Anda di halaman 1dari 341

Captulo 12

Aspectos de la emocin
Trate de verse triste, de producir una expresin de tristeza. Mientras lo hace, preste atencin a las di-
ferentes sensaciones que experimenta a partir de los movimientos de su musculatura facial. Si slo
empuj su labio inferior hacia fuera y jal las comisuras de su boca hacia abajo, es probable que no se
haya sentido muy triste. De modo que intntelo de nuevo.
Produzca una segunda expresin de tristeza. Pero esta vez, no slo mueva su labio inferior y las
comisuras de su boca, sino tambin junte sus cejas hacia dentro al mismo tiempo, lo que requerir de
cierta destreza; as que imagine que tiene un par de palillos anclados en las esquinas internas de sus
cejas. Imagine que estos palillos se encuentran como a 2.5 cm de distancia entre s y que estn dirigidos
hacia fuera en forma paralela (la base de cada palillo descansa en el interior de la ceja y las puntas se
extienden hacia fuera). Ahora, mueva sus cejas hasta que se toquen las puntas externas de los palillos.
Ahora, trate de mover los tres conjuntos de msculos a un mismo tiempo: una las puntas exteriores de
los palillos, empuje su labio inferior hacia fuera y voltee las comisuras de su boca hacia abajo (Larsen,
Kasimatis y Frey, 1992).
Sinti algo al intentar hacer esta expresin facial? Detect algn atisbo de tristeza incipiente? Su
frecuencia cardiaca descendi un poco? No sinti un vago impulso de llorar? De ser as, la sensacin
fue leve porque una expresin facial fingida no es tan autntica ni produce una emocin tan real como
la expresin facial espontnea. Pero el leve sentimiento de tristeza expresado a travs de una expresin
facial ensayada es una buena manera de introducir uno de los muchos aspectos de la emocin que se
discutirn en el presente captulo; en este caso, la hiptesis de la realimentacin facial.
A medida que nos ocurren sucesos vitales importantes, se activan reacciones biolgicas y cognitivas
en nosotros. Los procesos biolgicos y cognitivos resultantes generan emociones que nos preparan
para lidiar de manera adaptativa con el suceso vital importante al que nos enfrentamos. En el cuadro
12.1 aparece un esquema de los procesos biolgicos y cognitivos involucrados en las emociones. En la
primera mitad de este captulo se mostrar una perspectiva general de los procesos biolgicos implica-
dos en la emocin (lado izquierdo), mientras que la segunda mitad dar una perspectiva general de los
procesos cognitivos implicados en la emocin (lado derecho).

Aspectos biolgicos de la emocin


En parte, las emociones son reacciones biolgicas a sucesos vitales importantes. La lista de sucesos
biolgicos del cuadro 12.1 es importante porque los elementos listados identifican las reacciones biol-
gicas relacionadas con la emocin que el cuerpo experimenta ante los sucesos vitales significativos. Al
enfrentarse a una situacin de importancia personal (por ejemplo, una amenaza), el cuerpo se prepara
para afrontarla de manera efectiva (por ejemplo, se prepara para correr) mediante la activacin de lo
siguiente: 1) corazn, pulmones y msculos (sistema nervioso autnomo); 2) glndulas y hormonas
(sistema endocrino); 3) estructuras cerebrales lmbicas como la amgdala (circuitos neurales del ce-
rebro); 4) actividad neural y ritmo del procesamiento de informacin (tasa de descargas neurales); y

Cuadro 12.1 Aspectos biolgicos y cognitivos de la emocin.


Aspectos biolgicos Aspectos cognitivos, sociales y culturales

1. Sistema nervioso autnomo 1. Valoraciones


2. Sistema endocrino 2. Conocimientos
3. Circuitos neurales del cerebro 3. Atribuciones
4. Tasa de descargas neurales 4. Antecedentes de socializacin
5. Realimentacin facial 5. Identidades culturales
246 CAPTULO 12 Aspectos de la emocin

5) patrones discretos de musculatura facial (realimenta- perceptuales y que la experiencia emocional es la forma
cin facial). Al activarse estos sistemas biolgicos, la per- que la persona tiene de darle sentido a cada pauta distinta
sona experimenta emociones y est significativamente de reacciones corporales. Si no ocurrieran estos cambios
ms preparada para afrontar la amenaza inminente. en el cuerpo, no se presentara la emocin resultante.
El estudio de las emociones se inici hace cerca de La teora James-Lange de las emociones adquiri po-
cien aos cuando se plante la interrogante del papel que pularidad con rapidez, pero tambin se vio sometida a
realizaba el sistema nervioso autnomo en la experien- crticas (Cannon, 1927).1 Los crticos razonaban que el
cia subjetiva de la emocin. La primera teora de la emo- tipo de reacciones corporales a las que James haca refe-
cin, la teora James-Lange, preguntaba si las distintas rencia en realidad eran parte de la respuesta general de
emociones tenan reacciones corporales nicas que se les movilizacin corporal de pelea-huida que no vara de una
asociaran o no. Todos sabemos que el temor y la alegra emocin a otra (Cannon, 1929; Mandler, 1975; Schachter,
se sienten diferentes, pero, el temor y la alegra tambin 1964).2 Tambin argan que la experiencia emocional
tienen reacciones corporales diferentes entre s? Nuestro era ms veloz que las reacciones fisiolgicas; es decir,
corazn, pulmones y hormonas se comportan de una mientras que una persona siente enojo en una dcima
manera cuando estamos temerosos y de otra cuando de segundo, le lleva todo un segundo al sistema nervio-
experimentamos alegra? Y, de ser as, estas diferencias so de la persona activar glndulas importantes y enviar
biolgicas explican por qu son distintas las emociones hormonas excitatorias por el torrente sanguneo. Estos
que experimentamos? De hecho, la pauta de actividad de crticos afirmaban que el papel de la activacin fisiolgica
nuestro corazn, pulmones y hormonas es la que ocasio- era aumentar la emocin, ms que ocasionarla (Newman,
na el temor y la alegra experimentados? Perkins y Wheeler, 1930). Los crticos concluyeron que la
contribucin de los cambios fisiolgicos a la experiencia
emocional era pequea, complementaria y relativamente
Teora James-Lange insignificante. Una dcada despus de que se propuso, la
La experiencia personal sugiere que experimentamos primera teora principal de la emocin estaba en tela de
una emocin y que cambios corporales siguen rpida- juicio.
mente a la emocin experimentada. Tan pronto como
vemos luces rojas que parpadean y escuchamos la sire- Perspectiva contempornea
na de una patrulla de polica, surge el temor y este sen-
timiento de temor hace que nuestro corazn se acelere Ante las crticas, las ideas de James cayeron en el recha-
y que nos suden las palmas de las manos. La secuencia zo y surgieron teoras rivales de la emocin que obtuvie-
de eventos parece ser estmulo A emocin A reaccin ron mayor popularidad (por ejemplo, vase Schachter
corporal. William James (1884, 1890, 1894) argumenta- y Singer, 1962). No obstante, sus discernimientos con-
ba contra esta perspectiva comn. Sugiri que nuestros tinan guiando el estudio contemporneo (Ellsworth,
cambios corporales no siguen a la experiencia emocional; 1994; Lang, 1994) y las investigaciones modernas sus-
ms bien, la experiencia emocional sigue y depende de tentan la especificidad fisiolgica en algunas emociones
nuestras respuestas corporales a las luces parpadeantes (Buck, 1986; Levenson, 1992; Schwartz, 1986). Por ejem-
y los sonidos de la sirena. As, son los cambios corporales plo, Paul Ekman, Robert Levenson y Wallace Friesen
los que ocasionan la experiencia emocional: estmulo A (1983) estudiaron si cada una de las diversas emociones
reaccin corporal A emocin. tiene o no una pauta nica de cambios corporales. Estos
La teora de James descansaba en dos suposiciones: investigadores reclutaron personas que pudieran expe-
1) el cuerpo reacciona de manera nica y diferenciada a
distintos sucesos evocadores de la emocin y 2) el cuerpo 1 Al mismo tiempo que James present sus teoras, el psiclogo
no reacciona a sucesos que no evocan emociones. A fin dans, Carl Lange (1885) propuso lo que en esencia era la misma
de apreciar la hiptesis de James, piense en las respuestas teora (aunque ms limitada). Es por esta razn que la idea de que
fisiolgicas de su cuerpo ante una ducha que se enfra de las emociones emanan de nuestra interpretacin de los patrones de
activacin fisiolgica tradicionalmente se denomina teora James-
manera sorpresiva e inesperada. La reaccin fisiolgica
Lange (Lange y James, 1922).
el aumento en frecuencia cardiaca, la aceleracin de la 2 Por ejemplo, una persona experimenta emociones especficas
respiracin y los ojos abiertos empieza antes de que us- despus de ingerir un frmaco estimulante que se sabe induce
ted tenga tiempo de pensar acerca de las razones por las cambios corporales, como aumento de la frecuencia cardiaca,
que su corazn est acelerado y sus ojos se estn abriendo. minimizacin de la actividad gastrointestinal y dilatacin de los
bronquios? La estimulacin visceral inducida por frmacos conduce
El cuerpo reacciona y las reacciones emocionales resul-
a las personas a sentirse como con temor o como si fuera a llorar
tantes ocurren en nosotros antes de que nos demos cuen- sin saber por qu, ms que temerosas o tristes en s (es decir, por lo
ta de lo que est sucediendo. James argumentaba que es- general las personas se sienten estimuladas pero no especficamente
tas reacciones corporales instantneas suceden en pautas temerosas).
Aspectos biolgicos de la emocin 247

rimentar emociones a voluntad (actores profesionales) regula y prepara el marco para la emocin, pero no es
y les pidieron a cada uno de ellos que revivieran cinco causante directa de la misma. La perspectiva moderna es
emociones distintas enojo, temor, tristeza, alegra y que las emociones renen el apoyo biolgico y fisiolgi-
asco al tiempo que los investigadores realizaban medi- co para hacer posibles las conductas adaptativas de pelea,
ciones en busca de pautas especficas de la emocin en huida y crianza (Levenson, 1994b).
la actividad fisiolgica. Surgieron diferencias claras en
la frecuencia cardiaca (FC) y en la temperatura cutnea CIRCUITOS NEURALES ESPECFICOS
(TC). En el caso del enojo, hubo aumentos tanto en la Del mismo modo en que los primeros investigadores
FC como en la TC. Con el temor, la FC aument al tiem- buscaron patrones especficos para las emociones en la
po que la TC disminuy. En el caso de la tristeza, la FC actividad fisiolgica, los investigadores contemporneos
aument al tiempo que la TC permaneci estable. Con la buscan patrones especficos de la emocin en la activi-
alegra, la FC fue estable, mientras que aument la TC. dad cerebral (Gray, 1994; LeDoux, 1987; Panksepp, 1982,
Y en el caso del asco, disminuyeron tanto la FC como la 1986). Por ejemplo, los hallazgos neuroanatmicos de
TC. Justo como lo haba sospechado James, las diferentes Jeffrey Gray (1994; trabajos con animales no humanos)
emociones realmente s producan pautas distinguibles documentan la existencia de tres circuitos neurales dife-
de actividad corporal. renciados dentro del cerebro, cada uno de los cuales re-
Existe evidencia convincente de actividad en el sis- gula un patrn especfico de conducta emocional: 1) un
tema nervioso autnomo (SNA) que se asocia con el sistema de aproximacin conductual que prepara al ani-
enojo, el temor, el asco y la tristeza (Ekman y Davidson, mal para buscar e interactuar con oportunidades ambien-
1993; Ekman et al., 1983; Levenson, 1992; Levenson, tales atractivas, 2) un sistema pelea-huida que prepara al
Carstensen, Friensen y Ekman, 1991; Levenson, Ekman animal para huir de sucesos aversivos, pero tambin para
y Friensen, 1990; Sinha y Parsons, 1996; Stemmler, 1989). defenderse de manera agresiva en contra de otros y 3) un
Estas pautas de actividad del SNA supuestamente emer- sistema de inhibicin conductual que dispone al animal
gieron porque podan movilizar formas de comporta- para inmovilizarse ante sucesos aversivos. Estos circuitos
miento que resultaron ser adaptativas. Por ejemplo, en neurales subyacen a las cuatro emociones: alegra, temor,
una pelea que despierta el enojo, un aumento en la fre- rabia y ansiedad.
cuencia cardiaca y en la temperatura cutnea facilitan un
comportamiento fuerte y asertivo. Algunas de las impli- REAS ESPECFICAS DEL CEREBRO
caciones de la actividad especfica de las emociones del El captulo 3 trat acerca de las bases neurolgicas (cere-
SNA se discuten en el apartado 12. brales) de la emocin. Distintas partes de la amgdala ge-
Sin embargo, slo algunas emociones tienen pautas neran emociones negativas diferentes, incluyendo temor,
distintivas de actividad del SNA. Si ninguna pauta espec- enojo y ansiedad. La corteza prefrontal izquierda genera
fica de conducta tiene un valor adaptativo para una emo- alegra y afecto positivo; la corteza prefrontal derecha ge-
cin, hay pocas razones para que se desarrolle un patrn nera temor y afecto negativo. En trminos ms genera-
especfico de actividad en el SNA (Ekman, 1992, 1994a). les, las vas dopaminrgicas a lo largo del sistema lmbico
Por ejemplo, cul sera el patrn conductual ms adap- subyacen al afecto positivo. La idea bsica es que las reas
tativo para los celos? Para la alegra? La esperanza? En cerebrales subcorticales (no cognitivas), al activarse, son
el caso de estas emociones, ninguna actividad adaptativa totalmente capaces de generar y regular emociones espe-
nica parece ser universalmente ms apropiada, ya que cficas.
el afrontamiento adaptativo depende ms de las especifi-
cidades de una situacin que de la emocin misma. Por ACTIVACIN NEURAL
ende, hay poca razn para esperar que evolucione una Las diferentes emociones se activan por distintas tasas de
pauta especfica nica de actividad en el SNA. descargas neurales corticales (Tomkins, 1970). La descar-
Al discutir la teora James-Lange de la emocin, la ga neural se refiere al patrn de actividad electrocortical
pregunta fundamental es si la activacin fisiolgica causa, (en el cerebro) en cualquier momento dado. Segn Silvan
o sigue a, la activacin emocional. Esta pregunta es im- Tomkins, existen tres patrones bsicos de descarga neural:
portante porque si la activacin ocasiona la emocin, en- la actividad aumenta, la actividad disminuye o la actividad
tonces el estudio de la activacin fisiolgica se convierte permanece constante. El que la tasa de descarga neural
en la piedra angular de cualquier comprensin de la emo- aumente, disminuya o permanezca constante depende
cin. Pero si la activacin nicamente sigue y aumenta principalmente de sucesos ambientales. Por ejemplo, si
la emocin, la actividad fisiolgica es, por ende, mucho usted est durmiendo (tasa baja de descarga neural, me-
menos importante; digna de mencin, pero no vital. En dida por medio de un electroencefalograma o EEG) y un
trminos generales, los investigadores contemporneos gato le brinca a la cara (un evento estimulante), la tasa
concuerdan en que la activacin fisiolgica acompaa, de descarga neural aumentar. Si usted se encuentra en
248 CAPTULO 12 Aspectos de la emocin

