Anda di halaman 1dari 25

BAB I

PENDAHULUAN

1.1 Latar Belakang


Bidan adalah ahli dalam menangani kondisi-kondisi normal pada
masa usia subur sekaligus mendeteksi komplikasi yang ada. Dalam upaya
mendeteksi kelainan yang mungkin ada, pengetahuan yang menyeluruh
tentang ruang lingkup mengenai kondisi yang normal mutlak dibutuhkan.
Pengetahuaan tentang tanda dan gejala komlikasi yang sering muncul
memampukan bidan mendeteksi omplikasi yang mungkin ada sehingga
dapat memuali proses diagnosis banding dan konsultasi dokter sedini
mungkin begitu indikasi suatu masalah.

Kehamilan normal biasanya identik dengan amenore dan tidak ada


perdarahan pervagina, tetapi banyak wanita yang mengalami episode
perdaraan pada trimester pertama kehamilan. Darah yang keluar biasaya
segar (merah terang) atau tua (coklat kehitaman). Perdaraan yang terjadi
biasanya ringan, tetapi menetap selama beberapa hari atau secara tiba-tiba
keluar dalam jumlah besar. Dari seluruh wanita hamil yang mengalai
perdarahan pervaginam tanpa nyeri selama pertengahan pertama
kehamilan, hanya sepertiga yang mengalami keguguran spontan.
Kemungkinan perdarahan tersebut adalah kehamilan ektopik,
molahidatidosa

1.2 Rumusan Masalah


1. Apa yang dimaksud dengan kehamilan ektopik terganggu (KET) beserta
penyebab dan mekanismenya ?
2. Bagaimana asuhan kebidanan yang tepat dalam menangani kehamilan
ektopik terganggu (KET) ?

1
3. Apa yang dimaksud dengan kehamilan mola hidatidosa beserta penyebab
dan mekanismenya ?
4. Bagaimana asuhan kebidanan yang tepat dalam menangani kehamilan
mola hidatidosa ?

1.3 Tujuan
1.3.1. Tujuan Umum
Mahasiswa Akademi Kebidanan mampu melakukan asuhan kebidanan
pada kasus kehamilan ektopik terganggu (KET) dan kehamilan mola
hidatidosa.
1.3.2. Tujuan Khusus
1. Mengetahui tentang kehamilan ektopik terganggu (KET) beserta
penyebab dan mekanismenya
2. Agar mahasiswa mampu menentukan asuhan kebidanan yang
tepat dalam menangani kehamilan ektopik terganggu (KET) ?
3. Mengetahui tentang kehamilan mola hidatidosa beserta penyebab
dan mekanismenya
4. Agar mahasiswa mampu menentukan asuhan kebidanan yang
tepat dalam menangani kehamilan mola hidatidosa

2
BAB II

TINJAUAN TEORI

2.1 Kehamilan Ektopik Terganggu

2.1.1 Definisi
Kehamilan ektopik adalah suatu keadaan dimana sel telur yang
telah dibuahi tidak melekat pada dinding rahim namun melekat di
tempat lain yang bukan semestinya yaitu dalam endometrium kavum
uteri. Diantara kehamilan ektopik yang banyak terjadi ialah di tuba
(90%), khususnya di ampulla (Wiknjosastro, 2007).
Kehamilan ektopik adalah implantasi yang terjadi ditempat lain
selain rongga uterus. Tempat tersebut meliputi tuba uterina, ovarium,
serviks, dan abdomen (Myles jilid 14, 2009)
Kehamilan ektopik adalah kehamilan ditempat yang luar biasa.
Tempat kehamilan normal ialah didalam cavum uteri. Kehamilan
ektopik dapat terjadi diluar rahim misalnya dalam tuba, ovarium, atau
rongga perut, tetapi dapat juga terjadi di dalam rahim diserviks (Unpad,
1984).

3
Kehamilan Ektopik adalah kehamilan yang terjadi bila telur yang
dibuahi berimplantasi dan tumbuh diluar endometrium kavum uteri
(Sarwono Prawirohardjo, 2005).
Kehamilan ektopik terganggu adalah kehamilan yang ektopik
yang terganggu dapat terjadi abortus atau pecah, dan hal ini berbahaya
bagi wanita tersebut (Sinopsis Obstetri jilid 1, 1998).
Kehamilan ektopik kombinasi adalah kehamilan intra uterine
yang terjadi dalam waktu bersamaan dengan kehamilan ekstra uterine
(Sinopsis Obstetri jilid 1, 1998).
Kehamilan ektopik rangkap adalah kehamilan intra uterine
dengan kehamilan ekstra uterine yang lebih dulu terjadi, tetapi janin
sudah mati dan menjadi litopedion (Sinopsis Obstetri jilid 1, 1998).
Dari semua definisi diatas adalah dapat disimpulkan bahwa
kehamilan ektopik adalah keadaan dimana hasil konsepsi berimplantasi,
tumbuh, dan berkembang dimanapun selain diendometrium rongga
uterus. Bila kehamilan tersebut mengalami pengakhiran maka disebut
dengan kehamilan ektopik terganggu. Tuba falopi merupakan tempat
tersering untuk terjadinya implantasi kehamilan ektopik ( lebih besar
90% ).

