawab, berkaitan dengan penerimaan pesanan dan penanganan keluhandari
pelanggan.
5. Kelengkapan, menyangkut lingkup pelayanan dan ketersediaan sarana pendukung
serta pelayanan komplementer lainnya.
6. Kemudahan mendapatkan pelayanan, berkaitan dengan banyaknya outlet, banyaknya
kasir, banyaknya staf administrasi, dll.
7. Variasi model pelayanan, berkaitan dengan inovasi dalam memberikan pelayanan.
8. Pelayanan pribadi, berkaitan dengan flexibelitas dan permintaan khusus.
9. Kenyamanan dalam memperoleh pelayanan, berkaitan dengan lokasi, ruangantempat
pelayanan, kemudahan tempat parkir, dll.
10. Atribut pendukung pelayanan lainnya, seperti kebersihan, AC, ruang tunggu, dll.

Proses Pengendalian kualitas atau Quality Control secara umum didefinisikan


sebagai sebuah sistem yang digunakan untuk mencapai tingkatan kualitas yang diinginkan
dari sebuah produk atau jasa. Quality control adalah kegiatan inspecting, testing dan
grading dengan menggunakan statistik sebagai analisa data yang tepat sebagai jawaban
untuk pembanding dan estimasi yang baik dan yang tidak baik dipisah-pisahkan (grading)
untuk mencari mana yang dapat diterima (accept) dan mana yang ditolak. Tujuannya adalah
untuk mendapatkan spesifikasi produk atau jasa sesuai dengan kualitas yang diharapkan.
Pengendalian kualitas ini dilakukan ketika proses pembuatan barang hingga selesai dan
sampai barang tersebut berada ditangan konsumen sehingga diharapkan ketika produk itu

39
sudah jadi maka produk tersebut sesuai dengan kualitas yang diharapkan. keuntungan
pengendalian kualitas bagi produk atau jasa antara lain:

1. Dapat melakukan perbaikan kualitas produk atau jasa.


2. Sistem secara kontinu dievaluasi dan dimodifikasi untuk memenuhi kebutuhan
pelanggan yang berubah-ubah.
3. Meningkatkan produktivitas yang merupakan tujuan perusahaan.
4. Peningkatan produktivitas ini berarti penurunan scrap dan proses ulang.
5. Menurunkan biaya produksi.
6. Meningkatkan produktivitas dengan menurunkan leadtime pembuatan part atau
subassemblies.
7. Dapat melakukan perbaikan kualitas dan produktivitas secara terus-menerus.

Ada banyak metode dan tools yang digunakan untuk melakukan pengendalian
kualitas (Quality Control) statistik namun yang terkenal adalah dengan menggunakan
Seven tools atau ada yang menyebutnya dengan seven magnificent tools yaitu menggunakan:

1. Flowchart, tools yang menggambarkan suatu proses barang atau jasa secara detail
sehingga kita bisa menganalisis bagian dari proses.
2. Check Sheet atau Lembar pemeriksaan lembaran yang berisi daftar kualitas yang
harus dipenuhi ketika proses berjalan.
3. Histogram, grafik diagram batang yang menggambarkan banyaknya faktor yang
berpengaruh terhadap produk atau jasa.
4. Scatter Plot, Diagram pola yang digunakan untuk menggambarkan kedekatan faktor
faktor pada produk atau jasa.
5. Control Charts, Peta kontrol itu untuk mengtahui data tingkatan kualitas produk
terhadap kecacatan produk terhadap waktu yang ada. tujuannya untuk mendapatkan
keseragaman kualitas sehingga jika terjadi peningkatan grafik (jumlah cacat lebih)
maka perlu dilakukan perbaikan berkelanjutan (continuous improvement).
6. Fishbone Diagram (Ishikawa Diagram), Analisis sebab akibat yang digunakan
untuk menggambarkan hubungan hubungan antara faktor penyebab ketidaksuaian
pada produk dan jasa.
7. Pareto Diagram, diagram batang yang menggambarkan proporsi faktor yang
berpengaruh terhadap produk dan jasa. karena menurut pareto, dengan menyelesaikan
20% masalah utama dapat meningkatkan hasil 80 %.
40
Teknik Pengawasan Kualitas Secara Statistik

Pengawasan kualitas yang baik akan membantu dalam kelancaran proses produksi,
sehingga aktivitas produksi akan dapat mencapai sasarannya. Dengan adanya pengawasan
kualitas kemungkinan dapat mengurangi biaya-biaya yang diperlukan yaitu dengan cara
memperkecil jumlah kerusakan dan pemborosan yang terjadi dalam produksi dan dapat
dihindari. Dari keterangan di atas dapat diketahui bahwa setiap aktivitas pengawasan kualitas
merupakan usaha tercapainya tujuan dalam pengawasan produksi. Jadi pengawasan kualitas
mempunyai hubungan yang erat dengan pengawasan produksi dan tidak adanya pengawasan
terhadap kualitas akan mengakibatkan perusahaan berjalan tidak efisien yang pada akhirnya
proses produksi tidak akan berjalan lancar.

Dalam melaksanakan kegiatan proses produksi biasanya terdapat beberapa pilihan


dalam hal peralatan proses produksi yang akan dipakai, mulai dari penentuan tempat operasi,
perencanaan gedung yang sesuai, sampai kepada penentuan dan pilihan mesin-mesin serta
fasilitas produksi lainnya. Sehingga rancangan produksi barang yang akan diproses tidak
terlepas dari standar kualitas produk perusahaan, yang akan memudahkan untuk melakukan
pengawasan produk akhir. Memang perlu disadari bahwa tidak ada produk yang sempurna
dan mempunyai spesifik produk yang sama dengan apa yang ditentukan dalam standar.
Tetapi dengan adanya batasan-batasan pengawasan dan batasan toleransi tertentu dapat
diambil keputusan apakah produk tersebut layak.

Pengawasan kualiatas statistik adalah alat bantu manajemen untuk menjamin kualitas,
karena pada dasarnya tidak ada dua produk yang dihasilkan oleh suatu proses produksi itu
sama benar, tidak dapat dihindarkan adanya variasinya. Pengujian statistik diperlukan untuk
menyelesaikan masalah seperti ini, dalam pengendalian kualitas statistik teknik-teknik
tersebut diaplikasikan guna memeriksa dan menguji data untuk menentukan standar dan
mengecek kesesuaian produk untuk mencapai operasi manufaktur yang maksimum, dan
biasanya menghasilkan biaya kualitas yang lebih rendah dan menaikkan tingkat posisi
kompetitif. Rancangan percobaan dapat digunakan dalam hubungannya dengan pengendalian
proses statistik untuk meminimumkan variabilitas proses, yang menghasilkan produksi yang
pada akhirnya bebas cacat (Purnomo, 2004). Keuntungan Pengendalian Kualitas Statistik
Pengendalian kualitas statistik merupakan alat manajemen secara ilmiah.

41
BAB V

BIAYA KUALITAS

1. Definisi, dan Jenis-Jenis Biaya Kualitas

Biaya kualitas menurut Blocher, Chen dan Lin yang diterjemahkan oleh A. Susty
Ambarriani dalam buku Manajemen Biaya adalah : Biaya kualitas adalah biaya-biaya
yang berkaitan dengan pencegahan, pengindentifikasian, perbaikan dan pembetulan produk
yang berkualitas rendah, dan dengan opportunity cost dari hilangnya waktu produksi dan
penjualan sebagai akibat rendahnya kualitas.

Sedangkan pengertian biaya kualitas menurut Bambang Hariadi dalam buku


Akuntansi Manajemen Suatu Sudut Pandang adalah : Biaya kualitas adalah biaya atas
aktivitas-aktivitas yang dilakukan untuk menghindarkan suatu produk atau jasa dari kualitas
jelek yang mungkin ada. Definisi mencakup dua aktivitas yaitu aktivitas pengendalian
(control activities) dan aktivitas kegagalan (failure activities).

Berdasarkan pengertian-pengertian di atas dapat disimpulkan bahwa biaya kualitas


merupakan biaya yang dikeluarkan untuk mencegah terjadinya barang yang diproduksi
mengalami kegagalan (cacat) atau biaya yang dikeluarkan karena adanya barang cacat yang
diakibatkan dari kualitas barang yang rendah. Jadi biaya kualitas adalah biaya yang
berhubungan dengan penciptaan, pengidentifikasian,perbaikan, dan pencegahan kerusakan.