A PARTADO 12

Computacin afectiva emotividad del usuario. As, un juego de computadora puede ha-
cerse ms o menos desafiante. Un programa de tutora se puede
ajustar para disminuir el temor, digamos, al volver a presentar
Pregunta: Por qu es importante esta informacin? informacin familiar en lugar de informacin nueva y estresante.
Respuesta: Porque lo ayudar a prepararse para las tecnolo- Una sesin de orientacin en lnea puede proporcionar realimen-
gas futuras que leer y se adaptarn a sus emociones. tacin emocional en cuanto a los sentimientos de un cliente en
distintos puntos de la conversacin. Esta realimentacin sera
El hallazgo de que las emociones muestran una especificidad de particular utilidad durante una orientacin a distancia (el
en el SNA tiene implicaciones intrigantes para la tecnologa ve- cliente se encuentra en un sitio mientras que el terapeuta est
nidera. Si los cambios en la presin sangunea y la temperatu- en un lugar distinto).
ra de la piel pueden distinguirse de manera confiable entre las Pero aun el mejor ratn emocional seguir estando limita-
emociones como enojo, temor, tristeza, felicidad y asco, de tal do al monitoreo de las cinco emociones: enojo, temor, tristeza,
forma que un estetoscopio y un termostato electrnicos pueden alegra y asco (es decir, slo aquellas emociones que muestran
detectar estos cambios corporales, entonces podemos construir una especificidad en el SNA). A fin de expandir la capacidad
mquinas que sabrn cmo nos sentimos. Las mquinas que de la computadora para rastrear y analizar emociones adicio-
lean nuestras emociones no tardan en llegar. nales, una cmara digital, telfono celular o cmara de video
Imagine sensores electrnicos integrados a volantes, telfo- podra monitorear y, con el software adecuado, analizar las
nos mviles y manubrios de bicicletas, simuladores de vuelo, expresiones faciales. Este tipo de cmara podra rastrear los
palancas de mando y palos de golf que constantemente monito- movimientos de la cara del usuario: sus msculos frontal, su-
reen la activacin del SNA del usuario mientras conduce, habla y perciliar, orbicular de los prpados, cigomticos, nasal, depre-
dems actividades. Imagine sensores electrnicos en un dispo- sores, orbicular de los labios y cuadrados de los labios (vase
sitivo sostenido por los miembros del pblico durante obras de la figura 12.3). Con estos movimientos faciales, la computado-
teatro, conferencias, conciertos y debates polticos. ra obtiene los datos necesarios para inferir tanto la presencia
Dentro de poco usted no tendr que imaginarse tal tecnolo- como la intensidad del enojo, temor, angustia, asco, alegra,
ga ya que los cientficos en el nuevo campo de la computacin inters y desprecio.
afectiva estn dedicados a la construccin de estos dispositivos Las computadoras pueden analizar e interpretar los mscu-
(Azar, 2000; vase tambin Soon: Computers that know that los faciales del usuario porque algunos investigadores ya han
you hate them, en Pronto: computadoras que saben que usted las desarrollado un sistema complejo de codificacin que se deno-
odia, New York Times, 6 de enero, 2000). Una invencin particu- mina sistema de codificacin de accin facial o FACS, por sus
larmente interesante es el ratn emocional. Funciona como siglas en ingls (facial action coding system) (Ekman y Friesen,
ratn de cmputo ordinario, slo que tiene sensores especiales 1978). Ya existe un software basado en el FACS. Las computa-
que miden la frecuencia cardiaca, la temperatura cutnea, los doras que utilizan estos programas son casi tan precisas (y mu-
movimientos de las manos y la respuesta galvnica de la piel. cho ms veloces) que las personas que califican estos mismos
La computadora monitorea los datos reunidos por el ratn emo- movimientos faciales (Cohn, Zlochower, Lien y Kanade, 1999). El
cional y analiza estos datos como medio para inferir el estado que las computadoras sean capaces de reconocer las expresio-
emocional del usuario. nes emocionales de las personas en forma instantnea parece
Si la computadora puede leer las emociones del usuario, ser slo cuestin de tiempo (Ekman y Friesen, 1975; Ekman y
entonces tendr la capacidad de ajustar su programacin a la Rosenberg, 1997).

un concierto de rock (otro suceso estimulante) y sale a A temor, aumento dramtico A sorpresa). Si la descar-
una calma relativa, la tasa de descarga neural disminuir. ga neural alcanza y se sostiene en un nivel elevado, esta
En otras ocasiones, la actividad neural es constante, como descarga constante (y elevada) activa ya sea la angustia o
cuando hay un esfuerzo cognitivo persistente al leer el pe- el enojo, dependiendo de la magnitud de la estimulacin
ridico. neural (es decir, continuamente elevada A angustia, con-
Con estos tres patrones bsicos de descarga neural, la tinuamente muy elevada A enojo). Por ltimo, si la des-
persona est equipada para casi cualquier suceso vital im- carga neural disminuye, se activa la alegra, mientras el
portante. Si la descarga neural aumenta de manera sbita, individuo se re y sonre de alivio. La relacin entre cada
la persona experimenta una clase de emocin sorpresa, uno de estos cambios en la tasa de descarga neural y su
temor o inters, y la emocin especfica depende de la emocin asociada aparecen en la figura 12.1
brusquedad del aumento en la tasa de la descarga neural Considere la actividad neural de un pblico que mira
(es decir, aumento ligero A inters, aumento moderado una pelcula de terror. Primero, al pblico se le presentan
Aspectos biolgicos de la emocin 249

Sorpresa Temor Inters

Tasa de descarga neural


Enojo

Angustia

Alegra

Tiempo (segundos)

Figura 12.1 Activacin de la emocin en funcin de los cambios en la tasa de descarga neural.
Fuente: Tomado de S.S. Tomkins, Affect as the Primary Motivational System, en M.B. Arnolds, ed., Feelings and emotions 1970, Nueva York, Academic Press, pp.
101-110.

lentamente los personajes, el entorno y las circunstancias Las diez emociones discretas que se adecuan a estos
de la trama. La exposicin a toda esta nueva informacin cinco postulados aparecen en el cuadro 12.2. Cada emo-
aumenta la tasa de descarga neural de manera gradual, y cin, segn la teora de las emociones diferenciales, opera
el pblico muestra inters. Repentinamente, un loco con como sistema que coordina componentes de sentimiento
un hacha salta de detrs de unos arbustos, un suceso que (postulado 2), expresin (postulado 3), actividad neu-
aumenta la descarga neural del pblico en forma drstica ral (postulado 4) y propsito/motivacin (postulado 5).
y que activa la sorpresa. Ms adelante, el pblico observa Ntese la correspondencia tan cercana que existe entre
mientras el protagonista se mueve a travs de un bosque estos cuatro aspectos de la emocin y los cuatro aspectos
oscuro y ve cosas extraas. La descarga neural del pblico de la emocin que se introdujeron al inicio del captulo 11
se acelera y despierta temor; si la descarga neural perma- (vase la figura 11.1)
nece elevada, genera angustia. De modo que el escritor se La teora de las emociones diferenciales argumenta
asegura de incluir una broma o dos y hace que el hroe y que estas diez emociones discretas actan como sistemas
la herona sometan al loco en la parte final, sucesos que motivacionales que preparan al individuo para actuar en
disminuyen la tasa de descarga neural y producen alegra. forma adaptativa (Izard, 1989, 1991, 1992). Cada emo-
cin existe para proporcionarle al individuo una heurs-
tica organizada para lidiar de manera eficaz con tareas y
Teora de las emociones diferenciales problemas vitales que son tanto importantes como re-
La teora de las emociones diferenciales toma su nombre currentes (por ejemplo, establecimiento de lazos sociales,
de la importancia que da esta teora a las emociones bsi- confrontacin de amenazas).
cas que sirven a propsitos motivacionales nicos o dife- Al ver la lista de emociones del cuadro 12.2 segu-
rentes (Izard, 1991, 1992, 1993; Izard y Malatesta, 1987). ramente surgir la siguiente pregunta: dnde estn las
La teora plantea los siguientes postulados (Izard, 1991): emociones como los celos, la esperanza, el amor, el odio,
1. Existen diez emociones que constituyen el sistema la presuntuosidad y la preocupacin? En trminos gene-
motivacional principal de los seres humanos. rales, las teoras de orientacin biolgica no cuentan a
las experiencias de este tipo entre las emociones bsicas.
2. Sentimiento nico: cada emocin tiene su propia
Paul Ekman (1992) ofrece siete razones para explicar el
cualidad fenomenolgica subjetiva nica.
porqu:
3. Expresin nica: cada emocin tiene su propio pa-
trn expresivo-facial nico. 1. Existen familias de emocin, de tal suerte que mu-
4. Actividad neural nica: cada emocin tiene su propia chas emociones no bsicas son derivados basados en
tasa especfica de descarga neural que la activa. la experiencia de una nica emocin bsica (p. ej., la
5. Propsito/motivacin nica: cada emocin genera ansiedad es un derivado del temor).
propiedades motivacionales diferenciadas y tiene 2. Muchos trminos emocionales en realidad describen
funciones adaptativas. estados de nimo (p. ej., irritacin).
250 CAPTULO 12 Aspectos de la emocin

CUADRO 12.2 Las diez emociones fundamentales incluidas en la teora de las emociones diferenciales de Izard.

Emociones positivas Emociones neutrales Emociones negativas


Inters Sorpresa Temor
Alegra Enojo
Asco
Angustia
Desprecio
Vergenza
Culpa

3. Muchos trminos emocionales en realidad describen programas mandan impulsos a los ganglios basales y ner-
actitudes (p. ej., odio). vios faciales a fin de generar expresiones faciales discretas
4. Muchos trminos emocionales en realidad describen (nm. 3). Unos microsegundos despus de la presenta-
rasgos de personalidad (p. ej., hostilidad). cin de la expresin facial de temor (nm. 4), el cerebro
5. Muchos trminos emocionales en realidad describen interpreta la estimulacin propioceptiva (cules mscu-
trastornos (p. ej., depresin). los se contraen, cules msculos se relajan, los cambios
en el flujo sanguneo, cambios en la temperatura cutnea,
6. Algunas emociones no bsicas son combinaciones de
secreciones glandulares [nm. 5]). Este patrn particular
emociones bsicas (p. ej., el amor romntico combina
de realimentacin facial se integra a nivel cortical se
inters, alegra y el impulso sexual).
le interpreta para dar lugar al sentimiento subjetivo de
7. Muchas palabras emocionales se refieren a aspectos temor (nm. 6). Slo entonces es que el lbulo frontal de
especficos de una emocin bsica (p. ej., lo que evoca la corteza se percata del estado emocional a nivel cons-
una emocin [aoranza] o la manera en que se com- ciente. Casi inmediatamente despus, el cuerpo comple-
porta la persona [agresin]). to se une a la realimentacin facial para involucrarse en
la emocin del temor mientras los sistemas glandular-
hormonal, cardiovascular y respiratorio se activan para
Hiptesis de la realimentacin facial amplificar y preservar la experiencia activada de temor.
De acuerdo con la hiptesis de la realimentacin facial, el La realimentacin facial lleva a cabo un trabajo: la ac-
aspecto subjetivo de la emocin se deriva de los sentimien- tivacin emocional (Izard, 1989, 1994). Una vez que se
tos engendrados por: 1) los movimientos de la muscu- activa la emocin, es el programa emocional, no la reali-
latura facial, 2) los cambios en la temperatura facial y mentacin facial, el que entonces recluta la participacin
3) los cambios en la actividad glandular de la piel de la cognitiva y corporal adicional para mantener la experien-
cara. Por ende, las emociones son conjuntos de respues- cia emocional a lo largo del tiempo. Es entonces que la
tas musculares y glandulares localizadas en el rostro persona toma conciencia y monitorea no su realimenta-
(Tomkins, 1962). En otras palabras, la emocin es tomar cin facial, sino sus cambios en frecuencia cardiaca, res-
conciencia de la realimentacin propioceptiva de la con- piracin, tono muscular, postura y dems.
ducta facial. La accin facial tambin cambia la temperatura del
Es posible que al presentrsele la hiptesis de que cerebro, de tal forma que los movimientos faciales aso-
la emocin es informacin proveniente de la realimen- ciados con emociones negativas (tristeza) constrien la
tacin facial, el lector se sienta un tanto escptico: por respiracin, aumentan la temperatura cerebral y produ-
favor sonrer te hace feliz? Pero considere la siguiente cen sentimientos negativos, mientras que los movimien-
secuencia de eventos que se presenta en la figura 12.2 para tos faciales asociados con emociones positivas (felicidad)
comprender cmo las sensaciones de la cara realimentan aumentan la respiracin, disminuyen la temperatura
a la corteza del cerebro para producir la experiencia emo- cerebral y producen sentimientos positivos (McIntosh,
cional (Izard, 1991). La exposicin a un suceso externo Zajonc, Vig y Emerick, 1997; Zajon, Murphy e Inglehart,
(ruido estrepitoso) o interno (el recuerdo de haber sufri- 1989). Para darle sentido a lo anterior, haga una expre-
do algn dao) aumenta la tasa de descarga neural con sin facial de tristeza y vea si la accin facial alrededor
la suficiente velocidad como para producir un programa de su nariz no limita el flujo de aire hasta cierto punto.
subcortical de emocin tal como temor (nm. 1 en la fi- Asimismo, haga una expresin facial de alegra y vea si
gura 12.2). El cerebro subcortical (sistema lmbico) posee esa accin facial (p. ej., levantar las mejillas) no alienta y
programas especficos de emocin innatos y preprogra- abre el flujo de aire nasal. Los cambios en la temperatura
mados de manera gentica (nm. 2). Al activarse, estos cerebral s tienen consecuencias emocionales (leves).
Aspectos biolgicos de la emocin 251