kehamilan ektopik terganggu (KET) adalah sebuah keadaan


gawat darurat yang terjadi dimana dapat mengancam dan
membahayakan nyawa ibu dan perkembangan kehidupan janin.
Kehamilan di luar kandungan juga merupakan salah satu penyebab
utama kematian sang ibu dan umumnya terjadi pada trimester 1.
Pada umumnya kehamilan normal, telur yang sudah dibuahi akan
melalui tuba falopi (saluran tuba) menuju keuterus (rahim). Telur
tersebut akan berimplantasi (melekat) pada rahim dan mulai tumbuh
menjadi janin. Pada kehamilan ektopik, telur yang sudah dibuahi
berimplantasi dan tumbuh di tempat yang tidak semestinya. Kehamilan
ektopik paling sering terjadi di daerah tuba falopi (98%), meskipun
begitu kehamilan ektopik juga dapat terjadi di ovarium (indung telur),
rongga abdomen (perut), atau serviks (leher rahim).

4
Resiko kehamilan ektopik sangat besar karena kehamilan ini tidak
bisa menjadi normal. Bila telur tersebut tetap tumbuh dan besar di
saluran tuba maka suatu saat tuba tersebut akan pecah dan dapat
menyebabkan perdarahan yang sangat hebat dan mematikan. Apabila
seseorang mengalami kehamilan ektopik maka kehamilan tersebut
harus cepat diakhiri karena besarnya risiko yang ditanggungnya.

2.1.2 Klasifikasi
1. Kehamilan tuba
Proses implantasi ovum yang dibuahi, yang terjadi di tuba
pada dasarnya sama dengan halnya di kavum uteri. Karena tuba
bukan tempat yang normal bagi kehamilan maka sebagian besar
kehamilan akan terganggu pada umur 6-10 minggu. Menurut
tempatnya nidasi maka terjadilah :
- Kehamilan ampuler : didalam ampula tuba
- Kehamilan isthmika : didalam isthmus tuba
- Kehamilan interstisiil : didalam pars interstitialis tuba
Kehamilan yang paling sering terjadi di tuba daerah ampula,
walaupun kehamilan terjadi diluar rahim, rahim akan membesar
juga karena hypertrofi disebabkan pengaruh hormon-hormon yang
disebabkan oleh trofoblast. Begitu pula endometriumnya akan
menjadi desidua vera.
a. Mengenai nasib kehamilan dalam tuba terdapat beberapa
kemungkinan :
- Mati kemudian diresorbsi
- Terjadi abortus tuba (65 %), perdarahannya bisa sedikit atau
banyak. Hasil konsepsi atau perdarahan bisa keluar kearah
kavum uteri dan dikeluarkan pervaginam, atau dari kavum
abdominal sehingga bertumpuk dibelakang rahim disebut
hematoma retrourina atau masa pelvis (pelvic mass).
- Terjadi ruptur tuba (35 %)

5
Bila robekan kecil maka hasil konsepsi tetap tinggal dalam tuba,
sedangkan dari robekan terjadi perdarahan yang banyak. Bila
robekan besar hasil konsepsi keluar dan masuk dalam rongga perut,
nasib konsepsinya yaitu :
Mati dan bersama darah berkumpul diretrourina
Bila janin agak besar dan mati akan menjadi litopedion dalam
rongga perut
Janin keluar dari tuba diselubungi kantong amnion dan
plasenta yang utuh, kemungkinan tumbuh terus dalam rongga
perut dan terjadi kehamilan abdominal sekunder. Selanjutnya
janin dapat tumbuh besar bahkan sampai aterm.

2. Kehamilan Intertisial
Karena dinding agak tebal, dapat menahan kehamilan
sampai 4 bulan atau lebih, kadang kala sampai aterm. Kalau pecah
dapat menyebabkan perdarahan yang banyak dan keluarnya janin
dalam rongga perut.
Implantasi telur terjadi pada interstitialis tuba. Karena
lapisan myometrium lebih tebal maka ruptur terjadi lebih lama
kira-kira pada bulan ke-3 atau 4 bulan. Kalau terjadi ruptur maka
bisa terjadi pendarahan hebat karena tempat ini banyak pembuluh
darahnya sehingga dalam waktu yang singkat dapat menyebabkan
kematian. Terapi : histerektomi.

6
3. Kehamilan abdomen
a. Kehamilan abdomen ada 2 macam :
- Kehamilan abdomen primer, dimana telur dari awal
mengadakan implantasi dalam rongga telur.
- Kehamilan abdomen sekunder, yang asalnya kehamilan tuba
dan setelah ruptur baru menjadi abdominal.
Kebanyakan kehamilan abdomen adalah kehamilan sekunder,
maka plasenta akan terdapat didaerah tuba. Namun ada kalanya
kehamilan ini bisa mencapai cukup bulan tetapi hal ini jarang
terjadi karena pengambilan makanan untuk janin kurang
sempurna. Jika kehamilan sampai terjadi aterm, maka akan
timbul his dan artinya pasien akan merasakan sakit seperti pada
persalinan biasa. Jika keadaan ini tidak segera ditolong dengan
laparotomi maka janin akan mati.

b. Tanda dan gejala :

Kehamilan abdomen (rongga perut) biasanya baru


didiagnosa jika kehamilan agak lanjut :

- Tanda kehamilan sama seperti normal, tetapi pasien lebih


merasakan sakit. Misalnya sering mual, muntah, gembung
perut, obtipasi, dan sakit perut sering dikemukakan.
- Pada kehamilan skunder pasien pernah mengalami sakit perut
hebat, disertai pusing dan terjadi pingsan waktu terjadinya
ruptur tuba.
- Tumor yang mengandung anak tidak mengeras (tidak ada
kontraksi braxton hicks).
- Pergerakan anak dirasakan sakit oleh ibu.
- Bunyi jantung anak lebih jelas terdengar.
- Bagian anak akan mudah teraba karena hanya dibatasi
dinding perut.