Biaya kualitas tidak hanya terdiri atas biaya untuk mencapai mutu, tetapi juga biaya
yang terjadi karena kurangnya kualitas. Untuk memahami dan meminimalkan biaya kualitas,
jenis biaya kualitas harus diidentifikasi dan dibedakan ke dalam beberapa kategori. Menurut
Ross yang diterjemahkan oleh M. N.Nasution dalam buku Manajemen Mutu Terpadu
biaya kualitas dapat diklasifikasikan menjadi empat kategori, yaitu:

a. Biaya pencegahan (Prevention Costs)


Biaya ini muncul untuk mencegah terjadinya kualitas buruk dalam produk atau jasa
yang dihasilkan, atau biaya yang terjadi untuk mencegah kerusakan produk yang
dihasilkan.. Biaya ini meliputi biaya yang berhubungan dengan perancangan,

42
pelaksanaan, dan pemeliharaan sistem kualitas. Ada beberapa macam biaya yang
termasuk dalam biaya pencegahan, yaitu sebagai berikut:
Biaya perencanaan kualitas, yaitu biaya-biaya yang dikeluarkan untuk
aktivitas-aktivitas yang berkaitan dengan patokan rencana kualitas produk
yang dihasilkan, rencana tentang keandalan, rencana pemeriksaan, sistem
data, dan rencana khusus dari jaminan kualitas.
Biaya tinjauan produk baru, yaitu biaya-biaya yang dikeluarkan untuk
penyiapan usulan tawaran, penilaian rancangan baru dari kualitas, penyiapan
program percobaan, dan pengujian untuk menilai penampilan produk baru
serta aktivitas-aktivitas kualitas lainnya selama tahap pengembangan dan
praproduksi dari rancangan produk baru.
Biaya pemeliharaan peralatan, yaitu biaya-biaya yang dikeluarkan untuk
memasang, menyesuaikan, mempertahankan, memperbaiki dan menginspeksi
perlatan produksi, proses dan sistem.
Biaya pengendalian proses, yaitu biaya-biaya yang dikeluarkan untuk
teknik pengendalian proses, seperti diagram pengendalian yang memantau
proses pembuatan dalam usaha mencapai kualitas produksi yang dikehendaki.
Biaya pelatihan, yaitu biaya-biaya yang dikeluarkan untuk pengembangan,
penyiapan, pelaksanaan, penyelenggaraan, dan pemeliharaan program latihan
formal masalah kualitas. Ini meliputi upah dan gaji yang dibayarkan dalam
pelatihan dan biaya instruksi.

b. Biaya Deteksi/Penilaian (Detection/ Appraisal Cost)


Biaya penilaian / deteksi adalah biaya yang terjadi untuk menentukan apakah produk
atau jasa sesuai dengan kebutuhan pelanggan atau spesifikasi persyaratan-
persyaratan kualitas. Tujuan utama dari fungsi penilaian adalah menghindari
dikirimnya barang-barang yang tidak sesuai dengan kualitas kepada para pelanggan.
Yang termasuk dalam jenis deteksi ini antara lain adalah sebagai berikut :
Biaya pengujian dan inspeksi (pemeriksaan). Biaya ini meliputi biaya
yang dikeluarkan untuk menguji menginspeksi bahan yang datang, produk
dalam proses dan produk selesai.

43
Audit Kualitas. Biaya ini meliputi gaji dan upah semua orang yang terlibat
dalam penilaian kualitas produk dan jasa dan pengeluaran lain yang
dikeluarkan selama penilaian kualitas.
Peralatan pengujian. Biaya ini meliputi biaya yang dikeluarkan untuk
memperoleh, mengoperasikan atau mempertahankan fasilitas, software,
mesin dan perlatan pengujian atau penilaian kualitas produk, jasa atau proses.

c. Biaya Kegagalan Internal (Internal Failure Cost)


Biaya kegagalan internal adalah biaya yang terjadi karena ada ketidaksesuaian
dengan persyaratan dan terdeteksi sebelum barang atau jasa tersebut dikirimkan ke
pihak luar (pelanggan). Pengukuran biaya kegagalan internal dilakukan dengan
menghitung kerusakan produk sebelum meninggalkan perusahaan.Biaya kegagalan
internal terdiri atas beberapa jenis biaya, yaitu sebagai berikut :
Biaya sisa bahan (scrap). Biaya ini adalah kerugian yang terjadi karena
adanya sisa bahan baku yang tidak terpakai dalam upaya memenuhi tingkat
kualitas yang dikehendaki. Bahan baku yang tersisa karena alasan lain
(misalnya keusangan, dan perubahan desain produk) tidak termasuk dalam
kategori biaya ini.
Biaya pengerjaan ulang (rework). Biaya ini meliputi biaya yang
dikeluarkan untuk melakukan proses pengerjaan ulang agar dapat memenuhi
standar kualitas yang disyaratkan.
Biaya untuk memperoleh bahan baku. Biaya ini meliputi biaya-biaya
tambahan yang timbul karena adanya aktivitas menangani penolakan (rejects)
dan pengaduan (complaints) terhadap bahan baku yang telah dibeli.

d. Biaya Kegagalan Eksternal (External Failute Cost)


Biaya kegagalan eksternal adalah biaya yang terjadi karena produk atau jasa gagal
memenuhi persyaratan-persyaratan yang diketahui setelah produk tersebut
dikirimkan kepada pelanggan. Dari semua biaya, kategori ini merupakan biaya yang
paling membahayakan karena dapat menyebabkan reputasi perusahaan buruk,
kehilangan pelanggan, dan penurunan pangsa pasar.Biaya kegagalan eksternal terdiri
atas beberapa macam biaya, diantaranya adalah sebagai berikut :

44
Biaya penanganan keseluruhan selama masa garansi. Biaya ini meliputi
semua biaya yang terjadi karena adanya keluhan-keluhan tertentu, sehingga
diperlukan pemeriksaan, reparasi, atau penggantian/penukaran produk.
Biaya penanganan keluhan di luar masa garansi. Biaya ini merupakan
biaya-biaya yang berkaitan dengan keluhan-keluhan yang timbul setelah
berlalunya masa garansi.
Pelayanan produk. Biaya ini adalah keseluruhan biaya pelayanan produk
yang diakibatkan oleh usaha untuk memperbaiki ketidaksempurnaan atau
untuk pengujian khusus, atau untuk memperbaiki cacat yang bukan
disebabkan oleh adanya keluhan pelanggan.
Biaya penarikan kembali produk. Biaya ini timbul karena adanya
penarikan kembali suatu produk atau komponen produk tertentu.

Biaya kualitas ini juga dapat kelompokkan menjadi dua bagian yaitu pertama biaya
pencegahan dan biaya penilaian dapat digolongkan sebagai biaya pengendalian yaitu biaya
yang timbul karena ada aktivitas pencegahan kerusakan dari proses produksi, sedangkan
biaya kegagalan internal dan eksternal merupakan biya kegagalan yang timbul selama proses
produksi atau setelah produk tersebut dikirimkan pada konsumen.

2. Konsep dan Perilaku Biaya Kualitas

Sebagai alat strategi bisnis, konsep biaya kualitas adalah salah satu konsep yang mendukung
perbaikan peningkatan kualitas bagi perusahaan. Konsep biaya kualitas memberikan
kesempatan bagi perusahaan untuk dapat mengidentifikasi aktivitas maupun biaya yang
semestinya dikeluarkan untuk menghasilkan produk yang berkualitas. Identifikasi atas biaya
kualitas yang termasuk dalam biaya pencegahan, biaya penilaian, biaya kegagalan internal
dan eksternal membuat perusahaan untuk merencanakan aktivitas produksi yang berkualitas
sehingga terhindar dari kegagalan produk, dimanan untuk aktivitas yang mengeluarkan biaya
pencegahan termasuk ke dalam aktivitas yang bernilai tambah, sedangkan biaya penilaian,
biaya kegagalan internal dan eksternal termasuk dalam biaya yang menghasilkan aktivitas
tidak bernilai tamabah. Namun perbaikan kualitas ini bertujuan untuk memenuhi kepuasan
pelanggan.

45
Kualitas dapat diukur berdasarkan biayanya. Perusahaan menginginkan agar biaya
kualitas turun, namun dapat mencapai kualitas yang lebih tinggi, setidak-tidaknya sampai
dengan titik tertentu. Bila standar kerusakan nol dapat dicapai, maka perusahaan masih harus
menanggung biaya pencegahan dan penilaian/ deteksi. Menurut para pakar kualitas, suatu
perusahaan dengan program pengelolaan kualitas yang berjalan dengan baik, biaya
kualitasnya tidak lebih besar dari 2,5% dari penjualan.

Pandangan terhadap Biaya Kualitas dan Jumlah Kesalahan


Dewasa ini, ada tiga kategori pandangan yang berkembang diantara para praktisi
mengenai biaya kualitas, yaitu sebagai berikut:

1. Kualitas yang makin tinggi berarti biaya yang semakin tinggi pula. Unsur kualitas,
seperti kinerja dan karakteristik tambahan menimbulkan biaya yang lebih besar dalam
hal tenaga kerja, bahan baku, desain, dan sumber daya ekonomis lainnya. Manfaat
tambahan dari peningkatan kualitas tidak dapat menutupi biaya tambahan.
2. Biaya peningkatan kualitas lebih rendah daripada penghematan yang dihasilkan.
Pandangan ini dikemukakan pertama oleh Deming dan dianut oleh para pemanufakturan
Jepang. Penghematan dihasilkan dari berkurangnya tingkat pengerjaan ulang, produk
cacat, dan biaya langsung lainnya yang berkaitan dengan kerusakan. Pandangan inilah
yang menjadi landasan bagi perbaikan berkesinambungan pada perusahaan-perusahaan
Jepang.
3. Biaya kualitas merupakan biaya yang besarnya melebihi biaya yang terjadi bila barang
atau jasa yang dihasilkan secara benar sejak saat pertama (exactly right the first time)
produksi. Pandangan ini dianut oleh pendukung filosofi TQM. Biaya tidak hanya
menyangkut biaya langsung, tetapi juga akibat kehilangan pelanggan, kehilangan
pangsa pasar, dan banyak biaya yang tersembunyi lainnya serta peluang yang hilang dan
tidak terindentifikasi oleh sistem akuntansi biaya modern.
Menurut Juran, struktur biaya kualitas sangat dipengaruhi oleh interaksi antara
keempat jenis biaya kualitas, yaitu pencegahan, biaya penilaian, biaya kerusakan internal, dan
biaya kerusakan eksternal. Biaya pengendalian, yaitu biaya pencegahan dan biaya penilaian
meningkat seiring dengan peningkatan kualitas, sedangkan biaya kegagalan (internal dan
eksternal) menurun seiring dengan peningkatan kualitas. Dalam hal ini disarankan agar
manajemen dapat menemukan level atau tingkat kualitas (jumlah kerusakan) yang tepat
sehingga akan meminimumkan biaya kualitas total.