Neocorteza 2. Sistema lmbico


Suceso interno
 +LSRWiODPR
o externo 1. Tasa de descarga neural  *DQJOLRVEDVDOHV

6. Integracin cortical
de la informacin de la
realimentacin facial:
experiencia

5. Recepcin de la informacin 3. Impulsos generados


de la accin facial en la corteza motora
en la corteza sensorial y enviados al rostro

Nervio trigmino; Nervio facial;


nervio craneal V nervio craneal VII

4. Accin facial
 &DPELRVHQODPXVFXODWXUDIDFLDO
 &DPELRVHQODWHPSHUDWXUDIDFLDO
 &DPELRVHQODVJOiQGXODVIDFLDOHV

Figura 12.2 Secuencia de los sucesos activadores de emocin segn la hiptesis de la realimentacin facial.

MUSCULATURA FACIAL adicionales que se asocian con un patrn particular de


Existen 80 msculos faciales, 36 de los cuales estn in- conducta facial: inters (Reeve, 1993) y desprecio (Ekman
volucrados en la expresin facial. No obstante, para pro- y Friesen, 1986). La expresin de inters se ilustra en die-
psitos de exposicin, los ocho msculos faciales que se ciocho de las diecinueve caras que se muestran en la figu-
muestran en la figura 12.3 son suficientes para diferenciar ra 12.5 (en todas a excepcin de la del nio en la esquina
entre las emociones bsicas (para mayor informacin, inferior derecha). Para expresar inters, el orbicular de los
vase Ekman y Friesen, 1975; Izard, 1971). La parte supe- prpados los abre y el orbicular de los labios hace que la
rior del rostro (los ojos y la frente) tienen tres msculos boca se abra ligeramente (observe las posiciones nicas
principales: el frontal (cubre la frente), el superciliar (de- de los ojos y la boca). En el caso del desprecio, el cigom-
bajo de cada ceja) y el orbicular de los prpados (rodea a tico levanta la comisura de los labios en forma unilateral.
cada ojo). La parte media de la cara tiene dos msculos Al expresar desprecio, la persona grue levantando un
principales: el cigomtico (se extiende desde las comisu- lado de la boca. El orgullo tambin se puede reconocer
ras de la boca y hasta el pmulo) y el nasal (arruga la na- universalmente, aunque el orgullo se expresa con mucho
riz). La parte inferior de la cara cuenta con tres msculos ms que la cara (es decir, mediante sonrisa pequea, ca-
principales: el depresor (arrastra las comisuras de la boca beza inclinada ligeramente hacia atrs, postura expan-
hacia abajo), el orbicular de los labios (msculo circular dida, brazos en jarras con las manos sobre las caderas;
que rodea los labios) y el cuadrado de los labios (jala las Tracy y Robins, 2008).
comisuras de la boca hacia atrs).
Las pautas de conducta facial producen emociones COMPROBACIN DE LA HIPTESIS
discretas. Por ejemplo, el enojo, el temor, el asco, la an- DE LA REALIMENTACIN FACIAL
gustia y la alegra tienen expresiones faciales reconoci- La hiptesis de la realimentacin facial (HRF) afirma que
bles. Estas expresiones faciales se describen msculo por la realimentacin proveniente de la conducta facial, al
msculo en palabras en la figura 12.3 y en imgenes en la volverse activamente consciente, constituye la experien-
figura 12.4 (Ekman y Friesen, 1975). Hay dos emociones cia de la emocin (Laird, 1974; Tomkins, 1962, 1963).
252 CAPTULO 12 Aspectos de la emocin

Frontal

Superciliar

Orbicular
de los prpados
Nasal

Cigomtico

Cuadrado
Orbicular de los labios
de los labios
Depresor

Msculo facial Enojo Temor Asco Tristeza Alegra


Frontal n/a contrae, n/a n/a n/a
(Frente) produciendo
arrugas en la frente
Superciliar mueve las cejas levanta los extremos n/a levanta y junta las n/a
(Cejas) hacia dentro internos de las cejas comisuras internas
y abajo de los prpados
Orbicular tensa los prpados levanta los prpados n/a levanta las relaja, mostrando arrugas
de los prpados inferiores hacia superiores, tensa comisuras internas debajo de los ojos
(Ojos) arriba los prpados superiores de los
inferiores prpados
Nasal n/a n/a arruga la nariz n/a n/a
(Nariz)
Cigomtico n/a n/a levanta n/a 1. jala las comisuras de los
(Mejillas) las mejillas labios hacia atrs y arriba
2. levanta las mejillas,
mostrando patas de gallo
debajo de los ojos
Orbicular presiona los labios n/a levanta el labio n/a n/a
de los labios firmemente superior
(Labios)
Cuadrado n/a jala los labios n/a n/a n/a
de los labios hacia atrs
(Quijada)
Depresor n/a n/a n/a jala las comisuras n/a
(Boca) de los labios hacia
abajo

Figura 12.3 Los ocho msculos faciales principales involucrados en la expresin de emociones.
Aspectos biolgicos de la emocin 253

Temor Enojo

Asco Alegra Angustia

Figura 12.4 Expresiones faciales para cinco emociones.

Las investigaciones para comprobar la validez de la HRF un cuestionario. Las investigaciones han estado susten-
han utilizado dos metodologas distintas, porque existen tadas (Laird, 1974, 1984; Larsen et al., 1992; Rutledge y
dos versiones comprobables de la HRF: la versin fuer- Hupka, 1985; Strack, Martin y Stepper, 1988), como re-
te y la versin dbil (McIntosh, 1996; Rutledge y Hupka, futadas (McCaul, Holmes y Solomon, 1982; Tourangeau
1985). y Ellsworth, 1979) la versin fuerte de la HRF. Un rea de
En su versin fuerte, la HRF propone que manipular consenso coincide en que una musculatura facial fingida
la propia musculatura facial en una forma que corres- produce cambios confiables en las reacciones fisiolgicas,
ponda a una exhibicin de emocin (p. ej., vase la figu- como cambios en las tasas cardiovascular y de respiracin
ra 12.4) activar dicha experiencia emocional. En otras (Ekman et al., 1983; Tourangeau y Ellsworth, 1979). An
palabras, arrugar los labios y levantar la parte interior de se sigue debatiendo si la musculatura facial fingida pro-
las cejas activa la tristeza (recuerde el ejemplo al inicio duce una experiencia emocional, pero la mayora de los
del presente captulo). En pruebas empricas, el experi- estudios sugieren que s produce al menos un efecto pe-
mentador instruye al participante para contraer y relajar queo (Adelman y Zajonc, 1989; Izard, 1990; Laird, 1984;
msculos especficos de la cara y, con una expresin fa- Matsumoto, 1987; Rutledge y Hupka, 1985).
cial ensayada, que conteste un cuestionario para la eva- En su versin dbil (ms conservadora), la HRF pro-
luacin de la experiencia emocional. Por ejemplo, en un pone que la realimentacin facial modifica la intensidad
estudio, a los participantes se les indic: 1) levante las de la emocin (en lugar de ocasionarla). As, manipular
cejas y jntelas, 2) ahora, levante sus prpados superio- la musculatura facial propia en una exhibicin emocio-
res y 3) ahora jale sus labios en forma horizontal, hacia nal particular aumentar (exagerar), pero no necesaria-
sus orejas (Ekman et al., 1983). Una vez que mostraran mente activar (ocasionar) la experiencia emocional.
la expresin indicada, a los participantes se les pregunt En otras palabras, si de manera deliberada usted sonre
acerca de su estado emocional (en este caso, temor) en cuando ya siente alegra, entonces experimentar una
254 CAPTULO 12 Aspectos de la emocin

Una serie de investigaciones transculturales sometie-


ron a prueba la propuesta de que los seres humanos exhi-
ben expresiones faciales similares independientemente
de las diferencias culturales (Ekman, 1972, 1994b; Izard,
1994). En cada uno de estos estudios, representantes de
diversas nacionalidades miraron tres fotografas, cada
una de las cuales mostraba una expresin facial distin-
ta (Ekman, 1972, 1993; Ekman y Friesen, 1971; Ekman,
Sorenson y Friesen, 1969; Izard, 1971, 1980, 1994). De
entre estas fotografas, los participantes elegan, por me-
dio de un formato de opcin mltiple, la fotografa que
pensaban expresaba mejor una emocin particular. Por
ejemplo, a los participantes se les mostraron fotografas
de tres caras, una que expresaba enojo, otra que expresa-
ba alegra y otra que expresaba temor. Los participantes
seleccionaban la imagen que pensaban mostraba la forma
en que se vera la cara si la persona se topara con una
Figura 12.5 Dieciocho expresiones faciales de inters. injusticia o con un obstculo frente a su meta (es decir,
enojo). La pregunta de investigacin es si personas de
diversas culturas estaran de acuerdo en cuanto a qu ex-
presin facial corresponde con qu experiencia emocio-
alegra ms intensa. En un experimento, los participan- nal. El hallazgo de que las personas de culturas distintas
tes exageraron o suprimieron sus expresiones faciales es- (culturas distintas, idiomas diferentes, nacionalidades di-
pontneas al ver un video que presentaba una situacin versas) equiparan las mismas expresiones faciales con las
agradable, neutra o desagradable (Zuckerman, Klorman, mismas emociones es evidencia de que el comportamien-
Larrance y Spiegel, 1981). La exageracin de expresiones to facial es universal en trminos transculturales (Ekman,
faciales de ocurrencia natural s aument la experiencia 1994b; Ekman y Friesen, 1971; Izard, 1971).3 Esto es evi-
tanto emocional como fisiolgica, justo del mismo modo dencia de que la conducta facial relacionada con la emo-
que suprimir las expresiones faciales de ocurrencia natu- cin tiene un componente innato no aprendido.
ral atenu la experiencia tanto emocional como fisiolgi- A fin de examinarse a s mismo de la misma manera
ca (Lanzetta, Cartwright-Smith y Kleck, 1976). en que se hizo con los participantes de los experimentos
A diferencia de su versin ms fuerte, la versin d- transculturales, observe las fotografas que se muestran
bil de la HRF ha recibido mayor apoyo (McIntosh, 1996; en la figura 12.6. Las fotografas muestran cuatro expre-
Soussignan, 2002). Estos resultados destacan la doble va siones distintas de un nativo de Nueva Guinea (alguien
entre las emociones que sentimos y las emociones que ex- perteneciente a una cultura distinta a la suya). Su tarea es
presamos; las emociones activan las expresiones faciales identificar la cara de alguien que acaba de toparse con un
y las expresiones faciales, a su vez, se realimentan para objeto contaminado (es decir, de asco).
exagerar y suprimir las emociones que sentimos. No obs-
tante, los crticos argumentan que la contribucin de esta PODEMOS CONTROLAR NUESTRAS EMOCIONES
realimentacin facial es pequea y que hay otros factores
EN FORMA VOLUNTARIA?
ms importantes (Matsumoto, 1987).
Una pregunta fascinante que se plantean los investiga-
LAS EXPRESIONES FACIALES DE EMOCIN SON dores de la emocin es: es posible controlar nuestras
UNIVERSALES EN DISTINTAS CULTURAS?
emociones en forma voluntaria? (Ekman y Davidson,
La hiptesis de la realimentacin facial supone que las
3 Las investigaciones con lactantes sustentan la idea de que el
expresiones faciales son innatas. Pero, seguramente, gran
comportamiento facial tiene un poderoso componente innato (Izard
parte de la conducta facial es aprendida. Es raro el indivi- et al., 1980) ya que los lactantes presocializados exhiben expresiones
duo que no ha aprendido a expresar una sonrisa educada faciales diferenciadas e identificables. Los nios ciegos, que no
y a inhibir el rostro enojado cuando habla con su jefe. tienen la oportunidad de aprender las expresiones faciales de los
Pero el hecho de que parte de la conducta facial es apren- otros a travs del modelamiento y la imitacin, exhiben las mismas
expresiones faciales reconocibles que nios videntes de la misma
dida (y, por tanto, bajo control voluntario) no descarta
edad (Goodenough, 1932). Los nios con alteraciones mentales
la posibilidad de que la conducta facial tambin tiene un graves, que tienen dificultades para aprender nuevas conductas
componente gentico e innato, como lo plantean los pro- motoras, tambin muestran expresiones completas de sus emociones
ponentes de la HRF. (Eibl-Eibesfeldt, 1971).
Aspectos cognitivos de la emocin 255