7
- Jika sudah ada his dapat terjadi pembukaan sebesar 1 jari
dan tidak menjadi lebih besar, ketika pemeriksaan kedalam
cavum uteri maka akan teraba uterus kosong.

c. Diagnosa
Untuk menentukan diagnosa dilakukan percobaan sebagai
berikut :
Pitocin test : pitocin disuntikan subkutan dan tumor yang
mengandung anak dipalpasi dengan teliti. Jika tumor itu
mengeras maka kehamilan itu intra uterin.

d. Terapi
Jika diagnosa sudah dikemukakan maka kehamilan
abdomen harus dioperasi segera, karena bahaya seperti
pendarahan hebat, dan anak akan dilahirkan kurang baik.
Operasi dilakukan untuk mngeluarkan anak saja dan tali pusat
dipotong sependek mungkin, dan plasenta biasanya ditinggalkan
untuk mencegah perdarahan. Karena jika plasenta dilepaskan
akan menimbulkan perdarahan yang sangat hebat karena
plasenta melekat pada dinding yang tidak kontraktil. Plasenta
yang ditinggalkan lambat laun akan diabsorpsi, mengingat
perdarahan hebat saat operasi, persediaan darah harus cukup.

4. Kehamilan ovarium
Jarang terjadi melainkan biasanya terjadi ruptur pada hamil muda.

5. Kehamilan serviks
Kehamilan serviks jarang sekali terjadi, nidasi terjadi dalam selaput
lendir serviks dan dengan tumbuhnya telur serviks mengembung.
Kehamilan serviks biasanya berakhir pada kehmailan muda, karena
menimbulkan pendarahan hebat. Plasenta sukar dilepaskan dan
pelepasan plasenta tersebut mengakibatkan perdarahan hebat

8
hingga serviks sangat memerlukan tampon atau kalau ini tidak
menolong maka harus dilakukan histerektomi.

2.1.3 Etiologi
Ada berbagai macam faktor yang dapat menyebabkan kehamilan
ektopik. Namun perlu diingat bahwa kehamilan ektopik dapat terjadi
pada wanita tanpa faktor risiko. Faktor risiko kehamilan ektopik adalah:
1. Riwayat kehamilan ektopik sebelumnya
Risiko paling besar untuk kehamilan ektopik. Angka kekambuhan
sebesar 15% setelah kehamilan ektopik pertama dan meningkat
sebanyak 30% setelah kehamilan ektopik kedua
2. Penggunaan kontrasepsi spiral dan pil progesteron
Kehamilan ektopik meningkat apabila ketika hamil, masih
menggunakan kontrasepsi spiral (3 4%). Pil yang mengandung
hormon progesteron juga meningkatkan kehamilan ektopik karena
pil progesteron dapat mengganggu pergerakan sel rambut silia di
saluran tuba yang membawa sel telur yang sudah dibuahi untuk
berimplantasi ke dalam rahim
3. Kerusakan dari saluran tuba
Telur yang sudah dibuahi mengalami kesulitan melalui saluran
tersebut sehingga menyebabkan telur melekat dan tumbuh di dalam
saluran tuba. Beberapa faktor risiko yang dapat menyebabkan
gangguan saluran tuba diantaranya adalah :
- Merokok : kehamilan ektopik meningkat sebesar 1,6 3,5 kali
dibandingkan wanita yang tidak merokok. Hal ini disebabkan
karena merokok menyebabkan penundaan masa ovulasi
(keluarnya telur dari indung telur), gangguan pergerakan sel
rambut silia di saluran tuba, dan penurunan kekebalan tubuh.
- Penyakit Radang Panggul : menyebabkan perlekatan di dalam
saluran tuba, gangguan pergerakan sel rambut silia yang dapat
terjadi karena infeksi kuman TBC, klamidia, gonorea.

9
- Tindakan medis : seperti operasi saluran tuba atau operasi daerah
panggul, pengobatan infertilitas seperti bayi tabung
menyebabkan parut pada rahim dan saluran tuba.