46
Berdasarkan pendekatan tradisional, beranggapan bahwa kesalahan tidak dapat
dihindari sehingga sangatlah mahal biaya yang dikeluarkan untuk memperbaiki semua
kerusakan dan juga mengatakan bahwa biaya terendah dicapai pada tingkat nonzero defect.
Pendukung pandangan ini berpendapat bahwa biaya untuk mengatasi kesalahan meningkat
dengan semakin banyaknya kesalahan yang terdeteksi dan berkurang apabila ada sedikit yang
dibiarkan.

Sedangkan menurut TQM berpendapat bahwa biaya terendah dicapai pada tingkat zero
defect (tingkat kerusakan nol). Pendukung pandangan ini berpendapat bahwa meskipun
kesalahan yang ada itu berjumlah besar, tetapi hal ini tidak memerlukan lebih banyak biaya
untuk memperbaiki kesalahan yang terakhir tersebut dibandingkan dengan mengoreksi
kesalahan yang pertama. Oleh karena itu, biaya total akan menurun sampai kesalahan terakhir
diatasi. Dalam hal ini TQM berpendapat bahwa quality is free.

Menciptakan keunggulan Bersaing dengan Penerapan Biaya Kualitas

Konsep keunggulan bersaing perusahaan banyak dikembangkan dari strategi generik


yang dikemukakan oleh Porter (1985). Hal-hal yang dapat mengindikasikan variabel
keunggulan bersaing adalah imitabilitas, durabilitas, dan kemudahan menyamai. Keunggulan
bersaing adalah jantung kinerja perusahaan dalam pasar bersaing. Keunggulan perusahaan
pada dasarnya tumbuh dari nilai atau manfaat yang dapat diciptakan perusahaan bagi para
pembelinya. Menciptakan keunggulan bersaing dapat ditempuh salah satunya dengan
penerapan biaya kualitas yang efektif dan efisien dikarenakan:

Biaya kualitas memusatkan perhatian pada berapa besar biaya dari kualitas yang
rendah, walaupun ukuran-ukuran biaya kualitas kadang-kadang tidak memasukkan
biaya yang penting tapi sulit diukur seperti pengaruh kualitas yang rendah terhadap
hubungan baik dengan konsumen.
Ukuran biaya kualitas finansial adalah cara yang bermanfaat untuk membandingkan
antara proyek-proyek peningkatan kualitas yang berbeda dan untuk menetapkan
prioritas pengurangan biaya yang maksimum.
Ukuran biaya kualitas finansial berfungsi sebagai denominator untuk mengevaluasi
trade-off antara baiaya pencegahan dengan biaya kegagalan. Biaya kualitas
memberikan ukuran yang ringkas dan tunggal mengenai kinerja kualitas.

47
Pandangan yang kompetitif tentang kualitas menekankan perolehan produktivitas
dicapai melalui perbaikan kualitas. Penerapan biaya kualitas yang diajalankan dengan efektif
dan efisien tentunya akan memperoleh kesesuaian dengan standar yang mampu memberikan
kepuasan konsumen dan diukur berbasis proses perbaikan berkesinambungan. Kualitas
ditentukan pada desain produk dan dicapai dengan pengendalian proses yang efektif dimana
produk cacat dihindari dalam keberlangsungannya. Sehingga kualitas merupakan bagian dari
setiap fungsi tahap daur hidup produk yang menuntut manajemen bertanggungjawab serta
hubungan terbina dengan pemasok bersifat jangka panjang pada orientasi kualitas.
Singkatnya proses menjadi perhatian dalam pandangan yang kompetitif tentang kualitas.

48
BAB VI

BUDAYA KUALITAS DAN REKAYASA ULANG PROSES BISNIS

Definisi dan Tujuan Rekayasa Ulang Proses Bisnis

Menurut Michael Hammer dan James Champy, rekayasa ulang proses bisnis atau
Business process reengineering (BPR) adalah :Business process reengineering is the
fundamental rethinking and radical redesign of business system to aachieve dramatic
improvements in critical, contemporary measures of performance, such as cost, quality,
service and speed , atau dapat diartikan Reengineering proses bisnis adalah mendesain
ulang pemikiran ulang fundamental dan radikal dari sistem bisnis untuk aachieve perbaikan
dramatis dalam kritis, pengukuran kinerja kontemporer, seperti biaya, kualitas pelayanan, dan
kecepatan.

Jadi Rekayasa ulang proses bisnis merupakan suatu langkah perbaikan proses bisnis
yang sudah ada dengan tujuan untuk mendapatkan proses bisnis baru yang lebih baik sesuai
dengan tujuan dari perusahaan atau organisasi. Jadi, dengan adanya rekayasa ulang proses
bisnis ini dapat meningkatkan kepuasan konsumen, harga dan kualitas dari produk yang
sesuai, peningkatan kualitas informasi dan sumber daya manusia serta teknologi yang
mengikuti perkembangan zaman pada saat itu. Definisi rekayasa ulang ini memuat empat
kata kunci, yaitu:

1. Process, yaitu serangkaian aktivitas yang mengubah masukan menjadi keluaran.


Terdapat tiga aktivitas dalam proses yaitu:
Value-adding activities -> aktivitas untuk menghasilkan nilai tambah.
Hand-off activities -> Aktivitas yang memindahkan aliran kerja dengan
melewati hambatan-hambatan fungsional, departemental atau organisasional.
Control activities -> aktivitas yang tercipta untuk mengendalikan Hand-off
activities.
2. Strategik and value added. Target utama rekayasa ulang proses bisnis adalah stratgei
dan nilai tambah. Untuk memaksimalkan tingkat pengembalian investasi dalam
rekayasa ulang, perusahaan mulai memfokuskan pada proses yang terpenting dalam
perusahaan, yaitu tidak hanya strategi dan nilai tambah tetapi keseluruhan system,
kebijakan dan struktur organisasi yang mendukung proses.

49
3. Optimization of work flow and productivity in organization, yaitu meningkatkan
produktivitas, pangsa pasar, pendapatan, tingkat pengembalian investasi dan asset.
Rekayasa ulang proses bisnis dapat diukur dari pengurangan biaya per unit.
4. Rapid, radical and redesign. Rekayasa ulang harus dilaksanakan secara cepat dan
radikal serta merancang kembali proses bisnis untuk menghilangkan aktivitas yang
tidak perlu.

Tujuan rekayasa ulang proses bisnis adalah perbaikan proses untuk meningktkan
kepuasan total baik bagi pelanggan internal maupun pelanggan eksternal. Tujuan rekayasa
ulang proses bisnis menurut Andrews dan Stalick (1994 : 8) adalah sebagai berikut:

1. Meningktkan kemampuan organisasi dalam menghasilkan barang atau jasa


yang khusus serta mempertahankan produksi masal.
2. Meningktkan kepuasan atas barang atau jasa sehingga pelanggan akan memilih
barang atau jasa perusahaan daripada perusahaan pesaing.
3. Membuat lebih mudah dan menyenangkan bagi pelanggan untuk melakukan
bisnis dengan perusahaan.
4. Memutuskan batasan organisasional, membawa pelanggan kepada saluran
informasi melalui komunikasi, jaringan dan teknologi komputer.
5. Mempercepat waktu respon kepada pelanggan, mengeleminasi kesalahan dan
ketidak puasan, serta mengurangi pengembangan barang atau jasa dalam waktu
siklus pabrik.
6. Memproses permintaan pelanggan yang lebih dan peningkatan volume dari
setiap pelanggan serta menetapkan harga value-driven untuk pelanggan tanpa
mengurangi profitabilitas.
7. Memperbaiki kualitas kerja dan kemampuan individu dalam memberikan
kontribusi pada perusahaan dan,
8. Memperbaiki pembagian dan kegunaan pengetahuan organisasi sehingga
organisasi tidak tergantung pada keahlian beberapa orang saja.

Pendapat lain mengatakan rekayasaulangproses


bisnisbertujuanuntukmencapaihasilyangefektifdalam
empatfaktorkunci(Tan,VictorS.L.,1994), yaitu :
1. Memaksimalkanprosesbernilaitambah.