1994). Podemos sentirnos felices o no sentir miedo a


voluntad? La dificultad para proporcionar una respues-
ta definitiva emerge cuando se recuerda que las emo-
ciones tienen cuatro aspectos: sentimientos, activacin,
propsito y expresin. La naturaleza multidimensional
de la emocin nos lleva a preguntarnos si los sentimien-
tos, frecuencia cardiaca y estados fisiolgicos, deseos
motivacionales y expresiones faciales son controlables.
Sin embargo, al tratar de responder a la pregunta ms
general, es claro que algunas emociones sencillamente
nos suceden y que, por ende, no se nos puede respon-
sabilizar por los sentimientos, fisiologa, deseos y con-
ductas involuntarias que de all surgen (Ekman, 1992,
1994a).4 Por otra parte, todos tenemos cierta dificultad
para evocar ciertas emociones en forma deliberada: va-
lenta, amor, optimismo, inters, y otras. Es muy difcil
decir, muy bien, ahora voy a experimentar alegra. Ms
bien, se necesita una exposicin a un suceso generador
de emocin capaz de evocar ese estado emocional espe-
cfico. En gran medida, las emociones son reacciones y
se necesita algn suceso al cual reaccionar antes de que
se evoque la emocin.
Si, en gran parte, las emociones son fenmenos bio-
lgicos gobernados por estructuras y vas subcorticales,
tendra sentido que mucho de lo que son las emociones
escapar a nuestro control voluntario. Sin embargo, si
en gran medida las emociones son fenmenos cogniti-
vos que estn gobernados por pensamientos, creencias
y formas de pensar, lo que tendra sentido es que una
buena parte de la experiencia emocional se pueda con-
Figura 12.6 Cul expresin facial expresa asco? La fotografa
trolar en forma voluntaria, al menos al grado en que se
GHOQDWLYRGH1XHYD*XLQHDTXHHVWiH[SUHVDQGRDVFRDSDUHFH
pueden controlar voluntariamente nuestros pensamien- en la esquina inferior derecha. En el sentido de las agujas
tos, creencias y formas de pensar. Esta perspectiva nos del reloj, desde la esquina inferior izquierda, se encuentran
introduce a la discusin de los aspectos cognitivos de la expresiones de enojo, alegra y angustia.
emocin.

Aspectos cognitivos de la emocin


Para aquellos que estudian la emocin desde un punto de la emocin. Las emociones s emergen a partir de proce-
vista cognitivo, social o cultural, los sucesos biolgicos sos biolgicos. Pero tambin surgen a partir del procesa-
no son, por necesidad, los aspectos ms importantes de miento de la informacin, la socializacin y los contex-
tos culturales. Por ejemplo, un anlisis puramente biol-
4 La experiencia cotidiana confirma que podemos regular las gico que se centre en los circuitos cerebrales subcortica-
emociones de forma voluntaria una vez que nos suceden, al les, la actividad autnoma y del sistema endocrino y las
menos hasta cierto grado. De manera intencional, enmascaramos expresiones faciales no puede llevar a una comprensin
y ocultamos nuestro temor antes de saltar en paracadas y de emociones como esperanza, orgullo y alienacin.
suprimimos nuestro aburrimiento al escuchar la conversacin de
La decepcin no surge de la actividad del SNA o de los
otra persona. Debido a que s podemos regular nuestras emociones,
principalmente a travs de la inhibicin (Levenson, 1994a), somos cambios en la expresin facial, sino, en lugar de esto, de
un tanto responsables de nuestra emotividad (p. ej., lo enojados o una comprensin cognitiva, social y cultural de no ob-
tristes que nos ponemos y el tiempo que estaremos as). Por ende, tener lo que uno haba esperado (Van Dijk, Zeelenberg
la aparicin inicial de la emocin es lo difcil de controlar. Pero y Van der Pligt, 1999). Lo mismo se podra decir de la
nuestra capacidad de regulacin emocional nos permite tener
vergenza (no haber hecho lo que se esperaba de uno)
cierto control sobre la intensidad del aumento y disminucin de
nuestras emociones una vez que las experimentamos (Ekman, 1992; y de muchas otras emociones complejas (a diferencia de
Levenson, 1994a). las bsicas).
256 CAPTULO 12 Aspectos de la emocin

Valoracin la culpa (si tan slo no hubiera) (Niedenthal, Tangney


y Gavanski, 1994). Las emociones siguen a las valoracio-
El constructo central en la comprensin cognitiva de la nes. Al cambiar la valoracin, cambia la emocin. Una de
emocin es la valoracin (Frijda, 1993; Scherer, Schorr y las primeras tericas cognitivas fue Magda Arnold (1960,
Johnstone, 2001; Smith, Haynes, Lazarus y Pope, 1993). 1970). Ella especific la forma en que las valoraciones, la
Una valoracin es un clculo de la importancia personal neurofisiologa y la activacin trabajan en conjunto para
de un suceso: es significativo este suceso vital?, este su- producir la experiencia y expresin de la emocin al en-
ceso tiene implicaciones para mi bienestar? focarse en tres preguntas: 1) cmo es que la percepcin
Todos los tericos cognitivos de la emocin ratifican de un objeto o suceso produce una valoracin buena o
las siguientes dos creencias interrelacionadas (Frijda, mala?; 2) cmo es que la valoracin genera emocin? y;
1986; Lazarus, 1991a; Ortony et al., 1988; Roseman, 1984; 3) cmo es que la emocin sentida se expresa en accio-
Scherer, 1984a; Smith y Ellsworth, 1985; Weiner, 1986): nes? La innovadora teora de la valoracin para la emo-
1) las emociones no suceden sin una valoracin cognitiva cin de Arnold se resume en la figura 12.7.
antecedente del suceso y 2) es la valoracin, no el suceso
mismo, lo que ocasiona la emocin. DE LA PERCEPCIN A LA VALORACIN
Considere a una nia que ve venir a un hombre. De Segn Arnold, las personas valoran sucesos y objetos
manera inmediata y automtica, la nia valora el acer- estmulo de manera categrica como positivos o negati-
camiento del hombre como probablemente bueno o vos. A fin de corroborar sus ideas, Arnold prest especial
malo. La valoracin se basa en las caractersticas sobre- atencin a las vas neurolgicas del cerebro. En todo en-
salientes del hombre que se acerca (gnero, expresin fa- frentamiento con el ambiente, las estructuras cerebrales
cial, paso al que se acerca), en las expectativas de quin es del sistema lmbico (p. ej., la amgdala) de manera auto-
el hombre que se acerca, en las creencias acerca de lo que mtica valoran el tono hednico de la informacin sen-
tpicamente hacen las personas que se acercan y en los re- sorial. Por ejemplo, un sonido discordante se valora de
cuerdos de personas que se le han acercado en el pasado. manera instantnea como intrnsecamente desagradable
No es el hombre que se acerca en s lo que explica la cuali- (malo), mientras que el perfume de una rosa se valora
dad de la reaccin emocional de la nia, sino, ms bien, lo como intrnsecamente agradable (bueno). La investiga-
que ella cree acerca de la manera en que se ver afectado cin neuroanatmica reciente confirma las afirmaciones
su bienestar que da vida a su emocin. Si ve que el hom- de Arnold acerca de que el sistema lmbico (y la amg-
bre que se acerca sonre y la saluda con la mano y, ade- dala en particular) es el centro cerebral principal que
ms, ella recuerda que el hombre es su amigo, es probable valora la importancia emocional de un estmulo sensorial
que valore el suceso como bueno. Si ve que el hombre est (LeDoux, 1992a, 1992b). Adems, la mayora de los est-
dando gritos y recuerda que es el bravucn del vecindario, mulos se valoran an ms en un nivel cortical al aadir el
lo ms seguro es que valore el suceso como malo. Estas procesamiento de informacin y, por ende, las expecta-
valoraciones ocasionarn que experimente emociones (y tivas, memorias, creencias, metas, juicios y atribuciones.
tambin cambios corporales fisiolgicos). Si la nia no Por ende, una valoracin completa se sirve tanto de in-
hubiese valorado la relevancia personal del hombre que terpretaciones y evaluaciones subcorticales (del sistema
se acerca, no hubiese tenido una reaccin emocional ante lmbico) como corticales.
l porque los sucesos que no son pertinentes a nuestro
bienestar no generan emociones (Lazarus, 1991a; Ortony DE LA VALORACIN A LA EMOCIN
y Clore, 1989; Ortony et al., 1988). Una vez que el objeto se ha valorado como bueno o
Las valoraciones preceden y evocan emociones. Las malo (como benfico o daino), de manera inmediata y
situaciones y desenlaces no ocasionan emociones en la automtica se sigue la experiencia de agrado o desagrado.
forma en que lo hacen las valoraciones (interpretaciones) Para Arnold, el agrado o desagrado es la emocin sentida.
de dichas situaciones y desenlaces. A fin de reforzar esta
idea, considere el hallazgo contrario a la lgica de que los DE LA EMOCIN EXPERIMENTADA A LA ACCIN
medallistas olmpicos de bronce experimentan una mayor El agrado genera una tendencia motivacional a aproxi-
felicidad posterior a la competencia que los medallistas marse al objeto generador de emociones; el desagrado
olmpicos de plata. Para que esto sea cierto, la valoracin genera una tendencia motivacional a evitarlo. Durante
del atleta acerca de lo que pudo haber sido es al menos tan la valoracin, el individuo depende de la memoria y la
importante como lo que sucedi en realidad (p. ej., pude imaginacin para generar un nmero de posibles cursos
haber ganado la medalla de oro, en lugar de pude no ha- de accin para lidiar con el objeto que ocasion agrado
ber ganado nada) (Medvec, Madey y Gilovich, 1995). El o desagrado. Cuando se toma una decisin en cuanto al
mismo tipo de interpretacin tambin obra en emociones curso de accin, el circuito cerebral hipocmpico activa la
tales como la vergenza (si tan slo no fuera tan) y en corteza motora, lo que conduce a una accin conductual.
Aspectos cognitivos de la emocin 257

VALORACIN EMOCIN ACCIN


SITUACIN
Bueno frente a malo Agrado frente a Aproximacin
Suceso vital
(Benfico frente a daino) desagrado frente a evitacin

Figura 12.7 Teora de la valoracin de Arnold para la emocin.

Las investigaciones contemporneas aaden que el siste- las situaciones como tipos especficos de dao, tipos espe-
ma lmbico tambin tiene acceso directo a los msculos cficos de amenaza o tipos especficos de beneficio (vase
que controlan las expresiones faciales (Holstedge, Kuypers Lazarus, 1991a, 1994).
y Dekker, 1977), a las reacciones de los sistemas autno- Este proceso de valoracin no acaba con el anlisis de
mo y endocrino (Kapp, Pascoe y Bixler, 1984; LeDoux, pertinencia personal, congruencia con las metas y parti-
Iwata, Clicchetti y Reis, 1988) y a los sistemas generales cipacin del yo. Las capacidades percibidas de afronta-
de activacin (tallo cerebral; Krettek y Price, 1978). Las miento continan alterando la forma en que las personas
emociones producen accin a travs de sus efectos sobre interpretan (valoran) la situacin a la que se enfrentan
estos sistemas biolgicos.5 (Folkman y Lazarus, 1990; Lazarus, 1991a, 1991b). La
persona se pregunta a s misma, puedo afrontar el be-
neficio, amenaza o dao potencial al que me enfrento?
Valoracin compleja Puedo concretar el beneficio y puedo evitar el dao o
Al igual que Arnold, Richard Lazarus enfatiz los pro- amenaza? El afrontamiento anticipado cambia la forma
cesos cognitivos que intervienen entre los sucesos vitales en que se valora la situacin (si puedo afrontar la amena-
importantes (condiciones ambientales) y la reaccin fisio- za, entonces no es de gran importancia). Una valoracin
lgica y conductual. Al mismo tiempo que sigui las ideas alterada conduce a un cambio de emocin. Entonces, en
de Arnold como gua, extendi su idea de la valoracin trminos generales, las personas primero valoran su rela-
general bueno/malo antes de una emocin a una concep- cin con el suceso vital (valoracin primaria) y despus
tuacin ms compleja del proceso de valoracin (Lazarus, valoran su potencial de afrontamiento dentro del mismo
1968, 1991a; Lazarus y Folkman, 1984). Como se mues- suceso (valoracin secundaria).
tra adelante, las valoraciones buenas se conceptuaron
en diversos tipos de beneficio, mientras que las valora- VALORACIN PRIMARIA
ciones malas se diferenciaron en varios tipos de dao y La valoracin primaria implica la estimacin de si hay
diversos tipos de amenaza. El marco de las valoraciones algo en juego para uno dentro del encuentro (Folkman,
complejas de Lazarus (1991a) aparece en la figura 12.8. Lazarus, Dunkel-Schetter, DeLongin y Gruen, 1986). En
Al articular una visin ms amplia de la valoracin, la valoracin primaria, se encuentra en juego de mane-
Lazarus seal que las personas evalan si la situacin a ra potencial lo siguiente: 1) salud, 2) autoestima, 3) una
la que se enfrentan tiene una relevancia personal para su meta, 4) el estado financiero, 5) respeto y 6) el bienestar de
bienestar. Cuando el bienestar est en juego, las personas un ser amado. En otras palabras, las valoraciones prima-
evalan el dao, amenaza o beneficio potencial al que se rias preguntan si el bienestar fsico o psicolgico, metas
enfrentan. Para Lazarus (1991a), estas valoraciones toman y estado financiero o relaciones interpersonales propios
la forma de preguntas como: Este suceso es pertinente a estn en juego durante un encuentro en particular. Tan
mi bienestar? Este suceso es congruente con mis metas? pronto como uno de estos seis desenlaces se encuentra en
Qu tan profundamente afectar mi autoestima? Dadas juego, un suceso vital comn se convierte en un estado
estas valoraciones de pertinencia personal, congruencia vital significativo generador de emociones. Por ejemplo,
con las metas y participacin del yo, las personas valoran si al conducir un automvil ste repentinamente se derra-
pa sobre el hielo, el sistema cognitivo de inmediato gene-
5 Una caracterstica importante de la teora de Arnold es que la emocin ra la valoracin primaria de que hay mucho en juego: la
se define en trminos de motivacin. La tendencia a la aproximacin salud personal, la reputacin como conductor hbil, una
o a la evitacin le da una fuerza direccional a la emocin, mientras posesin valiosa (el automvil) y el bienestar fsico y psi-
que los cambios fisiolgicos en los msculos y en las vsceras le dan colgico del pasajero.
energa. Una segunda caracterstica importante de la teora de Arnold
trata a la emocin como constructo unitario, ya que esta terica VALORACIN SECUNDARIA
prefera hablar acerca de las fuerzas emocionales de aproximacin y
evitacin, de atraccin y repulsin y de agrado y desagrado ms que La valoracin secundaria, que sucede despus de cierta
de emociones especficas tales como el enojo, la tristeza o el orgullo. reflexin, incluye la valoracin de la persona en cuanto a
258 CAPTULO 12 Aspectos de la emocin