4. Faktor Lain
a. Migrasi luar ovum, yaitu perjalanan dari ovarium kanan ke tuba
kiri-atau sebaliknya dapat memperpanjang perjalanan telur yang
dibuahi ke uterus; pertumbuhan telur yang terlalu cepat dapat
menyebabkan implantasi prematur
b. Fertilisasi in vitro

2.1.4 Patofisiologi
Tempat-tempat implantasi kehamilan ektopik antara lain ampulla
tuba (lokasi tersering), isthmus, fimbriae, pars interstitialis, ovarium,
rongga abdomen, dan serviks. Pada keadaan yang pertama, zigot
melekat pada ujung atau sisi jonjot endosalping yang relatif sedikit
mendapat suplai darah, sehingga zigot mati dan kemudian direasorbsi.
Pada implantasi interkolumnar, zigot menempel di antara dua jonjot.
Zigot yang telah bernidasi kemudian tertutup oleh jaringan endosalping
yang menyerupai desidua, yang disebut pseudokapsul. Villi korialis
dengan mudah menembus endosalping dan mencapai lapisan
miosalping dengan merusak integritas pem.buluh darah di tempat
tersebut. Selanjutnya, hasil konsepsi berkembang, dan
perkembangannya tersebut dipengaruhi oleh beberapa faktor, yaitu

10
tempat implantasi, ketebalan tempat implantasi dan banyaknya
perdarahan akibat invasi trofoblas. Karena tempat implantasi pada
kehamilan ektopik tidak ideal untuk berlangsungnya kehamilan, suatu
saat kehamilan ektopik tersebut akan terkompromi. Kemungkinan-
kemungkinan yang dapat terjadi pada kehamilan ektopik adalah: hasil
konsepsi mati dini dan diresorbsi, abortus ke dalam lumen tuba, dan
ruptur dinding tuba.

2.1.5 Tanda gejala


Pada minggu-minggu awal, kehamilan ektopik memiliki tanda-
tanda seperti kehamilan pada umumnya, yaitu terlambat haid, mual dan
muntah, mudah lelah, dan perabaan keras pada payudara. Tanda-tanda
yang harus diperhatikan pada kehamilan ektopik adalah :
1. Nyeri hebat pada perut bagian bawah, nyeri tersebut dapat terasa
tajam awalnya kemudian perlahan lahan menyebar ke seluruh perut.
2. Nyeri bertambah hebat bila bergerak Perdarahan vagina (bervariasi,
dapat berupa bercak atau banyak seperti menstruasi)
Kehamilan ektopik yang terganggu Selain gejala kehamilan muda
dan abortus imminens, juga ditemui kondisi gawat darurat dan
abdominal akut seperti :
- Kesadaran menurun dan lemah
- Pucat
- Syok hipovolemik sehingga isi dan tekanan denyut nadi berkurang
serta meningkatnya frekuensi nadi > 112/menit
- Perut kembung ( adanya cairan bebas abdomen ) dan nyeri tekan
- Nyeri perut bawah yang makin hebat apabila tubuh digerakkan
- Nyeri goyang porsio

2.1.6 Pemeriksaan penunjang


Pemeriksaan air seni dapat dilakukan untuk mengetahui kehamilan
seseorang, sedangkan untuk mengetahui kehamilan ektopik seorang
dokter dapat melakukan: Pemeriksaan darah untuk mengecek hormon

11
-hCG. Pemeriksaan ini diulangi 2 hari kemudian. Pada kehamilan
muda, level hormon ini meningkat sebanyak 2 kali setiap 2 hari. Kadar
hormon yang rendah menunjukkan adanya suatu masalah seperti
kehamilan ektopik Pemeriksaan ultrosonografi (USG). Pemeriksaan ini
dapat menggambarkan isi dari rahim seorang wanita. Pemeriksaan USG
dapat melihat dimana lokasi kehamilan seseorang, baik di rahim,
saluran tuba, indung telur, maupun di tempat lain.

2.1.7 Diagnosis
1. Anamnesis : terjadi amenorea
2. Bila dijumpai KET : pada abortus tuba tidak begitu berat hanya rasa
sakit di perutdan perdarahan pervaginam, bila terjadi ruptur tuba
maka gejala akan lebih hebat dan membahayakan ibu
3. Perasaan nyeri dan sakit yang tiba-tiba di perut seperti di iris-iris
dengan pisau bahkan sampai pingsan
4. Tanda-tanda akut abdomen : nyeri tekan hebat, mual, muntah, tensi
rendah, nadi kecil, dan anemia
5. Nyeri bahu : karena perangsangan diafragma
6. Pemeriksaan ginekologik : nyeri ayun porsio dan nyeri tekan pada
kavum Dauglasi, teraba masa pelvis
7. Palpasi perut dan perkusi : ada tanda-tanda perdarahan abdominal
8. Pemeriksaan laboratorium : Hb sering di periksa setiap 1 jam,
adanya lekositosis
9. Kuldosentesis (Douglass Pungsi) :
- Bila keluar darah merah tua berwarna coklat sampai hitam yang
tidak membeku atau hanya bekuan kecil maka ini dikatakan
positif (fibrinasi) dan menunjukkan adanya hematoma retrourina
- Bila darah segar berwarna merah dan beberapa menit membeku
maka hasinya negatif karena darah berasak dari arteri atau vena
yang tertusuk
10. Dengan cara diagnostik laparoskopi
11. Dengan cara ultrasonografi