50
2. Mengurangiwaktusiklusdarialurproses.
3. Memaksimalkanfleksibilitas.
4. Memenuhikebutuhankonsumen.

Karakteristik Rekayasa Ulang Proses Bisnis

Karakteristik dari rekayasa ulang proses bisnis adalah :

1. Rekayasa ulang harus dilakukan secara cepat.


2. Rekayasa ulang merupakan perubahan yang radikal terhadap proses bisnis.
3. Rekayasa ulang merencanakan ulang prose dengan focus pada identifikasi dan
perbaiukan aktivitas yang memberikan nilai tambah serta mencoba
menghilangkan semua aktivitas lainnya.

Menurut Hammer dan Champy, pada suatu proses bisnis yang telah direkayasa ulang
akan mungkin memiliki karakteristik sebagai berikut :

1. beberapa pekerjaan digabung menjadi satu (Several jobs are combine into one)
Beberapa proses pada proses bisnis yang lama setelah dilakukan rekayasa ulang hanya
akan menjadi sebuah proses yang telah mencakup kesemua fungsi dari beberapa
proses yang terdapat pada proses bisnis yang lama.
2. Para pekerja membuat keputusan (Worker make decision)
Ada kalanya proses bisnis yang telah mengalami rekayasa ulang, bukan pimpinan lagi
( pihak management ) yang melakukan pengambilan keputusan, melainkan pekerja
yang melaksanakan proses bisnis tersebut yang langsung dapat melakukan
pengambilan keputusan.
3. Tahap dalam proses dilakukan menurut kebiasaan (The steps in the process are
performed in natural order)
Tahap pengerjaan pada suatu proses bisnis, benar benar dikerjakan sesuai dengan
urutannya, tanpa harus menunggu proses lain yang seharusnya tidak perlu ditunggu.
4. Proses memiliki banyak variasi (Process have multiple versions)
Suatu proses bisnis bisa mempunyai beberapa versi, artinya proses bisnis yang bisa
dijalankan adalah proses bisnis untuk menangani kejadian kejadian umum, tetapi
apabila ada suatu kejadian khusus, maka ada proses bisnis lain yang mempunyai

51
tujuan sama, tetapi lebih spesifik tahap pengerjaan untuk menanggulangi kejadian
khusus ini.
5. Pekerjaan dialukan pada tempat yang paling berarti (Work is performed where it
make the most sense)
Pekerjaan benar benar dilakukan pada tempat atau waktu yang sesuai, sebagai
contoh jika melakukan pemesanan barang, bukan dilakukan pada bagian pemesanan
barang di perusahaan, tetapi benar benar langsung memesan pada produsen atau
toko yang mungkin dilakukan dengan menggunakan credit card perusahaan. Hal ini
jelas pemesanan barang lebih sesuai dilakukan pada produsen atau toko tempat barang
dijual, bukan pada bagian pemesanan barang, yang nantinya akan memesan lagi
barang tersebut ke produsen atau toko.
6. Pemeriksaan dan control yang berkurang (Checks and controls are reduced)
Beberapa pemeriksaaan dan kontrol dimana biaya kontrolnya lebih besar dari pada
biaya perbaikan apabila suatu ancaman terjadi lebih baik dihilangkan.
7. Rujukan minimum (Reconciliation is minimized)
Pencocokan berkas berkas yang dirasa tidak perlu diminimalisasi sekecil mungkin,
sebagai contoh pada proses procurement yang dulunya dilakukan pencocokan tiga
berkas (purchase order, receiving report, invoice) hanya menjadi dua berkas (purchase
order dan invoice ) dimana saat barang diterima langsung dilakukan pencocokan
antara invoice yang dibawa bersama barang dengan purchase order.
8. Manajer kasus membuat satu titik kontak (A case manager provides a single point of
contact (for customers))
Pada proses bisnis yang telah mengalami rekayasa ulang, di buatnya suatu proses baru
dimana setiap proses yang lain melaporkan pada proses ini status dari masing masing
proses, sebagai contoh yaitu proses bisnis permohonan kredit, yang melalui banyak
tahap pemeriksaan kelayakan, pada setiap tahap setelah selesai dari tahap tersebut
wajib melaporkan pada suatu proses sehingga apabila seorang pelanggan menanyakan
permohonan kreditnya, maka proses ini yang disebut juga customer service
representative dapat menjawab pertanyaan pelanggan ini, karena ia mengetahui semua
keadaan proses didalam proses bisnis tersebut.
9. Hybrid centralized/decentralized operations are prevalent
Yang dimaksud dengan pelaksanaan suatu proses bisnis Hybrid
centralized/decentralized operations are prevalentadalah pelaksanaan proses bisnis
yang bisa mengambil beberapa tempat berbeda (decentralized) tetapi data yang
52
terkumpul tetap terpadu pada sebuah database dipusat yang bidang diakses dari
manapun (centralized). Hal ini sangat membantu dalam pelaksanaan proses bisnis itu
mencakup wilayah yang luas dan juga memiliki respon time yang cepat, tentu saja hal
ini dibantu oleh adanya teknologi masa kini.
10. Process without added value aree limited
Proses proses yang tidak memberikan nilai tambah dihilangkan pada suatu proses
bisnis.

Kesepuluh karakteristik diatas bisa aja dilihat secara bersamaan pada suatu proses
bisnis yang telah mengalami rekayasa ulang, tetapi bisa juga tidak ada satupun yang terlihat,
ini tentu saja dikarenakan situasi dan kondisi suatu proses bisnis tersebut itu sendiri yang
tidak memungkinkan untuk direkayasa ulang sesuai dengan ciri-ciri diatas.

Prinsip dan tahapan Rekayasa Ulang Proses Bisnis

Dengan memperhatikan karakteristik rekayasa ulang proses bisnis tersebut diatas,


maka dalam melakukan rekayasa ulang proses bisnis harus berlandaskan padabeberapa
prinsip rekayasa ulang proses bisnis, yang terdiri atas:

1. Mengorganisasikan hasil dari seluruh langkah dalam proses, bukan satu langkah saja
2. Orang yang mengusulkan disain proses baru tersebut harus bisa melakukannya
dengan tepat
3. Pekerjaan dalam memproses inromasi diusahakan menjadi kerja nyata yang
menghasilkan informasi akurat yang dibutuhkan
4. Sumber-sumber produksi yang letaknya menyebar harus dibuat agar seolah-olah
disentralisasikan
5. Lebih menghubungkan aktivitas parallel daripada mengintegrasikan hasilnya
6. Meletakkan titik keputusan di mana pekerjaan tersebut dilakukan, dan menentukan
kontrol atas proses tersebut dan
7. Menerima informasi satu kali saja daripada menerima informasi berulang kali.

Tahapan dasar dalam rekayasa ulang proses bisnis terdiri dari 3R, yaitu:

1. Rethink, Memikirkan kembali tujuan yang akan dicapai saat sekarang dengan
asumsi yang diperlukan untuk menentukan apakah tujuan tersebut masih bisa

53
digunakan pada komitmen yang baru untuk memenuhi kepuasan pelanggan di
waktu yang akan datang.
2. Redesign, Mencakup analisis tentang cara organisasi dalam pemproduksi
barang atay jasa, bagaimana struktur kerjanya, siapa yang menyelesaikan
suatu tugas tertentu dan apa hasil yang dicapai dari masing-masing prosedur
tersebut.
3. Retool, Mencakup evaluasi tentang keuntungan atau manfaat yang diperoleh
dari teknologi mutakhir yang digunakan khususnya pada electronic word and
data processing system untuk menentukan kemungkinan merubah teknologi
tersebut agar kualitas meningkat.

Apabila perusahaan telah menentukan bahwa suatu proses tidak efektif dan efisien
maka perusahaan harus merancang kembali proses baru dengan langkah-langkah sebagai
berikut:

a) menentukan tujuan bisnis dan proses;


b) menentukan proses mana yang akan diubah/diperbaiki
c) memahami dan mengukur proses yang lama tersebut
d) menentukan tingkat informasi teknologi yang dibutuhkan dan
e) merancang dan membuat suatu model mengenai proses yang baru.