VALORACIN EMOCIN
Tipo de beneficio
 3URJUHVRKDFLDXQDPHWD  )HOLFLGDG
 $WULEXLUVHHOPpULWRSRUXQORJUR  2UJXOOR
 0HMRUDUXQDFRQGLFLyQDQJXVWLDQWH  2UJXOOR
 &UHHUTXHXQGHVHQODFHGHVHDGRHVSRVLEOH  (VSHUDQ]D
 'HVHDURSDUWLFLSDUHQXQDUHODFLyQGHDIHFWR  $PRU
 &RQPRYHUVHSRUHOVXIULPLHQWRGHRWUR  &RPSDVLyQ
 $SUHFLDUXQUHJDORDOWUXLVWD  *UDWLWXG

Tipo de dao
 9HUVHPHQRVSUHFLDGRSRUXQDRIHQVDSHUVRQDO  (QRMR
SITUACIN  7UDQVJUHGLUXQLPSHUDWLYRPRUDO  &XOSD
Suceso vital  1RHVWDUDODDOWXUDGHXQLGHDOGHO\R  9HUJHQ]D
 ([SHULPHQWDUXQDSpUGLGDLUUHYRFDEOH  7ULVWH]D
 $FHSWDUXQREMHWRRLGHDLQDVLPLODEOH  $VFR

Tipo de amenaza
 (QIUHQWDUVHDXQDDPHQD]DLQFLHUWDHLQHVSHFtILFD  $QVLHGDG
 (QIUHQWDUVHDXQSHOLJURLQPHGLDWR\DEUXPDGRU  6XVWR
 4XHUHUORTXHRWURSRVHH  (QYLGLD
 5HVHQWLUDXQULYDOSRUODSURSLDSpUGLGD  &HORV

Figura 12.8 Valoraciones complejas de Lazarus: tipos de beneficio, dao y amenaza.

su afrontamiento del posible beneficio, dao o amenaza Por ende, no se presenta una hiperactividad del sistema
(Folkman y Lazarus, 1990). El afrontamiento involucra nervioso autnomo (SNA). La falta de descarga del SNA
los esfuerzos cognitivos, emocionales y conductuales de indica que no se requiere un afrontamiento para este su-
la persona para manejar el beneficio, dao o amenaza. ceso vital en particular; los sucesos benignos no generan
Por ejemplo, imagine las opciones de afrontamiento para episodios emocionales. Si se percibe que el suceso vital es
un msico programado a tocar frente a un pblico. El un beneficio potencial, un dao potencial o una amena-
msico podra pedir consejo a un mentor, practicar a lo za potencial, entonces se activa una emocin especfica
largo de la noche, encontrar un medio para escapar, reali- (vase la figura 12.8) y se presenta una hiperactividad del
zar un plan de accin y llevarlo a cabo, imitar el estilo de SNA que ayuda a la persona a prepararse para adaptarse
otro msico, bromear y tomar a la ligera la importancia al suceso vital significativo (Tomaka, Blascovich, Kelsey
del suceso, y as sucesivamente. La experiencia emocional y Leitten, 1993). La activacin del SNA prepara al indivi-
del msico depender no slo de su valoracin inicial del duo para iniciar conductas de aproximacin o evitacin y
beneficio, dao o amenaza potencial de la actuacin de la tambin activa o estimula una valoracin secundaria don-
noche, sino tambin de su reflexin acerca de la eficacia de el individuo considera el grado en el que puede afrontar
potencial de sus estrategias de afrontamiento para con- el suceso vital de manera exitosa. La activacin del SNA
cretar el beneficio o para evitar el dao o la amenaza. indica la necesidad de una valoracin secundaria. Si los
esfuerzos de afrontamiento de aproximacin o evitacin
MODELO DE VALORACIN DE LA EMOCIN del individuo son exitosos, la hiperactividad del SNA em-
El modelo completo de la emocin de Lazarus aparece en pieza a calmarse y el suceso generador de emocin pierde
la figura 12.9. Dado un encuentro con el ambiente un su estatus como episodio emocional porque el beneficio se
suceso vital lo primero que hace el individuo es rea- concreta o la amenaza o dao se disipan. No obstante, si
lizar una valoracin primaria relacionada con la perti- las respuestas de afrontamiento fracasan, la hiperactividad
nencia e importancia personal del suceso. Si no se prev del SNA contina en un nivel elevado y la persona expe-
que el suceso es un beneficio, dao o amenaza potencial, rimenta estrs o ansiedad porque el beneficio se disipa o
entonces se percibe que es irrelevante para el bienestar. porque suceden el dao o la amenaza.
VALORACIN PRIMARIA
Este suceso es pertinente a mi
bienestar?
+D\DOJRHQMXHJRHQHVWHVXFHVRYLWDO"
No se requiere de afrontamiento
Suceso vital  (OVXFHVRUHSUHVHQWDXQEHQHILFLR No hay un episodio emocional
porque no se present una
potencial? En caso entonces
hiperactividad del SNA
 (OVXFHVRUHSUHVHQWDXQGDxR negativo
potencial?
 (OVXFHVRUHSUHVHQWDXQDDPHQD]D
potencial?

En caso afirmativo

Se presenta hiperactividad del SNA a fin


de generar un impulso a la accin
 $SUR[LPDFLyQDXQEHQHILFLRSRWHQFLDO
 (YLWDFLyQGHXQGDxRRDPHQD]D
potencial
Si el afrontamiento tiene
entonces xito, se disminuye Finaliza el episodio emocional
la hiperactividad del SNA

VALORACIN SECUNDARIA
Puedo afrontar de manera exitosa el
beneficio, dao o amenaza potencial a
los que me enfrento?

Si el afrontamiento
fracasa, se conserva Estrs, ansiedad
la hiperactividad del SNA

Figura 12.9 Conceptuacin de Lazarus de la emocin como proceso.


Aspectos cognitivos de la emocin
259
260 CAPTULO 12 Aspectos de la emocin

MOTIVACIN ende, el orgullo). A la larga, si uno conociera la pauta


La descripcin de la emocin que hace Lazarus es mo- total de las valoraciones de la persona, sera una tarea
tivacional. Una persona trae motivos personales (metas, bastante clara predecir la emocin resultante que expe-
bienestar) a una situacin. Cuando hay motivos perso- rimentara.
nales en juego, se siguen las emociones. Adems, las A fin de explicar la complejidad total de las emocio-
emociones cambian de manera constante a medida que nes, los tericos han argumentado en favor de la impor-
se modifican las valoraciones primarias y secundarias. tancia tanto de: 1) las valoraciones compuestas como de
El proceso total de la emocin se caracteriza no tanto las 2) dimensiones adicionales de la valoracin. Las di-
por la secuencia lineal de suceso vital A valoracin A mensiones de la valoracin empiezan con la valoracin
emocin, sino por el cambio constante en el estatus de agradable-desagradable de Arnold y tambin con la im-
los motivos propios. Los sucesos vitales ofrecen benefi- portancia personal y potencial de afrontamiento (valora-
cios, daos o amenazas potenciales al bienestar y los es- ciones primaria y secundaria) de Lazarus. Pero una lista
fuerzos continuos de afrontamiento tienen implicaciones ms amplia de stas podra aadir an ms valoraciones
importantes para el grado en el que se concretan dichos acerca de la precipitacin del suceso y de su compatibili-
beneficios, daos y amenazas. De modo que los motivos dad con estndares internalizados (Scherer, 1997). Otras
personales del individuo (metas, bienestar) se encuentran valoraciones podran incluir la certeza del suceso, su legi-
al centro del proceso de la emocin, y as el individuo timidad y el esfuerzo propio anticipado requerido (Smith
continuamente lleva a cabo valoraciones primarias y se- y Ellsworth, 1985). Es difcil decir cuntas dimensiones
cundarias acerca del estado de los motivos personales a de valoracin existen o cules valoraciones son las ms
medida que se desarrollan los sucesos y se realizan los importantes y cules son slo de importancia perifrica.
esfuerzos de afrontamiento. No obstante, la siguiente lista de valoraciones adicionales
Lazarus categoriza su teora de la emocin como cogni- representa las ideas de la mayora de los tericos cogniti-
tiva-motivacional-relacional (Lazarus, 1991b). Lo cognitivo vos de la emocin (estas dimensiones son una combina-
comunica la importancia de la valoracin; lo motivacio- cin de las propuestas por Roseman, 1984, 1991; Scherer,
nal, la importancia de las metas y el bienestar personales; 1984a, 1997; Smith y Ellsworth, 1985):
y lo relacional comunica que las emociones surgen a par-
tir de la relacin del s mismo con las amenazas, daos y Valoracin de Arnold:
beneficios del ambiente. Complacencia El suceso es bueno
o malo?
Proceso de valoracin Valoraciones de Lazarus:
Continuando con el trabajo de Arnold y Lazarus, los Pertinencia personal El suceso es relevante
tericos de enfoque cognitivo procedieron a desarrollar al bienestar personal?
una comprensin cada vez ms sofisticada del proceso de Capacidad de Puedo afrontar el suceso
valoracin (de Rivera, 1977; Frijda, 1986; Johnson-Laird afrontamiento con xito?
y Oatley, 1989; Oatley y Johnson-Laird, 1987; Ortony, Otras valoraciones posibles:
Clore y Collins, 1988; Roseman, 1984, 1991; Scherer,
1984a, 1997; Smith y Ellsworth, 1985; Weiner, 1986). Expectancia Esperaba que el suceso
Cada terico adopta la secuencia suceso vital A valora- ocurriera?
cin A emocin, pero difiere en cuanto al nmero de di- Responsabilidad Quin ocasion el
mensiones de valoracin que son necesarias para explicar suceso? El s mismo?
la experiencia emocional. Arnold utilizaba la valoracin Otros?
para explicar dos emociones (agrado y desagrado), las Las circunstancias?
valoraciones primaria y secundaria de Lazarus explican Legitimidad Es justo lo que sucedi?
cerca de quince emociones (vase la figura 12.8), pero, Es algo merecido?
en ltima instancia, los tericos cognitivos de la emocin
Compatibilidad con El suceso es adecuado
buscan utilizar las valoraciones para explicar todas las
los estndares del s en el nivel moral?
emociones.
mismo, de la sociedad
Estos tericos cognitivos creen que cada emocin se
puede explicar mediante una pauta nica de valoracio-
nes compuestas. Una valoracin compuesta consiste en Considere cmo una combinacin de mltiples va-
la interpretacin de mltiples significados dentro de un loraciones distintas puede producir una emocin espe-
suceso ambiental, de tal suerte que un suceso puede ser cfica. Por ejemplo, el enojo es una combinacin de las
tanto agradable como ocasionado por el s mismo (por siguientes cuatro valoraciones: 1) una meta valorada se
Aspectos cognitivos de la emocin 261