12
2.1.8 Penanganan
Penatalaksanaan kehamilan ektopik tergantung pada beberapa hal,
antara lain lokasi kehamilan dan tampilan klinis. Sebagai contoh,
penatalaksanaan kehamilan tuba berbeda dari penatalaksanaan
kehamilan abdominal. Selain itu, perlu dibedakan pula penatalaksanaan
kehamilan ektopik yang belum terganggu dari kehamilan ektopik
terganggu. Tentunya penatalaksanaan pasien dengan kehamilan ektopik
yang belum terganggu berbeda dengan penatalaksanaan pasien dengan
kehamilan ektopik terganggu yang menyebabkan syok. Penatalaksanaan
bedah dapat dikerjakan pada pasien-pasien dengan kehamilan tuba yang
belum terganggu maupun yang sudah terganggu. Tentu saja pada
kehamilan ektopik terganggu, pembedahan harus dilakukan secepat
mungkin. Selain itu macam-macam pembedahan tersebut dapat
dilakukan melalui laparotomi maupun laparoskopi. Namun bila pasien
jatuh ke dalam syok atau tidak stabil, maka tidak ada tempat bagi
pembedahan laparoskopi.

13
2.2 Mola Hidatidosa
2.2.1 Definisi
Mola Hidatidosa adalah malformasi besar yang terjadi pada
trofoblast ketika vili korionik berpoliferasi dan menjadi vaskular,
ditemukan pada rongga uterus dan juga pada tuba uteri (Myles:283).
Mola hidatidosa merupakan kehamilan abnormal hampir seluruh
vili korialisnya mengalami perubahan hidrofik (Arif : 265)

2.2.2 Etiologi
Penyebabnya belum diketahui pasti, diduga akibat adanya infeksi,
defisiensi makanan, dan genetik. Adapun teori dari Acosta sison
yaitu karna adanya defisiensi protein. Faktor resiko terdapat pada
golongan sosioekonomi rendah, usia dibawah 20 tahun dan usia
diatas 35 tahun, dan paritas tinggi.

2.2.3 Patofisiologi
Pada Mola Hidatidosa atau Complete mole tidak ada jaringan
fetus/janin. 90% merupakan kromosom 46,XX dan 10% merupakan
kromosom 46, XY. Semua kromosom berasal dari paternal. Sebuah
enukliasi telur dibuahi oleh sperma haploid (yang kemudian
berduplikasi menjadi masing-masing kromosom), atau sel telur dibuahi
oleh dua sperma. Pada mola hidatidosa, vili korion menyerupai anggur
dan hiperplasia trofoblastik muncul.
Pada Mola parsialis atau Partial mole jaringan fetus/janin
dapat ditemukan. Eritrosit dan pembuluh darah janin pada vili dapat
ditemukan. Komplemen kromosom nya 69,XXX atau 69 XXY.
Kromosom tersebut merupakan hasil dari pembuahan sel telur haploid
dan duplikasi dari kromosom haploid paternal. Seperti pada Complete
mole, jaringan hiperplasia trofoblastik dan vili korion yang lunak pun
muncul pada mola ini.

14
2.2.4 Klasifikasi
1. Mola hidatidosa komplit (MHK)
Merupakan kehamilan abnormal tanpa embrio yang seluruh
vili korialisisnya mengalami degenerasi hidropik yang
menyerupai anggur. Mikroskopi tanpak edema stroma vili tanpa
vaskularisasi disertai hiperplasia dari kedua lapisan trofoblast.
MHK bersifat heterozigot tetapi tetap androgenetik dan bisa
terjadi, walaupun sangat jarang terjadi kehamilan kembar
dizigotik yang terdiri dari 1 bayi normal dan satu lagi MHK.
Pada mola jenis ini tidak terdapat adanya tanda-tanda
embrio, tali pusat, atau membran. Kematian terjadi sebelum
berkembangnya sirkulasi plasenta (Szulman 1988). Vili korionik
berubah menjadi vesikel hidropik yang jernih yang menggantung
bergerombol pada pedikulus kecil, dan memberi tampilan seperti
seikat anggur. Ukuran vesikel bervariasi dari yang sulit dilihat
sampai yang berdiameter besar. Pada kehamilan normal
troploblast meluruhkan desidua untuk menambatkan hasil
konsepsi. Hal ini berarti bahwa mola yang sedang berkembang
dapat berpenetrasi tempat implantasi.
Mola komplit biasanya memiliki 46 kromosom yang
berasal dari pihak ayah (paternal). Sperma haploid memfertilisasi
telur yang kosong yang tidak mengandung kromosom maternal
(Lawler et al 1991). Kromosom paternal berduplikasi sendiri.
Korion karsinoma dapat terjadi dari mola jenis ini. (Myles:283)

15
Manifestasi Klinis MHK :
Gejala bervariasi, Tanda-tanda vital pasien dapat
mengungkapkan takikardia, takipnea, dan hipertensi (Hecker:
681). tanda-tanda kehamilan berlebihan yang muncul pada
minggu ke 6-8 merupakan karakteristik mola jenis ini. Perdarahan
atau rabas vagina bernoda darah setelah periode amenore
merupakan gejala paling umum yang menjadi tanda pertama
adanya abnormalitas. Vesikel tersebut kemudian terlepas dan
dapat diambil melalui vagina untuk penetapan diagnosis.
Anemia yang terjadi akibat kehilangan darah secara
bertahap juga dapat menjadi masalah. Mual dan muntah yang
berlebihan akibat tingginya kadar HCG sehingga ibu akan
mengalami Hyperemesis Gravidarum. Hipertiroidisme telah
dideteksi pada kehamilan mola. Pre-eklamsia yang terjadi di awal
kehamilan merupakan tanda adanya kemungkinan mola
hidatidosa komplit. Pada pemeriksaan, ukuran uterus melebihi
usia kehamilan, uterus terasa elastis dan tidak berkontraksi.
(Myles: 284)
Kadar HCG pada mola jauh lebih tinggi dari kehamilan
biasa. Pada kehamilan biasa , kadar HCG paling tinggi 100.000
IU/L, sedangkan pada mola bisa mencapai 500.000 IU/L.