Menurut Manganelli dan Klein (1994 : 30) metodologi rekayasa ulang proses bisnis
meliputi lima tahap, yaitu :

1) Persiapan. Tahap ini dimulai dengan pengembangan dari persetujuan bersama yang
telah disepakati oleh eksekutif pada terobosan tujuan dan sasaran, yang mewakili
maksud untuk keberadaan organisasi serta proyek rekayasa ulang. Persiapan
membentuk hubungan yang utama antara tujuan bisnis dan kinerja proses rekayasa
ulang, dan mendefinisikan parameter proyek yang menyangkut jadwal, biaya, resiko
dan perubahan organisasional. Pada tahap ini, teknik manajemen mengidentifikasikan
penetapan tujuan, fasilitasi, kelompok membangun, motivasi, manajemen perubahan,
taksiran sendiri, taksiran lingkungan dan manajemen proyek.
2) Identifikasi. Tahap ini mengembangkan model bisnis yang berorientasi pelanggan,
mengidentifikasi proses strategi nilai tambah, dan peta organisasi, sumber daya dan
volume untuk proses yang spesifik dan prioritas, serta merekomendasikan proses
spesifik sebagai akibat target rekayasa ulang yang tertinggi. Teknik manajemen yang

54
digunakan adalah model pelanggan, pengukuran kinerja dan analisis waktu siklus,
proses model, integrasi pemasok dan program kerja sama, ananlisis alur kerja, peta
organisasional, analisis biaya berdasarkan kegiatan, manajemen perubahan dan
fasilitasi.
3) Visi. Melihat peluang terobosan bisnis, analisis dan struktur sebagai visi dari
perubahan radikal. Teknik manajemen yang digunakan adalah: ananlisis alur kerja,
analisis proses nilai, benchmarking, manajemen perubahan, manajemen proyek dan
fasilitasi.
4) Pemecahan / solusi. Tahap ini dibagi dua, yaitu :
a) Rancangan Teknis: Tujuan tahap ini adalah untuk menetapkan dimensi teknis
dari proses yang baru. Spesifikasi ini akan menghasilkan deskripsi tentang
teknologi, standar prosedur, system dan kontrol bagi karyawan, perancangan
interaksi elemen social dan teknik, persiapan perencanaan untuk pengembangan,
perolehan, fasilitas, pengujian, konversi dan penyebaran. Teknik manajemen
yang digunakan adalah analisis alur kerja, informasi teknik mesin, pengukuran
kerja, strategik otomatisasi, manajemen perubahan, manajemen proyek dan
fasilitasi.
b) Rancangan Sosial: Tujuannya untuk menetapkan dimensi social proses bisnis
yang baru. Tahap ini menghasilkan gambaran tentang organisasi, staf, pekerjaan,
jalur karir, insentif bagi karyawan, perancangan interaksi elemen teknik dan
social, dan perencanaan awal untuk perekrutan, pendidikan dan pelatihan,
organisasi ulang dan penyebaran ulang. Teknik manajemen yang digunakan
adalah kekuasaan karyawan, acuan keahlian, kelompok membangun, mengatur
ulang organisasional, danpeta organisasional, pekerjaan produksi, broadbanding,
manajemen perubahan, manajemen proyek, fasilitasi, penghargaan karyawan dan
insentif.
5) Transformasi. Tahap ini bertujuan untuk mewujudkan visi proses rekayasa ulang.
Tahap ini adalah tahap akhir untuk melakukan implementasi pada perencanaan
proses. Teknik manajemen yang digunakan adalah proses model, informasi teknik
mesin, acuan keahlian, kelompok membangun, perbaikan terus-menerus, pengukuran
kinerja, manajemen perubahan, manajemen proyek dan fasilitasi.

Sedangkan menurut Victor SL Tan,penerapan suatu rekayasa ulang prose bisnis perlu
memiliki metode yang terdiri atas beberapa tahapan yaitu:

55
a) memahami proses yang sedang berlangsung.
Langkah pertama adalah mendokumentasikan alur proses bisnis yang terjadi saat ini
dengan memetakan interaksi saat ini, sampai dengan memetakan interaksi dari unit unit
yang melakukan proses dalam level organisasi. Alur proses dapat menggambarkan
hubungan masukan dan keluaran antara supplier, unit organisasi, dan pelanggan.
b) mencari titik lemah proses saat ini.
Tahapan ini merupakan tahap kritis dimana penerimaan asumsi terdahulu akan
dipertanyakan.
c) menyelidiki alternatif rencana ulang,.
Pencarian proses revolusioner yang dapat memberikan peningkatan performa secara
signifikan memerluka pendekatan yang kreatif. Hal ini berarti melanggar dan
mengabaikan model kuno, peraturan dan perintah yang berlaku. Kecuali kalau perusahaan
meninggalkan paradigma lama, proses baru akan dengan sederhana memberikan
peningkatan perbaikan terhadap proses kerja normal. Dalam melakukan alternatif, harus
dilakukan usaha untuk menilai apakah proses kerja saat ini dapat dirancang secara
berbeda. Pengaruh proses baru dapat dinilai sebagai alternative yang diusulkan.
d) mencari informasi yang diperlukan untuk mendukung proses rekayasa ulang.
Informasi merupakan kunci dalam menjalankan fungsi pada proses baru. Maka ssangat
penting untuk menguji perubahan informasi yang diperlukan untuk mendukung proses
baru.
e) melakukan tes kelayakan terhadap rancangan proses baru.
Langkah akhir dari proses rekayasa ulang proses bisnis adalah mengidentifikasi sumber
tambahan seperti sumber daya manusia dan sumber daya keuangan. Hal ini diperlukan
untuk memastikan keberhasilan proses baru.

Melakukan BPR, Kesalahan dan Keberhasilan BPR

Menurut Robert Quinn, perusahaan harus melakukan Rekayasa Ulang Proses


Bisnisnya bila sudah muncul apa yang disebut Deep Change. Ada 4 (empat) karakteristik
yang diurai oleh Robert Quinn dalam tubuh perusahaan, yaitu Pervasiveness, Burnout, Thirst
for Vision, dan Violation of Trust (www.personal.umich.edu) bisa dijadikan pedoman untuk
melakukan deep change. Keempatnya terjadi bila perubahan tersebut tidak dikomunikasikan
secara benar, dan ini menuntut peran dari leader perusahaan tersebut. Setiap lapisan level

56
management, dari level teratas kemudian turun ke lapisan bawah berikutnya dan sampai
kepada semua karyawan dalam perusahaan harus memahami perubahan itu.

Empat karakteristik yang menjadi tanda bagi perusahaan untuk malakukan tindakan
rekayasan ulang bisnis proses

Pervasiveness berarti karyawan relative pasif, dan membiarkan perubahan itu terjadi,
dan menganggap itu bukan dari bagiannya.
Thirst for Vision berarti karyawan mencari-cari arah dari perubahan itu, bila
perubahan tidak diinformasikan secara jelas, maka karyawan akan bimbang dan
mencari arahan, sangat buruk bila arahan yang diterima justru berlawanan arah.
Violation of Trust justru terjadi pada sisi leader, leader yang tidak memahami dan
tidak sepakat biasanya menyalah gunakan kepercayaan dan kemudian mengingkari
tanggung jawab yang diembannya.
Burnout, merupakan gambaran dimana karyawan bingung dan gelisah, karena
merespon setiap perubahan namun responnya seakan-akan tanpa hasil karena tidak
adanya ukuran yang memadai untuk menilai kinerja mereka atas perubahan yang
terjadi.

Bila keempat karakteristik tersebut muncul dan menjadi ciri dalam sebuah
perusahaan, maka pilihannya hanya ada dua, yaitu melakukan rekayasa ulang bisnis proses,
atau mati pelan-pelan. Dan ketika memilih harus berubah, waspadai berbagai penyebab
kegagalannya.

Hal-hal yang berkaitan dengan implementasi rekayasa ulang dari proses bisnis adalah
sebagai berikut:

1. Identifikasi proses

Hal-hal yang perlu dipertimbangkan dalam melakukan identifikasi proses :


Seringkali proses tersebut tidak jelas terlihat karena terpilah-pilah oleh struktur organisasi.
Oleh karena itu diperlukan suatu nama untuk mengidentifikasi setiap proses. Identifikasi yang
diberikan oleh Joe peppard & Philips Roland (1995) dengan menggunakan peta proses
produksi manufaktur dan system informasi (batas pekerjaan). Peta proses memberikan
gambaran yang menyeluruh dari mulai input sampai dengan output, sehingga dapat diperoleh

57
gambaran aktivitas yang memberikan/tidak memberikan kontribusi pada hasil. Dibawah ini
diuraikan keuntungan dan kerugian dari pemetaan proses :
Keuntungan :
Memberikan gambaran yang lebih jelas dari pernyataan, sehingga diidentifikasi
daerah yang harus ditingkatkan kinerjanya.
Dalam pembentukan peta personal yang terlibat akan paham masalah dari masing-
masing aktivitas dan kontribusi yang dihasilkan.
Kerugian :
Diperlukan peta yang memberikan kemudahan dari pelaksana operasi, hal ini
perludiperhatikan bila pemetaan dilakukan oleh staf pusat atau konsultan.
Keterpakuan pada peta proses, sehingga mengganggu keluwesan dari proses
yangdigunakan untuk proses yang unik.

Hal-hal yang perlu tercantum pada peta proses adalah sebagai berikut :
Waktu tunda dari masing-masing aktivitas
Ketergantungan dari aktivitas
Siapa yang bertanggung jawab pada aktivitas
Permasalahan dari masing-masing aktivitas
Nilai tambah dari masing-masing proses, atau yang berkaitan dengan biaya yang
dihasilkandari masing-masing aktivitas

2. Pemahaman proses
Setelah mengidentifikasi proses yang ada dalam perusahaan perlu adanya perhatian pada
pemahaman proses pemenuhan kebutuhan pelanggan. Oleh karena itu pelanggan tidak perlu
dianalisa pada proses yang telah ada. Seperti yang telah disebutkan sebelumnya rekayasa
ulang dari proses bisnis harus dimulai dari komitmen maka diperlukan pernyataan yang
memberikan alasan mengapa rekayasa ulang dilaksanakan secara singkat dan persuasif.