encuentra en juego (pertinencia personal); 2) la meta se Un rbol de decisin de valoraciones como el que se
pierde (disgusto); 3) alguien bloque la obtencin de mi muestra en la figura 12.10 nunca predir las emociones
meta (irresponsabilidad); y 4) la prdida fue inmerecida resultantes de manera correcta 100% de las veces (Oatley
(ilegitimidad). Esto es, pertinencia personal + disgusto + y Duncan, 1994). En general, los tericos de la valoracin
irresponsabilidad + ilegitimidad = enojo. Como segundo concuerdan en que conocer la configuracin particular
ejemplo, el sentimentalismo se encuentra en funcin de valoraciones de la persona les concede cerca de 65-
de las siguientes valoraciones: pertinencia personal, alto 70% de precisin en la prediccin de las emociones de
potencial de afrontamiento, expectancia, complacencia y las personas (Reisenzein y Hofman, 1993). Existen cinco
compatibilidad con estndares. Sin embargo, si se cam- razones de por qu la teora de la valoracin no puede
bia cualquiera de estas valoraciones, tambin cambiar la explicar las reacciones emocionales con una precisin de
emocin experimentada; es decir, cambie la alta capaci- 100% (Berkowitz y Harmon-Jones, 2004; Fischer, Shaver
dad de afrontamiento por una baja capacidad de afronta- y Carnochan, 1990; Reisenzein y Hofman, 1993; Scherer,
miento (al tiempo que se mantienen constantes las otras 1997):
cuatro valoraciones) y el sentimentalismo cambiar por
anhelo. 1. Existen procesos distintos a la valoracin que con-
Es posible que ahora sea ms que aparente la meta fi- tribuyen a la emocin (como se discuti en la pri-
nal de los tericos de la valoracin para la emocin. Estn mera mitad del presente captulo).
dedicados a la construccin de un rbol de decisin en el 2. A menudo, las valoraciones sirven para intensifi-
que todos los patrones posibles de valoracin conduzcan car (ms que ocasionar) la emocin (p. ej., el bajo
a una sola emocin (Scherer, 1993, 1997); es decir, si la potencial de afrontamiento intensifica el enojo,
persona lleva a cabo las valoraciones X, Y y Z, es seguro e pero no lo causa).
inevitable que seguir la emocin A. 3. Mientras que cada emocin especfica tiene un
patrn nico de valoraciones que se asocia con la
DIFERENCIACIN DE EMOCIONES misma, los patrones de valoracin para muchas
El fuerte de una teora de valoracin para la emocin es emociones se traslapan y ocasionan cierta confu-
su capacidad para explicar los procesos de diferenciacin sin (p. ej., la culpa y la vergenza tienen patrones
de la emocin (p. ej., la manera en que distintas perso- similares de valoracin).
nas experimentan emociones diferentes ante el mismo 4. Existen diferencias de desarrollo entre las per-
suceso). La figura 12.10 presenta un posible rbol de de- sonas, de tal suerte que los nios generalmente
cisin para mostrar cmo seis dimensiones de valoracin experimentan emociones bsicas generales (p. ej.,
pueden diferenciar entre diecisiete emociones distintas alegra), mientras que los adultos socializados por
(Roseman, Antoniou y Jose, 1996). Las dimensiones de lo general experimentan una variedad ms amplia
valoracin se muestran en el margen de la figura, mien- de emociones con valoraciones especficas (p. ej.,
tras que las emociones diferenciadas aparecen en las ca- orgullo, alivio, gratitud).
sillas dentro de la figura. Las dimensiones de valoracin 5. El conocimiento y atribuciones de la emocin (los
en el margen izquierdo de la figura son responsabilidad siguientes dos temas del presente captulo) repre-
(ocasionadas por las circunstancias, ocasionadas por sentan factores cognitivos adicionales a la valora-
otros, ocasionadas por el s mismo), expectancia (ines- cin que afectan la emocin.
peradas) y certeza (inciertas, seguras). Las dimensiones
de valoracin al tope de la figura son meta/necesidad en
juego (consistentes con el motivo, inconsistentes con el
Conocimiento emocional
motivo) y complacencia (apetitivas, aversivas). La di- Los lactantes y los nios pequeos comprenden y distin-
mensin de valoracin del lado derecho de la figura es guen entre slo algunas emociones bsicas. Aprenden a
la capacidad de afrontamiento (baja frente a alta). Y la nombrar las pocas emociones bsicas de enojo, temor,
dimensin de valoracin en la parte baja de la figura es la tristeza, alegra y amor (Kemper, 1987; Shaver et al., 1987).
fuente del suceso aversivo (no caracterolgico, caractero- A medida que las personas obtienen experiencia con di-
lgico). Es cierto que la figura es algo difcil de descifrar, ferentes situaciones, aprenden a discriminar entre las to-
pero s comunica una idea de manera bastante adecua- nalidades de una sola emocin. Por ejemplo, los tonos de
da; a saber, que en un episodio emocional, las personas la alegra incluyen felicidad, alivio, optimismo, orgullo,
llevan a cabo una buena cantidad de valoracin cogniti- complacencia y gratitud (Ellsworth y Smith, 1988b). Los
va a fin de interpretar lo que les est sucediendo y que a matices del enojo incluyen furia, hostilidad, revanchis-
medida que cambia cualquiera de estas interpretaciones mo, rabia, fastidio e ira (Russell y Fehr, 1994). Estas dis-
(valoraciones), tambin cambia la experiencia emocional tinciones se almacenan de manera cognitiva en jerarquas
de la persona. de emociones bsicas y sus derivados. As, el nmero de
262 CAPTULO 12 Aspectos de la emocin

Emociones positivas Emociones negativas


Consistentes con el motivo Inconsistentes con el motivo
Ocasionadas por Apetitivas Aversivas Apetitivas Aversivas
las circunstancias
Inesperadas Sorpresa

Inciertas Esperanza Temor Baja


Seguras Control
Alegra Alivio Tristeza Angustia
Potencial
Inciertas
Esperanza Alta
Seguras
Frustracin Asco Control
Alegra Alivio Potencial
Ocasionadas por otros Baja
Inciertas Desagrado Control
Potencial
Seguras Agrado
Inciertas Alta
Enojo Desprecio Control
Seguras Potencial
Ocasionadas Baja
por el s mismo Arrepentimiento Control
Inciertas Potencial
Seguras Orgullo Alta
Inciertas Culpa Vergenza Control
Potencial
Seguras
No caracterolgico Caracterolgico

Figura 12.10 rbol de decisin de seis dimensiones de valoracin para diferenciar entre diecisiete emociones.
Fuente: Tomado de I. J. Roseman, A. A. Antoniou y P. E. Jose, Appraisal Determinants of Emotions: Constructing a More Accurate and Comprehensive Theory, en
Cognition and Emotion, 10, 1996, pp. 241-277. Reimpreso con autorizacin de Psychology Press, Ltd.

emociones diferentes entre las que puede distinguir una entre las emociones y las situaciones especficas que las
persona constituye su conocimiento emocional (Shaver et ocasionan. Los tericos de la valoracin creen que existen
al., 1987). A travs de la experiencia, construimos una re- tantas emociones como posibilidades de valoracin cog-
presentacin mental de las diferentes emociones y de la nitiva de una situacin (Ellsworth y Smith, 1988a; Smith
manera en que cada emocin individual se relaciona con y Ellsworth, 1985, 1987). Por ejemplo, un individuo que
otras emociones y con las situaciones que las producen. acaba de perder frente a un rival podra, en potencia, ex-
En la figura 12.11 aparece el conocimiento emocional perimentar angustia, enojo, temor, asco y celos (Hupka,
hipottico (generado por computadora) de una persona. 1984). Uno aprende que estas emociones pueden coin-
El nivel al tope de la figura incluye las categoras de emo- cidir y que, por tanto, estn relacionadas entre s (como
ciones bsicas: amor, alegra, sorpresa, enojo, tristeza y te- en el complejo de los celos; Hupka, 1984; White, 1981).
mor. Para esta persona, stas son sus seis emociones bsi- Tambin se aprende que otras emociones (p. ej., alegra,
cas (o familias de emociones). A travs de la experiencia, amor) estn lejos de este agrupamiento de experiencia
el individuo aprende matices de estas emociones bsicas emocional. Por ltimo, uno aprende las diferencias entre
(listadas en la parte inferior de la figura). Por ejemplo, matices de enojo; las diferencias entre celos, odio, irrita-
el individuo sealado en la figura abarca tres matices de cin y dems. A la larga, una vida entera de este apren-
amor afecto, lujuria y anhelo y seis tonalidades de dizaje produce un conocimiento emocional altamente
tristeza sufrimiento, depresin, decepcin, vergenza, personal. Es esta reserva de conocimiento emocional la
abandono y lstima. El asterisco en cada columna de que permite que el individuo valore situaciones con gran
palabras emocionales denota el prototipo dentro de los discriminacin y que, por ende, responda con emociones
matices de dicha emocin. situacionalmente adecuadas (ms que con emociones ge-
Gran parte de la diversidad de experiencias emocio- nerales). As, mientras ms fino y sofisticado sea el cono-
nales proviene del aprendizaje de las distinciones precisas cimiento emocional propio, mayor es la capacidad para
0

10

Emociones generales
20
Sorpresa
Alegra
Enojo
Amor
Temor
30 Tristeza

40

Emociones especficas a la situacin


50

Adoracin Excitacin Anhelo Diversin Entusiasmo Complacencia Orgullo Avidez Fascinacin Alivio Asombro Fastidio Exasperacin Rabia Asco Envidia Tormento Agona Depresin Consternacin Culpa Alienacin Alarma Ansiedad
Afecto Deseo Encanto Celo Placer Triunfo Esperanza Apasionamiento Sorpresa Irritacin Frustracin Indignacin Repulsin Celos Sufrimiento Desesperacin Decepcin Vergenza Aislamiento Conmocin Nerviosismo
Estima Lujuria Simpata Bro Optimismo Estupefaccin Agitacin Furia Desprecio Dolor Desesperanza Displacer Arrepentimiento Abandono Susto Desasosiego
Agrado Pasin Alborozo Emocin Molestia Ira Desconsuelo Pesimismo Remordimiento Soledad +RUURU Intranquilidad
Atraccin Encaprichamiento Regocijo Estremecimiento Enfado +RVWLOLGDG Desnimo Rechazo Terror Aprehensin
Cario Jocosidad Arrebato +RVTXHGDG Fiereza Infelicidad Aoranza Pnico Preocupacin
Ternura Jovialidad Amargura Pesar Derrota +LVWHULD Angustia
Compasin Deleite Odio Afliccin Abatimiento Mortificacin Zozobra
Sentimentalismo *R]R Detestacin Desolacin Inseguridad
Contento Desdn Miseria Turbacin
Felicidad Despecho Melancola +XPLOODFLyQ
Jbilo Revanchismo Agravio
Exaltacin Desagrado
Satisfaccin Resentimiento
xtasis
Euforia

Figura 12.11 Representaciones hipotticas del conocimiento emocional de una persona.


Fuente: Tomado de P. Shaver, J. Schwartz, D. Kirson y C. OConnor, Emotion knowledge: Further exploration of a prototype approach, en Journal of Personality and Social Psychology, 52, 1987, pp. 1061-1086. Copyright 1987,
American Psychological Association. Adaptado con autorizacin.
Aspectos cognitivos de la emocin
263
264 CAPTULO 12 Aspectos de la emocin

responder a cada evento vital con una reaccin emocio- Gratitud Atribuir un desenlace positivo a una
nal especializada y altamente apropiada. causa externa.
Tuve xito gracias a la ayuda de mis
Atribuciones compaeros de equipo.
La teora de la atribucin se basa en la suposicin de que Esperanza Atribuir un desenlace positivo a una
las personas tienen un gran deseo por explicar por qu causa estable.
han experimentado un desenlace vital particular (Heider, Me desempeo bien en deportes por-
1958; Jones y Davis, 1965; Kelley, 1967, 1973; Weiner, que soy atltico por naturaleza.
1980, 1985, 1986). Despus de un desenlace, nos pre- Enojo Atribuir un desenlace negativo a una
guntamos, por ejemplo: Por qu reprob el examen de causa externamente controlable.
qumica? Por qu los Yankees ganaron la Serie Mundial? Perd porque mi oponente hizo tram-
Por qu Juan abandon la escuela? Por qu esta persona pa.
es rica mientras que esta otra es pobre? Por qu no obtu- Lstima Atribuir un desenlace negativo a una
ve ese trabajo? Por qu no me regres la llamada Frank? causa externamente incontrolable.
Una atribucin es la razn que la persona utiliza para (Compasin) Perd mi empleo por culpa de la mala
explicarse un desenlace vital importante (Weiner, 1985, economa.
1986). Es la explicacin causal que aclara la ocurrencia de
un desenlace. Por ejemplo, si respondemos a la pregunta Culpa Atribuir un desenlace negativo a una
por qu reprob el examen de qumica?, diciendo por- causa internamente controlable.
que no estudi, entonces el esfuerzo insuficiente es la Perd porque no hice el esfuerzo su-
atribucin que explica el mal resultado. Las atribuciones ficiente.
son importantes porque la explicacin que utilizamos Vergenza Atribuir un desenlace negativo a una
para esclarecer nuestros desenlaces normalmente genera causa internamente incontrolable.
reacciones emocionales. Despus de un desenlace positi- Me rechazaron porque soy feo.
vo, por lo general las personas se siente felices y, despus
de un desenlace negativo, las personas generalmente se Ntese que en cada una de estas siete emociones (tres
sienten tristes o frustradas. En su teora atribucional de positivas, cuatro negativas) el anlisis atribucional de por
la emocin, Bernard Weiner (1985, 1986) se refiere a la qu se dio el desenlace es causalmente anterior a la emo-
reaccin emocional dependiente del desenlace como va- cin especfica. Por ejemplo, la afirmacin fundamental
loracin primaria del desenlace. Las emociones bsicas de un anlisis atribucional de la emocin es que si la atri-
de alegra y tristeza sencillamente siguen a los desenlaces bucin cambiase, entonces la emocin tambin cambiara
buenos y malos (Weiner, Russell y Learman, 1978, 1979). (es decir, al cambiar la atribucin se cambia la emocin).
La teora de la atribucin propone que en adicin a estas Si una estudiante est orgullosa porque siente que su ca-
reacciones emocionales primarias generadas por desen- pacidad le gan una beca y se entera de que la verdadera
laces, las personas explican an ms las razones de sus razn por la que gan la beca es por el fuerte apoyo que
xitos y fracasos. Una vez que se ha explicado el desen- alguien dio a su peticin durante una junta, entonces la
lace, surgen nuevas emociones para diferenciar entre la emocin experimentada fluye de orgullo a gratitud. El
reaccin emocional inicial de felicidad-tristeza, como las desenlace es el mismo (gan la beca), pero al cambiar la
emociones secundarias especficas. La atribucin de por atribucin tambin cambi su reaccin emocional.
qu sucedi el desenlace constituye la valoracin secun- Los tericos atribucionales empiezan su anlisis con
daria del desenlace. La secuencia de sucesos de la teora valoraciones relativamente sencillas, como cuando un
atribucional de la emocin de Weiner aparece en la figura suceso implica dao, amenaza o peligro (Lazarus, 1991a)
12.11. y continan con valoraciones cada vez ms complejas,
Como se muestra en la figura 12.12, siete emociones como la legitimidad (Ellsworth y Smith, 1988a). De esta
ocurren de manera confiable en funcin del flujo de pro- manera, los tericos cognitivos aaden el conocimiento
cesamiento de informacin atribucional (Weiner, 1985, emocional para explicar la forma en que las personas rea-
1986; Weiner y Graham, 1989). Las races atributivas de lizan valoraciones ms perfeccionadas. En su anlisis atri-
las siete emociones son las siguientes: bucional, Bernard Weiner (1982, 1986) aade otro tipo
ms de valoracin para ayudar a explicar los procesos
Orgullo Atribuir un desenlace positivo a una emocionales: la valoracin posdesenlace de por qu ha
causa interna. sucedido dicho resultado. As, el papel de la cognicin no
Tuve xito a causa de mis capacida- es slo evaluar el significado del suceso vital (valoracin),
des sobresalientes. sino tambin analizar por qu el desenlace vital result
Valoracin primaria del desenlace Valoracin secundaria del desenlace