2. Mola hidatidosa parsial


Mola hidatidosa parsial adalah mola yang tidak lengkap
atau sebagian biasanya berhubungan dengan janin yang sedang
berkembang. Pasien mola sebagian memperlihatkan sebagian
besar sifat patologik dan klinik dari mola lengkap, meskipun
biasanya dalam bentuk yang tidak begitu berat.
Mola sebagian biasanya didiagnosis belakangan
dibandingkan mola lengkap dan biasanya muncul sebagai aborsi
spontan atau missed abortion. Mola sebagian jarang dideteksi
sebelum pengakhiran spontan kehamilan. Kemungkinan

16
degenerasi mola pada plasenta yang berhubungan dengan janin
yang sedang berkembang. (Hacker: 685).

Manifestasi klinis mola hidatidosa parsial :


Mola parsial tanda-tanda klinis tidak begitu nyata terkadang
hampir sama dengan mola hidatidosa komplet, seperti amenore,
tanda-tanda kehamilan, perdarahan pervaginam berualang-ulang,
darah cenderung berwarna coklat. Pada keadaan lanjut kadang
keluar gelembung mola, pembesaran uterus lebih dari masa
kehamilan (Arief: 267). Pembesaran rahim jauh kurang lazim
tinggi fundus biasanya jauh lebih besar dibanding tanggalnya,
namun terkadang juga jauh lebih kecil. Bila terjadi bersama mola
sebagian, pre-eklamsia mungkin berat , keadaan tersebut biasanya
terjadi antara usia kehamilan 17 minggu sampai 22 minggu. Mola
sebagian belum dilaporkan mengalami metastasis, dan jarang
sekali membutuhkan kemoterapi karena titter beta-HCG
mendatar/meningkat (Hacker: 685)

2.2.5 Diagnosis
Anamnesis : perdarahan pervaginam/ gambaran mola, gejala tosemia
pada trimester I dan trimester II, hyperemesis gravidarum, gejala
tirotoksikosis, dan gejala emboli paru. Pemeriksaan fisik : uterus
lebih besar dari usia kehamilaalotement negatif, denyut jantung janin
negatif. Pemeriksaan penunjang pada tes Acosta Sison dapat
dikeluarkan jaringan mola, melakukan USG terdapat seperti salju .
Kehamilan dengan mioma, abortus, hidramnion, dan gemeli. (Arief:
267)

17
2.2.6 Penatalaksanaan
1. Evaluasi praoperatif
Pasien dirawat di rumah sakit untuk menjalani terapi
definif. Evaluasi praoperatif meliputi hitung darah lengkap hitung
trombosit, pemeriksaan bekuan, golongan darah, dan cocok silang,
titer serum HCG sub unit beta, panel kimia darah mencakup tes
fungi hati, panel tiroid, foto thorax, USG pelvis, urinalisa, dan
elektrokardigram.
2. Kuretase isap (Suction Curettage)
Apabila pasien menginginkan keturunan dikemudian hari,
penanganan yang dipilih adalah evakuasi jaringan mola dengan
evakuasi hisap. Dua sampai empat unit darah harus tersedia karena
evakuasi dapat disertai dengan kehilangan darah banyak.
Setelah evakuasi awal, kontraksi uterus dirangsang dengan
oksitosin intravena untuk mengurangi kehilangan darah. Jaringan-
jaringan sisa dibersihkan dengan kuretase tajam. Spesimenne
dikirim secara terpisah ke laboratorium patologi.

3. Histerektomi Abdominal
Pada mola in situ merupakan suatu alternatif lain bagi para
pasien yang tidak lagi menginginkan kehamilan di kemudian hari.
Histerketomi menyingkirkan kemungkinan berfungsinya sel-sel
trofoblastik yang tertinggal didalam uterus setelah kuretase isap
dan mengurangi resiko penyakit trofoblastik residual sampai 3-5%.
Keputusan mengenai salpingo-ooforektomi adalah
tersendiri. Setelah pengeluaran mola dan pengurangan stimulasi
chorionic gonadotropine, kista teka-lutein ovaium mengalami
regresi secara spontan. Pengangkatan dengan pembedahan hanya
diperlukan bila ada kaitan dengan torsi atau perdarahan.