Sejarah mencatat bahwa tidak semua rekayasa ulang perusahaan berhasil baik, bisa
juga gagal. Michael Hammer dan James Champy dalam bukunya Reengineering The
Corporation: A Manifesto For Business Revolution terbitan Gramedia mendaftar berbagai
alasan mengapa banyak perusahaan gagal dalam melakukan rekasaya ulang bisnis prosesnya,
yaitu:

58
Mencoba memperbaiki proses bukan merubahnya.
Tidak menitikberatkan pada proses-proses bisnis.
Mengabaikan semua hal kecuali perancangan ulang proses.
Menolak nilai-nila dan keyakinan-keyakinan orang
Puas memperoleh hasil-hasil kecil.
Begitu cepat menyerah.
Terlebih dulu menetapkan batasan-batasan definisi masalah dan jangkauan usaha
rekayasa ulang.
Memungkinkan budaya-budaya dan sikap manajemen yang ada untuk mencegah
rekayasa ulang dari awal mulanya.
Berusaha melaksanakan rekayasa ulang dari bawah ke atas.
Menunjuk seseorang yang tidak mengerti rekayasa ulang untuk memimpin upaya
tersebut.
Setengah-setengah dalam menyediakan sumber daya untuk rekayasa ulang.
Mengukur rekayasa ulang ditengah agenda perusahaan.
Menghambur-hamburkan energi untuk sejumlah besar proyek rekayasa ulang. 14.
Mengusahakan rekayasa ulang saat CEO kurang dua tahun lagi pension.
Gagal membedakan antara rekayasa ulang dengan program-program peningkatan
bisnis lain.
Secara ekslusif berkonsentrasi pada perancangan.
Berusaha melakukan rekayasa ulang tanpa menyakiti hati siapapun.
Mundur jika orang-orang menolak melakukan rekayasa ulang.
Mengulur-ulur rekayasa ulang.

Seluruh sumber kegagalan tersebut memang sungguh kontras dengan definisi dari
rekayasa ulang bisnis proses. Ada beberapa kata kunci didalam definisi rekayasa ulang bisnis
proses tersebut, yaitu fundamental, radikal, dramatis. Kata fundamental berarti mendasar
sehingga berbagai alasan kegagalan seperti daftar diatas banyak yang disebabkan karena
rekayasa ulang tidak dilakukan secara mendasar.Kata radikal berarti dilakukan cepat dan
mengabaikan banyak pertimbangan yang biasanya pertimbangan tersebut adalah kekawatiran,
dan keinginan untuk tidak rock the boat. Dramatis menjelaskan bahwa hasil yang dicapai jauh
berbeda dibandingkan dengan perbaikan-perbaikan biasa.

59
Pendapat lain mengatakan, Terdapat beberapa sebab atau upaya rekayasa ulang dapat
gagal. Berikut adalah berbagai perangkap yang harus dihindari :

Penggunaan yang tidak tepat


Kurangnya visi
Tim rekayasa ulang yang tidak efektif
Pemberdayaan yang tidak tepat
Rasionalisasi proses
Mengandalkan semata-mata pada teknologi informasi
Menggunakan batasan geografis dan organisasional untuk mengatasi perubahan
Gagal memahami proses rekayasa ulang dan implementasinya

Tom Watson mengatakan, Jika Anda ingin menjadi perusahaan yang terbaik, Anda harus
mulai bertindak seperti perusahaan yang terbaik sekarang juga. Berikut adalah beberapa
pedoman untuk sukses dalam rekayasa ulang sehingga dapat berhasil :

Berpikir secara luas, berani, dan terbuka.


Memandang proses di seluruh organisasi.
Menantang semua doktrin dan proses tradisional dan menciptakan yang baru.
Menetapkan hasil yang diinginkan. Organisasikan segala upaya Anda dengan
memandang setiap hasil yang diinginkan sebagai suatu proses yang kontinyu
ketimbang menganalisis tiap departemen, fungsi, atau tugas.
Menghubungkan berbagai aktivitas dalam proses yang bersamaan, bukan dalam tugas
yang berurut. Pastikan setiap aktivitas dilakukan dalam tata cara yang wajar.
Memandang setiap lokasi organisasi sebagai suatu kesatuan tunggal; menggabungkan
semua lokasi secara logis menurut cara yang sama dalam menjalankan bisnis.
Berdayakan karyawan untuk membuat keputusan yang berkenaan dengan pelanggan
dan proses yang mereka hadapi.
Pusatkan perhatian pada nilai yang berasal dari setiap proses (kontribusi proses pada
nilai pemegang saham dan keunggulan kompetitif), bukan pada tugas perorangan
yang membentuk proses tersebut.
Pergunakan teknologi untuk memungkinkan suatu proses, untuk mengharmoniskan
pekerjaan serta untuk meningkatkan nilai dan kinerja.
Bertindaklah pada keputusan dan masalah yang sulit. Atasilah hal-hal yang sulit itu.

60
Ciptakan tim lintas fungsi yang terdiri dari orang-orang dari tingkat yang tepat da
mempunyai ketrampilan yang sesuai. Gunakan sumber daya eksternal seperti
konsultan.
Realistislah terhadap besarnya upaya. Rekayasa ulang itu sulit, radikal, dan sangat
berarti.

Jenis-Jenis Perubahan
Tujuan dari perubahan adalah mempertahankan kehidupan. Berubah juga dapat diartikan
sebagai adaptasi, menyesuaikan diri, dan menjadi lebih berdaya untuk mempertahankan dan
meneruskan kehidupan.

Teknologi informasi dapat mendukung berbagai tingkatan perubahan dalam


perusahaan. Empat macam perubahan struktural organisasi yang disebabkan oleh teknolog
informasi ialah:

1. Otomatisasi
Adalah Bentuk paling umum dari perubahan organisasional yang dimungkinkan oleh
teknolog informasi. Penerapan pertama dari teknologi informasi antara lain adalah
membantu para karyawan melakukan tugas-tugas mereka secara lebih efisien dan
efektif.
2. Rasionalisasi,
Adalah Bentuk perubahan organisasional yang lebih mendalam yang langsung
mengikut otomatisasi awal. Rasionalisasi prosedur adalah pemangkasan prosedur-
prosedur operasional standar.
3. Rekayasa ulang,
Bentuk perubahan organisasional yang lebih kuat adalah rekayasa ulang proses
bisnis,yang melalui nya, proses-proses bisnis dianalisis, disederhanakan, dan
dirancang ulang. Rekayasa ulang bisnis menata ulang aliran-aliran kerja,
menggabungkan langkah-langkah untuk mengurangi limbah dan mengeliminasi
tugas-tugas yang banyak menggunakan kertas dan sifatnya repetitive (kadang-kadang
rancangan yang baru juga menghilangkan beberapa pekerjaan).
4. Pergeseran paradigma setiapnya membawa imbalan dan resiko yang berbeda-beda.
pergeseran paradigm adalah Perubahan bisnis yang lebih yang lebih radikal.

61
Selain itu jenis jenis perubahan juga terbagi dua. Perubahan operasional adalah
perubahan-perubahan kecil bersifat parsial dan tidak menimbulkan dampak luar biasa bagi
divisi dan unit-unit lainnya dalam perusahaan. Misalnya perubahan kemasan produk,
perubahan seragam karyawan dan lain-lain.
Perubahan strategis adalah perubahan yang berdampak luas dan memerlukan
koordinasi dan dukungan dari semua komponen perusahaan. Jenis perubahan strategis yaitu
diantaranya: perubahan budaya dan nilai-nilai dasar perusahaan, perubahan arah/fokus bisnis,
perubahan cara kerja.
Dalam perubahan strategis ada perubahan visi kepemimpinan yang memerlukan
perubahan empat komponen utama (McCann, 1991), yaitu:
teknologi,
produk atau jasa,
strategi serta struktur,
budaya perusahaan.
Perubahan strategis diperlukan karena adanya perubahan lingkungan eksternal,
termasuk lingkungan internasional yang harus diantisipasi untuk memenangkan persaingan
pasar yang kompetitif.
Perubahan teknologi berarti perubahan proses produksi, keterampilan, basis
pengetahuan, agar produksi lebih efisien dan produk lebih cepat dihasilkan dalam volume
besar. Tetapi, bisa juga dihasilkan produk baru untuk pasar yang benar-benar berbeda. Ini
bisa diikuti dengan perubahan domain administrasi, sistem penggajian, struktur, dan nilai-
nilai korporat. Singkatnya, dalam perubahan strategis, Anda tidak bisa mengisolir perubahan
pada satu komponen saja. Satu komponen diubah maka semua aspek akan ikut berubah.
Dengan demikian jelas bahwa ada perubahan yang sifatnya mendasar, dan ada pula
sekedar tampak dari luar. Perubahan strategis harus tampak secara kasat mata dalam
perubahan operasional. Namun, belum tentu seseorang melakukan perubahan operasional
berhasil meyentuh aspek strategisnya. Perubahan strategis membutuhkan konsep dan seni
yang kuat dan dilakukan secara bertahap. Perubahan ini akhirnya akan tampak pada sikap
manusia yang menjalankannya, bukan pada benda-benda yang mudah diganti.