ORGULLO Si el desenlace positivo se atribuye


a una causa interna
FELICIDAD GRATITUD Si el desenlace positivo se atribuye
Si el desenlace es positivo a una causa externa
ESPERANZA Si el desenlace positivo se atribuye
a una causa estable

Desenlace

ENOJO Si el desenlace negativo se atribuye


a una causa externa controlable
LSTIMA Si el desenlace negativo se atribuye
TRISTEZA O FRUSTRACIN a una causa externa incontrolable
Si el desenlace es negativo CULPA Si el desenlace negativo se atribuye
a una causa interna controlable
VERGENZA Si el desenlace negativo se atribuye
a una causa interna incontrolable

Figura 12.12 Teora atribucional de la emocin.


Aspectos cognitivos de la emocin
265
266 CAPTULO 12 Aspectos de la emocin

de la manera en que lo hizo (atribucin). Al considerarse (amor triste) como una emocin negativa, este punto
en su totalidad, las valoraciones anteriores al desenlace, ayudar a ejemplificar las bases culturales de la emocin.
como beneficio, dao y amenaza potenciales explican al- En la cultura tradicional china, los padres arreglan los
gunos procesos emocionales, como tambin lo hacen las matrimonios de sus hijos. Los matrimonios funcionan
valoraciones posteriores al resultado (atribuciones) que como unin entre dos familias extensas, al mismo tiem-
explican los procesos emocionales y desenlaces adiciona- po que unen a dos personas. Cuando uno contempla un
les (Len y Hernndez, 1998). matrimonio arreglado, el amor romntico adquiere el
significado de fuerza potencialmente alteradora que pue-
de separar a un hijo o hija de sus padres (Potter, 1988).
Aspectos sociales y culturales Por ende, si se le acoge, el amor romntico tiene el po-
de la emocin tencial de destruir el respeto y deferencia apropiados que
Del mismo modo en que una valoracin contribuye a la se espera que hijos e hijas demuestren hacia sus padres
comprensin cognitiva de la emocin, las relaciones so- (Russell y Yik, 1996). As, la experiencia del amor ro-
ciales contribuyen a la comprensin social de la emocin. mntico adquiere una valencia negativa y se representa
Adems, el contexto sociocultural en el que uno vive de mejor forma mediante la experiencia del amor triste.
contribuye a la comprensin cultural de la emocin. Los Los tericos que estudian la construccin social de
psiclogos sociales, socilogos, antroplogos y otros pro- las emociones sealan que si cambiara la situacin en la
fesionales argumentan que la emocin no es necesaria- que uno se encuentra, las emociones tambin cambia-
mente un fenmeno privado biolgico intrapsquico. Ms ran. Piense acerca de las emociones tpicas que se expe-
bien, arguyen que muchas emociones se originan dentro rimentan en el patio de juegos, en el trabajo, en una fiesta
tanto de la socializacin como de un contexto cultural de fin de semana, en un evento deportivo, al limpiar el
(Averill, 1980, 1983; Kemper, 1987; Manstead, 1991). bao, durante una pelea a puo limpio, y as sucesiva-
Aquellos que estudian la construccin cultural de las mente. Las situaciones definen las emociones que son
emociones sealan que si uno cambiara la cultura en ms apropiadas y esperadas y, debido a que las personas
la que vive, tambin cambiara el repertorio emocional saben cules emociones tienen mayor probabilidad de
propio (Mascolo, Fischer y Li, 2003). Por ejemplo, con- suceder en qu entornos, pueden seleccionar un entorno
sidere el repertorio emocional de personas de Estados y as construir una experiencia emocional especfica
Unidos y China. Los lactantes chinos son menos reac- para s mismos. Por ejemplo, si usted desea construir
tivos emocionalmente y expresivos que los lactantes es- alegra, acudir a una fiesta de fin de semana; si quiere
tadounidenses, probablemente porque los padres chinos construir asco, limpia la regadera. As, tambin piense
resaltan y esperan el control emocional, mientras que los en las emociones tpicas que se experimentan cuando
padres estadounidenses resaltan y esperan la expresin se relaciona con una persona de estatus superior (jefe, pa-
emocional. dre), con alguien de estatus equivalente (amigo, cnyuge),
En el mismo nimo, la figura 12.13 ilustra de manera o con alguien de estatus inferior (hijo, empleado nuevo).
grfica las emociones bsicas similares y dismiles de las Las diferencias en estatus entre las personas definen las
personas en ambas culturas. Las lneas slidas al enojo, emociones apropiadas y esperadas y, debido a que las per-
tristeza, temor y felicidad indican que los miembros de sonas saben qu emociones van con cada quien, pueden
ambas culturas ven esencialmente el mismo significado seleccionar parejas de interaccin y, por ende, construir
en estas experiencias emocionales. Las lneas punteadas una experiencia emocional particular. As, mediante la
a la vergenza y el amor ilustran que los miembros de seleccin estratgica de situaciones en las cuales estar y de
las dos culturas dan diferentes significados a estas mismas personas con quienes relacionarse, cada uno de nosotros
emociones. Para los chinos, el amor no es una emocin tiene los medios de construir socialmente qu emociones
positiva; el significado del amor se acerca mucho ms al estamos en mayores probabilidades de experimentar.
del amor triste y se considera que es una emocin nega-
tiva. Para las personas en China, la vergenza se considera
una emocin bsica. As, los estadounidenses encuentran
Relaciones interpersonales
significado en dos emociones positivas y tres emociones Tpicamente, las dems personas son nuestra fuente ms
negativas, mientras que las personas en China encuentran frecuente de emocin cotidiana (Oatley y Duncan, 1994).
significado en una emocin positiva y en cinco emociones Experimentamos un mayor nmero de emociones con
negativas. (Las diecisiete emociones subordinadas ce- otros que cuando estamos a solas.
los, ira, asco, etc. son de los participantes chinos, no de Si usted llevara la cuenta de los sucesos y experiencias
los participantes estadounidenses.) que ocasionan sus reacciones emocionales las acciones
Si usted es un lector de origen occidental y le sor- de otra persona o las propias o algo que haya ledo o vis-
prende que los participantes chinos consideren el amor to es casi seguro que descubrira que sus relaciones con
Aspectos sociales y culturales de la emocin 267

EMOCIONES

Negativas Positivas Supraordinadas

os
nid
Ch

os U
ina

C hi

ad
na

Est
ENOJO TRISTEZA TEMOR VERGENZA (TRISTE) AMOR FELICIDAD Familias BSICAS

Ira Afliccin Pnico VergenzaAmor Alegra Subordinadas


Asco afligido;
Celos Angustia Ansiedad Amor no Agrado
Soledad correspondido Excitacin
Descorazonamiento Anticipacin Culpa/ exuberante
nerviosa Arrepentimiento

Figura 12.13 Anlisis en racimo de familias de emociones bsicas en chino e ingls.


Fuente: Tomado de P. R. Shaver, S. Wu y J. C. Schwartz, Cross-cultural similarities and differences in emotion and its representation: a prototype approach, en
M. S. Clark, ed., Review of Personality and Social Psychology, volumen 13, 1992, pp. 231-251. Thousand Oaks, CA: Sage.

otros son las que dispararon la mayora de sus emociones ciales, voces, posturas, movimientos
(Oatley y Duncan, 1994). Las emociones son intrnsecas y conductas instrumentales de otras
a las relaciones interpersonales. Tambin representan un personas.
papel central en la creacin, preservacin y disolucin
Realimentacin: La experiencia emocional se ve afec-
de relaciones interpersonales, ya que las emociones nos
tada, momento a momento, por la
unen y nos separan (Levenson, Carstensen y Gottman,
activacin de la realimentacin de
1994; Levenson y Gottman, 1983). Por ejemplo, la alegra, la imitacin facial, vocal, postural y
la tristeza y el enojo trabajan en conjunto para afectar el de movimientos.
entramado social de las relaciones. La alegra promueve
el establecimiento de las relaciones. La tristeza preserva Contagio: En consecuencia, las personas tien-
las relaciones en tiempos de separacin (al motivar la den a `infectarse de las emociones de
reunin). Y el enojo motiva la accin necesaria para rom- otras personas.
per las relaciones dainas.
Las dems personas no slo ocasionan que se des- Al estar expuestos a las expresiones emocionales
pierten las emociones en nuestro interior, sino que tam- de los dems, tendemos a imitar sus expresiones facia-
bin nos afectan de manera indirecta a travs del contagio les (Dimberg, 1982; Strayer, 1993), su estilo de hablar
emocional. El contagio emocional es la tendencia a imi- (Hatfield, Hsee, Costello, Weisman y Denney, 1995) y su
tar y sincronizar expresiones, vocalizaciones, posturas y postura (Bernieri y Rosenthal, 1991). Una vez que suce-
movimientos con los de otra persona y, en consecuencia, de esta imitacin, la hiptesis de la realimentacin facial
converger en sentido emocional (Hatfield, Cacioppo y ilustra la forma en que esta imitacin (no slo del rostro,
Rapson, 1993a). Las tres propuestas de imitacin, rea- sino tambin de la voz y la postura) puede afectar la expe-
limentacin y contagio explican cmo, durante las re- riencia emocional del observador y, as, llevar a un efecto
laciones interpersonales, las emociones de otros causan de contagio.
emociones en nosotros (Hatfield, Cacioppo y Rapson, Durante el intercambio social, no slo nos vemos
1993b): expuestos a los efectos del contagio emocional, sino que
tambin nos colocamos en un contexto conversacional
Imitacin: Al conversar, las personas autom- que proporciona la oportunidad de reexperimentar y re-
ticamente imitan y sincronizan sus vivir experiencias emocionales pasadas, un proceso que
movimientos con las expresiones fa- se conoce como reparto social de emociones (Rim,
268 CAPTULO 12 Aspectos de la emocin