18
4. Program lanjutan
Setelah evakuasi suatu kehamilan mola pasien di amati
dengan seksama terhadap serangkaian titer chorionic
gonadotropine, menggunakan radio immunoassay untuk sub unit
beta, setiap satu atau dua minggu sampai negatif. Hilangnya HCG
secara sempurna diperkirakan terjadi dalam 9-15 minggu setelah
pengosongan uterus. Pasien disarankan untuk menghindari
kehamilan sampai titer HCG selama satu tahun. Biasanya diberikan
kontrasepsi oral estrogen dan progestin.
Pelvis diperiksa secara berkala untuk menilai ukuran uterus.
Apabila dua titer HCG yang berurutan stabil atau meningkat, atau
apabila tampak adanya metastase, pasien harus dievaluasi terhadap
keganasan neoplasia trofoblastik gestasional dan kemotrapi.
Hampir 15-20% pasien dengan mola berkembang gejala keganasan
setelah kuretase isap. Dari kelompok ini hampir 80% menderita
penyakit trofoblastik non metastastik sedangkan yang 20%
menderita metastase keluar batas uterus, paling sering ke paru-paru
atau vagina.
Selain titer HCG yang persisten atau meningkat, gejala
keganasan neoplasia trofoblastik gestasional meliputi perdarahan
pervaginam yang persisten, perdarah intra abdominal, dan lesi
didalam paru-paru, hepar, otak dan organ-organ lainnya.

5. Pengobatan profilaksis dengan sitostatika (kemoterapi)


Molahidatidosa merupakan penyakit trofoblas yang dapat
berkelanjutan menjadi korio karsinoma (65-75%). Untuk
menhindari terjadinya degenarasi ganas, penderita mola hidatidosa
diberi profilaksis dengan sitostatiska (kemoterapi) methotraxate
(MTX) atau actinoycin D. Pengobatan Profilaksis atau terapi
sitostatiska memerlukan perawatan dan pengawasan dirumah.

19
2.2.7 Penatalaksanaan Bagi Bidan
Peran bidan dalam penatalaksanaan penyakit mola hidatidosa
terutama menegakkan diagnosis kemungkinan dan selanjutnya
melakukan rujukan untuk mendapatkan diagnosis pasti.
Namun jika sudah terjadi perdarahan lebih dari 500cc sampai syok
perdarahan maka bidan melakukan penanganan awal
kegawatdaruratan terlebih dahulu sebelum dirujuk, yaitu :
- Tindakan Umum
Jangan beri cairan atau makanan kedalam mulut untuk mecegah
adanya bahaya aspirasi
Miringkan kepala pasien / badan kesamping
Jaga kondisi badan tetap hangat untuk mencegah terjadinya
hipotermi
Naikkan kaki pasien untuk membantu aliran darah balik ke
jantung
Yakini bahwa jalan napas tidak tersumbat

- Pemberian Oksigen
Pastikan bahwa jalan napas bebas oksigen
Diberikan kecepatan 6-8 liter per menit

- Pemberian Cairan Intravena


Menggantikan cairan tubuh yang hilang dengan cairan
isotonik : NaCl 0,9% atau Ringer Laktat
Ditusukan jarum infus No. 16-18
Pemberian cairan secara cepat 0,5 1 Liter (15-20 menit), 1-3
Liter untuk menstabilkan hipovolemik, setelah koreksi cairan
terpenuhi lalu pertahankan infus 1 liter/6-8 jam

20
BAB III

PENUTUP

3.1 Kesimpulan
Mola Hidatidosa adalah kehamilan abnormal dimana hampir seluruh villi
Korialisnya mengalami perubahan hidrofobik Prevalensi mola hidatidosa
lebih tinggi di Asia, Afrika dan Amerika Latin Mola hidatidosa terbagi
menjadi :
a. Mola hidatidosa sempurna
b. Mola hidatidosa parsial
Perdarahan pervaginaan dari bercak sampai perdarahan berat merupakan
gejala utama dari mola hidatidosa Diagnosis ditegakkan berdasarkan
Anamnesa, Pemeriksaan fisik, pemeriksaan dalam, laboratorium, radiologik
dan histopatologik
Penatalaksanaan :
a. Evakuasi : Kuret atau kuret isap
b. Pengawasan lanjut : Periksa ulang selama 2-3 tahun
c. Terapi profilaksis : Pemberian Metotreksat (MTX)
Komplikasi :
- Syok
- Anemia
- Infeksi Sekunder
Kehamilan ektopik terganggu (KET)
Sebagian besar kehamilan ektopik terganggu berlokasi di tuba
(90%) terutama di ampula dan isthmus. Sangat jarang terjadi di ovarium,
rongga abdomen, maupun uterus. Keadaan-keadaan yang memungkinkan
terjadinya kehamilan ektopik adalah penyakit radang panggul, pemakaian
antibiotika pada penyakit radang panggul, pemakaian alat kontrasepsi dalam
rahim IUD (Intra Uterine Device), riwayat kehamilan ektopik sebelumnya,
infertilitas, kontrasepsi yang memakai progestin dan tindakan aborsi. Gejala
yang muncul pada kehamilan ektopik terganggu tergantung lokasi dari

21
implantasi. Dengan adanya implantasi dapat meningkatkan vaskularisasi di
tempat tersebut dan berpotensial menimbulkan ruptur organ, terjadi
perdarahan masif, infertilitas, dan kematian. Hal ini dapat mengakibatkan
meningkatnya angka mortalitas dan morbiditas Ibu jika tidak mendapatkan
penanganan secara tepat dan cepat. (Marten,2009)