PERUBAHAN RADIKAL DAN PERUBAHAN INKREMENTAL


Menurut Daft (2004), Perubahan strategis cenderung radikal atau revolusioner, dan
perubahan operasional dinilai tak ubahnya sebagai perubahan inkremental atau gradual.

62
Perubahan radikal cenderung mengubah referensi, arah, dan kebijakan organisasi.
Biasanya perubahan ini mentransformasi seluruh bagian institusi, misalnya perubahan
struktur organisasi dari vertikal-horizontal menjadi matrix dan horizontal tim kerja.
Perubahan ini melibatkan lahirnya suatu terobosan berupa struktur yang benar-benar baru
dengan prose bisnis yang berbeda. Business Process Reengineering dalam Total Quality
Management, yaitu rekayasa ulang proses bisnis dilakukan secara fundamental, radikal,
dramatis, dan rapid untuk mendapatkanperbaikan kinerja perusahaan yang mencakup
menekan biaya, dan meningkatkan kualitas, penyerahan, pelayanan serta kecepatan untuk
menigkatkan daya saing perusahaan.
Perubahan inkremental adalah perubahan secara kontinu untuk memelihara
keseimbangan umum organisasi. Biasanya perubahan ini dilakukan hanya terbatas pada salah
satu bagian organisasi dan dampaknya relatif kecil. Misalnya, perbaikan mesin dan
pergantian mesin. Perubahan inkremental ini sama, tapi berbeda dengan Total Quality
Management. Persamaannya adalah perbaikan dialkuakn secara kontinu, sedangkan
perbedaannya dilakukan secara total, yaitu pada semua orang, semua fungsi manajemen dan
semua proses. Perbedaan perubahan inkremental dan radikal dikemukakan dalam gambar
berikut.

PERUBAHAN PERUBAHAN

INKREMENTAL RADIKAL

Untuk keseimbangan Mengubah Paradigma

Umum Organisasi dan mendasar

Mengubah Transformasi

Bagian Kecil Seluruhnya

Melaui Struktur & Proses Melalui Penciptaan Struktur

Manajemen Biasa & Manajemen Baru

Perbaikan / Penyempurnaan Terobosan (Breakthrough)

63
Teknologi Teknologi

Penemuan Produk Baru


Perbaikan Produk
Atau Pasar Baru

Sumber : Alan D. Meyer, James B. Goes dan Geoffrey R Brooks, Organization in


Disequilibirium: Environmental Jolts and Industry Revolution, dalam George
Huber dan William H., Glick eds. Organizational Change and Redesign.

PERUBAHAN KASAT MATA DAN MOSAIK


Adakalanya suatu perubahan dapat dengan mudah dilihat dan dibaca dengan kasat
mata. Perubahan yang terjadi secara kontras, bersifat lokal, dan dimuat di media massa dari
suatu kejadian dapat dikategorikan sebagai perubahan kasat mata. Demikian juga dengan
perubahan operasional yang tampak dari kegiatan fisik di pabrik, lobi hotel atau ruang
pelayanan jasa, penurunan penjualan atau serangan kompetitor di depan mata.
Dalam kehidupan ditemui perubahan yang tidak dapat dilihat secara kasat mata.
Seringkali untuk melihat perubahan ini diperlukan pihak ketiga yang bertindak
mengumpulkan mosaik yang terpisah dan dianalisis terhadap kecendrungan yang terjadi di
tempat yang terpisah-pisah dengan rentang waktu yang berjauhan, misalnya karya John
Naisbitt. Krisis ekonomi di Indonesia pada tahun 1997-2000, tidak dapat dibaca dan
dianalisis secara parsial, tetapi dengan mengumpulkan mosaik yang terpisah-pisah dan
dianalisis oleh tenaga ahli.

PEMBAHARUAN PERUSAHAAN
Marilah kita kembali ke dataran Mikro, yaitu perubahan yang terjadi dalam unit
usaha. Menurut Platt (1998) perubahan strategis suatu perusahaan dilakukan dalam 3
kategori, yaitu: transformasi manajemen, manajemen turnaround, dan manajemen krisis.
a. Transformasi Manajemen.
Biasanya dilakukan oleh perusahaan yang sehat yaitu perusahaan yang menangkap
adanya signal yang kurang menguntungkan. Pada saat seperti ini, perusahaan
mengajukan dua pertanyaan, yaitu:
Hal hal yang tidak patut apa yang telah dilakukan?
Hal-hal apa yang mampu membuat kita menjadi lebih baik?

64
Pada Sigmoid Curve (gambar pada halaman 7), transformasi dilakukan ketika
perusahaan sedang berada di titik A. Tujuannya agar perusahaan bisa bergerak
mulus menuju ek titik C mengikuti alur kurva pertama, atau pindah ke kurva kedua
(titik C1). Transformasi perlu dilakukan untuk mencegah agar jangan sampai
perusahaan bergerak alamiah menuju titik B1 atau B yang artinya menuju
kemunduran.
b. Manajemen Turnaround.
Hal ini biasanya dilakukan bila perusahaan menghadapi masalah yang pelik dan
melibatkan pihak-pihak yang lebih luas. Namun, pada tahapan ini, perusahaan
masih mempunyai sumber daya (pada sisi aset) dan tersedia waktu untuk
melakukan manuver perbaikan. Misalnya, perusahaan masih bisa memperbaiki
kinerja karena masih memiliki produk unggulan, reputasi baik dan ada aset yang
kurang produktif sebagai contoh, perubahan bentuk turnaround yang dilakukan oleh
Abdul gani sebagi direktur utama garuda Indonesia (1998). Latar belakang masalah
yang dihadapi adalah sebagai berikut;
Masalah Keuangan:
Kegiatan bisnis yang merugi.
Cashflow operasi yang negatif.
Kewajiban-kewajiban yang jatuh tempo sebesar $ 1,8 juta.
Net worth negatif $ 234 juta.
Sistem Informasi Manajemen yang tidak dapat dikendalikan.
Masalah Operasional
Rute-rute yang diterbangi sebagian besar tidak menguntungkan.
Terlalu banyak jenis pesawat
Utilisasi pesawat rendah
Ketepatan waktu buruk, yield rendah.
Masalah Manajemen
Manajemen tidak solid dan tidak efektif
Budaya perusahaan tidak mendukung strategi (tidak fit dengan kebutuhan).
Produktivitas rendah.
c. Manajemen Krisis.
Biasanya dilakukan kalau perusahaan sudah memasuki masa krisis, yaitu saat
perusahaan mulai kehabisan darah (cashflow) dan energi (reputasi, motivasi). Pada

65
titik ini perusahaan mulai tampak sulit memenuhi kewajiban-kewajiban pembayaran
jangka pendek yang jatuh tempo, mulai dari tagihan para pemasok bahan baku, kredit
jangka pendek, sampai gaji karyawan. Pada tahap ini perusahaan sudah benar-benar
berada pada posisi berbahaya dan eksistensinya diragukan. Berikut ciri-ciri
perusahaan yang berada dalam krisis:
Keadaan fisik : Tak terurus,, lampu redup, toilet kotor, seragam petugas lama
tak terganti, mobil tua, pabrik bekerja dibawah titik optimal.
SDM : Malas, datang dan pilang seenaknya, pemimpin jarang hadir,
banyak yang terlihat tidak bekerja dan kongko-kongko.
Tenaga yang bagus-bagus sudah keluar.
Produk andalah : Hampir tidak ada, hanya menyelesaikan yang sudah ada saja.
Banyak retur dan defect
Konflik : Hampir setiap hari terdengar, perasaan resah dimana-mana.
Energi : Hampir tidak ada.
Demo Karyawan : Tinggi, rasa takut kena PHK.
Proses hukum : Meningkat, datang dari mana-mana.
Bag. Keuangan : Hidup dalam suasana stres. Dikejar-kejar tagihan yang tak
terbayar dan oleh debt collector.

Pada Sigmoid Curve, titik ini berada pada B, dimana orang yang tersisa
besar kemungkinan adalah orang-orang lama yang kurang produktif dan perusahaan
nyaris tak punya apa-apa lagi.

66
Ketiga strategi ini menunjukkan keterkaitannya satu sama lain. Pada saat
perusahaan telah memasuki tahap berbahaya, yaitu tahap B, mustahil melakukan
turnaround. Pada tahap ini eksekutif harus menerapkan Manajemen Krisi terlebih
dahulu berupa langkah-langkah penyelamatan strategis. Langkah ini dalam bisnis
sering disebut dengan istilah stop the bleeding atau hentikan pendarahan. Darah
adalah penyambung nyawa yang sangat vital, wujudnya dapat berupa cash flow, nama
baik, dan kepercayaan semua pihak.
Kalau titik B berhasil diatasi, pemimpin baru dapat melakukan langkah-
langkah turnaround seperti perbaikan modal kerja, kualitas produk, restrukturisasi
utang dan sebagainya.
Sebaliknya, perusahaan yang mengalami berbagi persoalan, begitu mencatat
angka kerugian (sekecil apapun), atau bahkan mengalami penurunan pendapatan,
sebaiknya segera mengambil langkah-langkah turnaround. Perusahaan tidak dapat
dikelola dengan cara-cara yang biasa (business as usual) atau melanjutkan cara-cara
kerja normal di masa lalu. Manajer harus melakukan terobosan-terobosan strategis
sebelum perusahaan memasuki tahapan krisis. Kesalahan terbesar seorang eksekutif
biasanya dimulai dengan menyepelekan tanda-tanda kemunduran dengan hanya
melakukan perubahan operasional belaka. Perubahan operasional saja tentu tidak akan
mampu menghasilkan kemajuan-kemajuan strategis.