3.2 Saran

Guna penyempurnaan makalah ini, kelompok kami sangat mengharapkan


kritik dan saran dari rekan-rekan pembaca khususnya dosen pembimbing. Semoga
makalah ini bermanfaat bagi rekan-rekan dalam membantu kegiatan belajar kita.
Sekian dan terimakasih,

22
Ante Natal care

Hari/ Tanggal :

WaktuPengakajian :

A. Data Subjektif
a. IndentitasKlien
Istri Suami
Nama : Ny. B Tn. K
Usia : 32tahun 35tahun
Agama : Islam Islam
SukuBangsa : Sunda Sunda
Pendidikan : S1 SMA
Pekerjaan : Karyawan Swasta PNS
Alamat : Padurenan 1/6 Gn. Sindur Padurenan 1/6
Gn. Sindur

b. Keluhan Utama
Keluarga mengatakan klien mengeluarkan flek-flek darah dari vagina
sejak 1 minggu yang lalu dan nyeri perut yang sangat hebat sejak 2 hari
yang lalu.

c. Riwayat Kehamilan sekarang dan persalinan yang lalu


Ibu mengatakan ini adalah kehamilan yang kedua dan tidak pernah
keguguran. Hari pertama haid terakhir tanggal 10 Maret 2014. Ibu
belum merasakan adanya gerakan janin. Ibu rutin meminum tablet
penambah darah dan vitamin yang diberikan. Kelahiran anak pertama
tahun 2009 cukup bulan, tidak ada penyulit selama kehamilan,
persalinan dan nifas, lahir di bidan secara spontan jenis kelamin
perempuan berat badan 3200 gram.
d. Riwayatkesehatanibudankeluarga
Ibutidakmerasamemilikipenyakitdantidakpernahdirawatdirumahsakit.
Ibutidakmempunyaiketurunankembar.

23
e. Riwayat KB
Ibu mengatakan pernah mengunakan alat kontrasepsi KB Pil lamanya 3
tahun, haid tidak teratur.

f. Riwayatbiologi-psiokologi-sosialdanekonomi
a. Biologi : Gizi yang dikonsumsi dan kebiasaan makan sebelum
hamil : 3x sehari, minum 5 gelas perhari, saat hamil 2 kali sehari,
minum 5 gelas tidak ada keluhan
b. Psikologi : Respon ibu dan keluarga terhadap kehamilan sangat
senang
c. Sosial : ibu mengatakan sudah menikah selama 7 tahun dengan
status pernikahan yang sah. Dan kehamilan ini adalah kehamilan
yang direncanakan dan didukung oleh suami dan keluarga. Suami
selalu mengingatkan ibu untuk makan dan istirahat. Keluarga sering
mendampingi ibu saat melakukaan pemeriksaan kehamilannya.
Pengambilan keputusan dalam keluarga adalah suami. Ibu
berencana melahirkan di rumah sakit. Dan di tolong oleh bidan.
d. Ekonomi : ibu sudah mulai menabung biaya untuk bersalin.

B. DATA OBJEKTIF
1. Keadaan umum : ibu tampak kesakitan
2. Kesadaran umum : Somnolen
3. Antropometri : tinggi badan : 155 cm, berat badan sebelum hamil 47
kg, berat badan sekarang 47 kg.
4. Tanda-tanda vital : TD : 90/60 mmHg N : 110x/menit
P : 30x/menit S : 35,8C
5. Kepala : muka : tidak terdapat oedema
Mata : konjungtiva tampak merah pucat, sclera tanpak putih
Mulut : bibir tampak pucat

24
6. Abdomen : tidak ada luka operasi terdapat nyeri tekan yang hebat
pada perut, ballotemen belum teraba, perut teraba kembung.
7. Ekstremitas : tangan dan kaki tidak oedema, tampak pucat dan
dingin.
8. Genetalia tidak ada varises, tidak ada luka, terdapat pengeluaran
bercak darah berwarna kehitam pada vagina.
9. Pemeriksaan Lab : HB 9gr% protein negatif

C. Analisa
Ny. N usia 33 tahun G3P2A0 usia kehamilan 7 minggu dengan
kehamilan ektopik terganggu

D. Penatalaksanaan
1. Memberitahukan hasil pemeriksaan kepada ibu dan keluarga.
2. Inform Consent keluarga bahwa ibu harus segera di rujuk dan bidan
akan segera melakukan tindakan untuk memperbaiki keadaan umum
ibu keluarga setuju dilakukan tidakan dan merujuk ibu
3. Melakukan upaya penanganan awal
- Janganbericairanataumakanankedalammulutuntukmecegahadany
abahayaaspirasi
- Miringkankepalapasien / badankesamping
- Jagakondisibadantetaphangatuntukmencegahterjadinyahipotermi
- Naikkan kaki pasienuntukmembantualirandarahbalikkejantung
- Yakinibahwajalannapastidaktersumbat
4. Memberikan oksigen 6-8 liter permenit
5. Memberikan cairan infus RL secaracepat 0,5 1 Liter (15-20 menit)
6. Mempersiapkan rujukan BAKSOKU.
7. Melakukan rujukan ke Rumah Sakit yang diinginkan keluarga.

25