PERUBAHAN ANTISIPATIF, REAKTIF, DAN KRISIS


Selain jenis-jenis perubahan diatas, Black & Gregersen (2002) membagi strategi
perubahan dalam tiga kategori, yaitu:
1. Perubahan antisipatif, yaitu perubahan sebelum segala sesuatu terjadi yang biasa
digunakan oleh pemimpin pasar untuk mendikte dan menguasai pasar.
2. Perubahan reaktif adalah perubahan yang paling sering digunakan perusahaan sebagai
reaksi atas setiap kejadian dan merespons setiap hal yang baru terjadi. Namun
terkadang kita menunggu tanda-tanda / signal perubahan menjadi sesuatu yang lebih
intens (sering/banyak) sehingga kita merasa jelas dan baru kemudian bertindak. Maka
akan menjadi aneh bila sesuatu telah jelas terjadi namun kita tidak bereaksi sama
sekali. Untuk itu reactive change selalu dibutuhkan.
3. Perubahan krisis, dimana sesuatu yang rutin menjadi kacau, tidak ada keteraturan dan
koordinasi. Orang yang jernih dan berani akan tampil mengambil kesempatan dan
peluang yang tercipta dari adanya krisis, memimpin dan mengembalikan krisis pada
67
keteraturan. Perubahan dalam krisis membutuhkan biaya besar dan energi yang sangat
besar.

Budaya Kualitas dan Budaya Rekayasa Ulang

Budaya kualitas adalah system nilai yang hasilnya kondusif untuk perkembangan
kualitas secara berkelanjutan didalam lingkungan . hal ini mengandung nilai, tradisi, prosedur
dan ekspektasi yang mendukung kualitas. Elemen- elemen yang terdapat di kualitas budaya :
Lingkungan bisnis
Nilai organisasi
Role model budaya
Organizational rites, rituals, dan customs
Cultural transmitters

Sistem nilai pengambilan keputusan dari executive-level seringkali dapat


merefleksikan budaya organisasi . ekspectasi merupakan determinan yang penting. Jika
seorang manajer memperkakukan pegawai dengan trust, dignity, dan respect, maka pegawai
akan memperlakukan sang manajer dengan cara yang sama. Maka akan timbullah sebuah
komitmen.

Perbedaan budaya kualitas dengan Budaya Tradisional ialah sebagai berikut:

Filosofi operasi jangka pendek merupakan alasan oraganisasi tradisional mengalami


turnover yang tinggi. Sedangkan dalam budaya kualitas organisasi, filosofi operasi
yang mendasar adalah customer satisfaction.
Objektif (Short-term vs longterm.)
Pendekatan manajemen (Bosses vs coaches.)
Perilaku terhadap consumer (Focus pada kebutuhan sendiri vs focus pada kostumer.)
Hubungan dengan supplier (Adversial vs partner)
Pendekatan performa-perkembangan. (Memicu masalah vs mengembangkan factor
pengaruh.)

Sebuah strategi jangka panjang yang sukses tidak dapat dirumuskan tanpa terlebih dahulu
memungkinkan sebuah budaya organisasi diarahkan pada keunggulan bisnis. Oleh sebab itu
diperlukan adanya perubahan budaya dalam suatu bsnis dengan melakukan rekayasa ulang

68
proses bisnis. Salah satu manfaat utama yang dibawa oleh keunggulan bisnis adalah
customer-centric, kualitas berfokus efisiensi, menyebabkan pengendalian biaya operasional.
Untuk menanamkan budaya rekayasa ulang diarahkan dari sudut ini:

1. Strategi. Mendefinisikan strategi bisnis diarahkan keunggulan bisnis merupakan


langkah penting dalam proses. Jika Anda memikirkan budaya perusahaan sebagai
proses bisnis, perubahan itu tidak lagi merupakan tantangan bagi tim proses bisnis
rekayasa ulang. Karena budaya perusahaan, pada dasarnya, terdiri dari orang,
kebijakan, dan proses melalui mana semua berinteraksi, budaya sendiri dapat
diasimilasikan dengan proses bisnis yang kompleks.
2. Manajemen perubahan. Keberhasilan pelaksanaan perubahan dan stabilitas jangka
panjang dari pengembangan keunggulan bisnis budaya tergantung pada seberapa baik
manajemen perubahan dijalankan. Dengan perubahan proses yang paling kompleks,
perubahan budaya didasarkan pada analisis proses bisnis, yang hasilnya dapat dibagi
dengan organisasi. Manajemen perubahan yang berhasil melibatkan lapisan
komunikasi: menjelaskan temuan-temuan dari analisis, perubahan yang disarankan,
bagaimana perubahan ini setiap orang akan dampak dan manfaat apa yang akan
membawa perubahan. Manajemen perubahan adalah proses penjualan: juara akan
menjual perubahan ke organisasi yang lebih luas, memastikan dukungan yang sangat
dibutuhkan dan integrasi proses bisnis sukses untuk proses yang baru dirancang:
perusahaan-lebar budaya untuk keunggulan bisnis.
3. Tujuan. Strategi harus tercermin dalam tujuan bisnis, tim, dan individu, untuk
memastikan pelaksanaan yang tepat waktu dari strategi bisnis. Menetapkan tujuan
yang tepat untuk mencerminkan budaya keunggulan bisnis merupakan elemen penting
untuk keberhasilan; di tingkat individu tujuan ini tidak hanya harus dicapai, terukur,
dan relevan, tetapi mereka juga harus masuk akal, untuk melibatkan karyawan dengan
menunjukkan mereka bagaimana kontribusi mereka cemara dalam gambaran besar,
dan bagaimana masing-masing dan setiap satu dari mereka membuat perbedaan.
4. Kinerja. Bisnis proses manajemen untuk proses budaya yang kompleks membutuhkan
manajemen kinerja yang sering melakukan review dan fokus pada kiriman kunci
seperti tercermin oleh KPI dan kinerja individu. Sambil memastikan bahwa KPI yang
memadai ditetapkan untuk setiap kontributor individu, dan bahwa KPI adalah tepat
menangkap kedalaman dan prioritas tujuan organisasi, tim Sigma Bersandar dapat
membantu menentukan apa ini, dan apa nilai-nilai yang perlu dicapai untuk setiap

69
KPI untuk memastikan bahwa tujuan perusahaan tingkat terpenuhi. Dengan kriteria
yang jelas di tempat, manajemen kinerja menjadi seluruhnya data-driven, tak
terbantahkan, konsisten, dan adil, dan umpan balik dapat dibagi sering. Jika
perusahaan sedang mengalami turnaround perusahaan, ketepatan waktu umpan balik
bahkan lebih penting, serta pengakuan berutang kepada yang berkinerja baik.
5. Imbalan. Akhirnya, penghargaan kinerja yang baik akan memastikan keberhasilan
terpengaruh perusahaan dalam mencapai keunggulan bisnis budaya. Hadiah harus
mencocokkan kinerja individu untuk menjamin keunggulan individu, komitmen, dan
keterlibatan, dan mereka harus relevan untuk membuat perbedaan. (I. R., 2010)

70
Daftar Pustaka

Ajeng,2010. Mengelola bisnis jasa-jasa pendukung produk (online)


http://ajengocpoenya.wordpress.com/2010/06/11/mengelola-bisnis-jasa-jasa-pendukung-
produk/

Anonim,2009.business process reengineering (online)


(http://fikainaviany.blogspot.com/2009/03/tugas-ii-fika-inaviany-1416003-mm.html,
diakses 12 maret 2013)

Anonim,2012. Kualitas dalam TQM (Online) (http://fantastic-note.blogspot.com/2012/04/kualitas-


dalam-tqm.html , diakses 14 maret 2013)

Avven.Muhammad,2012. Perkembangan Pemikiran Perkembangan Kualitas TqM: (online)


(http://muhammadavven-belajardesainweb.blogspot.com/2012/01/perkembangan-
pemikiran-perkembangan.html, diakses 14 Maret 2013)

Girl, Lonely 2012.Mengembangkan Sistem (online)


(http://lonelygirl302.blogspot.com/2012/06/mengembangkan-sistem.html, diakses 12
maret 2013)

Sirait, 2008. Total Quality Manajemen.


(online)(http://siraits.files.wordpress.com/2008/01/tqm6.pdfdiakses 12 Maret 2013)

Triatmojo, 2007.pelayanan-publik-dan-konsep-tentang-kepuasan-pelanggan (online)


(http://triatmojo.wordpress.com/2007/01/15/pelayanan-publik-dan-konsep-tentang-kepuasan-
pelanggan/ diakses 12 maret 2013

Vincent, Gaspersz.2011. Total Quality management. : vincharisto Publication

71