Mesquita, Philippot y Boca, 1991). El reparto social de Nia (varias veces): Mi mam est retrasada.
conversaciones emocionales normalmente se lleva a cabo Miembro del personal: Eso te hace sentir enojada?
tarde en el da y cuando nos encontramos en compaa
de nuestros ntimos (amigos cercanos, parejas amorosas, Nia: S.
compaeros de equipo). Cuando las personas comparten Miembro del personal: A veces los nios se enojan
sus emociones, normalmente lo hacen mediante el re- cuando sus mams se retrasan
cuento completo de lo que sucedi durante el episodio y los recogen tarde.
emocional, lo que signific y cmo se sinti la persona a Considere un ejemplo de manejo de expresin; la for-
lo largo del mismo (Rim et al., 1991). Durante este repar- ma en que los adultos les dicen a los nios cmo expresar
to social de emociones, un escucha emptico puede ofre- sus emociones (Pollak y Thoits, 1989):
cer apoyo o asistencia, fortalecer las respuestas de afron-
tamiento, ayudar a darle sentido a la experiencia emo- Miembro del personal: Robert, veo que ests muy eno-
cional y reconfirmar el autoconcepto (Lehman, Ellard y jado.
Wortman, 1986; Thoits, 1984). Es durante estos momen- (Mientras sostiene a un nio que grita y patalea en el tiempo
tos en los que compartimos nuestras emociones que cons- de descanso.)
truimos y mantenemos las relaciones que son centrales en
nuestras vidas (Edwards, Manstead y MacDonald, 1984), Considere un ejemplo de control emocional; la mane-
como las relaciones maritales (Noller, 1984). ra en que los adultos les ensean a los nios a controlar
sus expresiones de emocin (Pollak y Thoits, 1989):
Durante una actividad que se realiza en crculo, Alec tra-
Socializacin emocional t de subrsele a John, un voluntario.
La socializacin emocional sucede cuando los adultos John: Si quieres estar cerca, hay algunas cosas que
les indican a los nios lo que deberan saber acerca de puedes hacer Puedes sentarte junto a m y
las emociones. Tambin se presenta entre adultos, pero nos podemos tomar de las manos, o puedo
el proceso se ilustra de mejor manera cuando los adul- poner mi brazo en tus hombros o podras sen-
tos interactan con los nios con el propsito explcito tarte en mi regazo.
de impartirles informacin de socializacin (Pollack y
Thoits, 1989). Los adultos les cuentan a los nios sobre Las distintas sociedades ensean a socializar a sus
las situaciones que provocan emociones, acerca de la ma- nios en formas diferentes. Considere, por ejemplo, los
nera en que la emocin se manifiesta y sobre las palabras distintos mensajes de socializacin comunicados por los
o etiquetas para sus sentimientos y conductas. Por su par- padres de un nio en Estados Unidos (primera cita) o por
te, los nios aprenden que una emocin bsica se puede los padres de un nio en China (cita inferior):
diferenciar en emociones especficas (conocimiento emo- Danny, de tres aos de edad, y su madre estn armando
cional; Shaver et al., 1987), que ciertas muestras expresi- un rompecabezas. El nio coloca una pieza en el sitio co-
vas deberan controlarse (manejo de expresiones; Saarni, rrecto. Inmediatamente mira a su madre, sonre y dice:
1979) y que las emociones negativas se pueden manipu- Oh! Lo logr!. Levantando la mirada de su trabajo,
lar de manera deliberada para convertirlas en emociones su madre sonre y dice: Lo lograste!. Danny aplaude,
neutras o positivas (control emocional; McCoy y Masters, despus de lo cual su madre hace lo mismo y dice exce-
1985). Cuando los nios aprenden acerca de las emocio- lente!.
nes de parte de los adultos, lo que aprenden bsicamente
cae bajo las categoras de conocimiento emocional, ma- La madre de Lin, de tres aos de edad, le pide a su hija
nejo de expresiones y control emocional. que cante para los invitados. Al terminar, con sonrisas y
Considere la socializacin que ocurre en entornos expresiones exageradas, los invitados dicen Maravilloso!
como guarderas, instituciones preescolares y escue- Cantas mejor que mis hijos!. La madre responde:
las de educacin bsica (Denham, Mitchell-Copeland, Haihao, est bien. Sin embargo, su voz es algo desento-
Strandberg, Auerbach y Blair, 1997; Pollak y Thoits, 1989). nada. Pero le gusta cantar. A Lin le dice: Lo hiciste bien,
Durante un episodio emocional del nio, un cuidador o pero ahora necesitas practicar ms. No le des tanta im-
maestro puede explicar los sentimientos del nio, sealar portancia a tu xito! (Mascolo et al., 2003, p. 375).
las causas de una emocin e instruir al nio en cuanto a Este par de citas muestra las diferentes formas en que
qu muestras de expresin son las ms apropiadas y bien- los agentes de la socializacin responden a los logros de
venidas y cules otras muestras de expresin no lo son. sus hijos. Como lo sugieren estas citas, los padres de nios
Considere un ejemplo de conocimiento emocional, la estadounidenses tienden a elogiar los logros de sus hijos y
forma en que los adultos les cuentan a los nios acerca de alientan la expresin propia positiva. Los padres de nios
las causas de la emocin (Pollak y Thoits, 1989). en China tienden a hacer comentarios que menosprecian
Aspectos sociales y culturales de la emocin 269

los logros de sus hijos ante los dems. Sin embargo, por mamas y que realice cirugas, disecciones y autopsias. Es
lo general, los invitados, familiares y otros alaban efusiva- evidente que tales situaciones generan emociones, pero
mente al nio, e incluso restan importancia a sus propios los mdicos necesitan aprender una neutralidad afectiva
hijos. Despus de algunos aos, los estadounidenses con- profesional, aun cuando la sangre salga a borbotones por
ducen a los nios a enorgullecerse de sus logros con este una arteria o tengan que hundir sus manos en los intesti-
tipo de socializacin, mientras los chinos conducen a los nos de un paciente. La manera en que los mdicos apren-
nios a la armona entre su yo y el de los dems a travs den esta neutralidad afectiva proporciona una ilustracin
de la modestia (Chen, 1993; Stipek, 1999).6 de la forma en que el resto de nosotros aprende a manejar
Los miembros de las diversas culturas ofrecen libros nuestras emociones.
de cuentos a sus nios. Sin embargo, los nios estadouni- Durante un periodo de dos aos, unos investigado-
denses prefieren los cuentos emocionantes, mientras que res observaron y entrevistaron a estudiantes de medicina
los preescolares chinos prefieren otros ms tranquilos. para identificar las estrategias de manejo de emociones
Adems, esta literatura emocionante es parte de lo que que haban aprendido durante sus estudios a fin de lograr
conduce a los nios estadounidenses a preferir un tipo de una neutralidad afectiva (Smith y Kleinman, 1989). Los
afecto similar como ideal, mientras que las historias apa- estudiantes de medicina aprendieron a manejar sus emo-
cibles forman parte de lo que conduce a los nios chinos a ciones mediante la internalizacin de las siguientes cinco
preferir un afecto calmado como ideal (Tsai, Louie, Chen estrategias:
y Uchida, 2007).
Transformar el contacto emocional en algo ms.
Transformar mentalmente el contacto corporal nti-
Manejo de las emociones mo en un procedimiento impersonal paso a paso.
La forma en que las personas aprenden a manejar sus Acentuar lo positivo.
emociones se puede ver en los profesionales que inte- Identificar la satisfaccin al aprender o la oportuni-
ractan de manera frecuente, cercana e ntima con el dad de ejercer la medicina.
pblico, como sobrecargos (Hochschild, 1983), estilistas
(Parkinson, 1991) y mdicos (Smith y Kleinman, 1989). Usar al paciente.
En estos campos, las presiones por la socializacin y el Cambiar la concienciacin de los sentimientos inc-
manejo de las emociones propias principalmente se cen- modos al paciente, p. ej., mediante proyeccin o in-
tran en torno a un tema de afrontamiento de sentimien- culpacin.
tos aversivos de maneras que son tanto socialmente de- Rerse al respecto.
seables como personalmente adaptativas (Saarni, 1997). Hacer bromas, ya que las bromas eximen al mdico
Por ejemplo, no se supone que los mdicos sientan ya sea de admitir sus debilidades.
atraccin o asco por sus pacientes, sin importar qu tan
Evitar el contacto.
bella o repulsiva sea su apariencia. Por tanto, durante su
Mantener al paciente cubierto, desviar la mirada o
capacitacin profesional, los mdicos deben aprender
apresurarse a hacer el procedimiento.
una neutralidad afectiva, una preocupacin desprendida
por sus pacientes. Estas cinco estrategias de manejo de emocin ilustran
Imagine que usted es un estudiante de medicina al que la cultura que refleja la medicina occidental. Cuando los
se le pide que lleve a cabo exmenes plvicos, rectales y de estudiantes dependen de dicha cultura para guiarlos en
cmo pueden manejar sus emociones, de hecho estn
6 reproduciendo la cultura para la siguiente generacin de
Es claro que las sociedades socializan las experiencias y expresiones
emocionales de sus miembros. Aun as, existen lmites para el grado estudiantes (Smith y Kleinman, 1989).
en el que una cultura puede socializar ciertas emociones en sus Tambin considere a los estilistas (Parkinson, 1991).
participantes. Considere la afirmacin de que en algunas culturas se A fin de obtener xito profesional, los estilistas necesitan
comparten las parejas romnticas sin celos. Los tericos de enfoque desarrollar un estilo comunicacional abierto que se ca-
biolgico argumentan que compartir la pareja sexual seguramente
racteriza por la expresividad, intensidad del afecto, em-
producira celos y los tericos de la valoracin podran plantear un
argumento similar (vase el cuadro 12.2). Pero, es posible socializar pata, aplomo, expresiones faciales positivas frecuentes y
a las personas a no experimentar celos durante un intercambio de ocultamiento de emociones negativas. Adems, mientras
parejas romnticas? La respuesta breve es, bsicamente, no (Reis, ms natural y espontneo aparente ser el estilista ante sus
1986). Las culturas s varan en cuanto a las conductas que indican clientes, mejor trabajo hace. Cmo es que los estilistas
celos, las seales de afecto que justifican los celos y la manera en que
aprenden a manejar sus emociones de esta forma? En
las personas expresan sus celos, pero la ansiedad emocional de los celos
sexuales sucede en todas las culturas (Reis, 1986). Al igual que muchas esencia, el problema al que se enfrentan los estilistas es
otras emociones bsicas, los celos son universales, aunque muchos de cmo adquirir un estilo abierto de relacin con clientes
sus matices (causas, expresiones) varan de una cultura a otra. que a menudo son quisquillosos y distintos en el aspecto
270 CAPTULO 12 Aspectos de la emocin

sociocultural. Parte del trabajo de ser estilista es encon- les durante una presentacin de dos horas. Por medio del
trar la manera de hacerlo, y aquellos que logran desa- uso de los mtodos de actuacin profunda, el sobrecargo
rrollar estas habilidades de manejo de sus emociones reemplaza sus reacciones emocionales naturales y espon-
mencionan que tienen una mayor satisfaccin laboral. tneas con un repertorio emocional que se caracteriza por
Los estilistas que no logran desarrollar estas habilidades una constante cortesa hacia los pasajeros (Hochschild,
de manejo de emociones mencionan que tienen una sa- 1983). En todos estos casos estudiantes de medicina,
tisfaccin laboral inferior. estilistas y sobrecargos las personas aprenden a mane-
Los sobrecargos necesitan adoptar un estilo de rela- jar sus sentimientos privados y espontneos y a expresar-
cin abierto similar al de los estilistas. Para hacerlo, es fre- los en formas de actuacin pblicamente determinadas y
cuente que utilicen mtodos de actuacin profunda que socialmente deseables. Hacerlo facilita las relaciones pro-
no son muy distintos a los que utilizan los actores teatra- fesionales llanas con su clientela (Manstead, 1991).

Resumen
Existen tres aspectos centrales de la emocin: biolgico, riencias emocionales naturales mediante la exageracin o
cognitivo y sociocultural. El captulo empieza con un an- supresin de sus acciones faciales.
lisis biolgico de la emocin porque, en parte, las emocio- El constructo central de la comprensin cognitiva de
nes son reacciones biolgicas a sucesos vitales importan- la emocin es la valoracin. Dos tipos de valoraciones: pri-
tes. Tienen funciones de afrontamiento que permiten que maria y secundaria, regulan el proceso emocional. La va-
el individuo se prepare para adaptarse de manera efectiva loracin primaria analiza si algo importante est en juego
a las circunstancias vitales significativas. Las emociones dentro de una situacin o no bienestar fsico, autoesti-
energizan y dirigen las acciones del cuerpo (p. ej., correr, ma, una meta, el estado financiero, respeto o el bienestar
pelear) al afectar: 1) al sistema nervioso autnomo y su de una persona amada. La valoracin secundaria sucede
regulacin del corazn, pulmones y msculos; 2) al sis- despus de cierta reflexin y gira en torno de la evaluacin
tema endocrino y su regulacin de glndulas, hormonas de cmo afrontar el beneficio, dao o amenaza potencia-
y rganos; 3) a los circuitos neurales del cerebro como les. Los tericos de la valoracin se han propuesto la meta
aquellos en el sistema lmbico; 4) la frecuencia de descar- de construir un rbol de decisin en el que conocer todas
gas neurales y, por tanto, el ritmo del procesamiento de las diferentes valoraciones que la persona realiza durante
informacin; y 5) la realimentacin facial y los patrones un episodio emocional arrojar una prediccin de la emo-
discretos de la musculatura facial. cin que la persona experimentar de manera inevitable
La investigacin acerca de las bases biolgicas de la (p. ej., si hay algo en juego y se perdi a causa de una
emocin identifica que la activacin y preservacin de fuerza externa e ilegtima A enojo).
cerca de diez emociones distintas se puede comprender La emocin tambin est integrada en la cognicin a
desde una perspectiva biolgica: inters, alegra, temor, travs del conocimiento emocional y las atribuciones. El
enojo, asco, angustia, desprecio, vergenza, culpa y sor- conocimiento emocional implica aprender las distinciones
presa. Por ejemplo, hay cuatro emociones que muestran finas entre las emociones bsicas y aprender qu situacio-
un patrn nico de especificidad fisiolgica en el sistema nes provocan qu emociones. Un conocimiento emocional
nervioso autnomo y el sistema endocrino. La teora de las sofisticado permite que el individuo valore una situacin
emociones diferenciales indica que diez emociones pro- con alta discriminacin y que, por ende, responda con
ducen expresiones faciales transculturales nicas. Y hay emociones altamente apropiadas. Un anlisis atribucio-
seis emociones que se asocian con tasas especficas de nal se enfoca en las atribuciones posteriores al desenlace
descarga neural en la corteza. para explicar cundo y por qu las personas experimen-
La hiptesis de realimentacin facial afirma que el as- tan orgullo, gratitud o esperanza despus de desenlaces
pecto subjetivo de la emocin en realidad es la conciencia- positivos, y culpa, vergenza, enojo y lstima despus de
cin de la realimentacin propioceptiva de la accin facial. desenlaces negativos.
La hiptesis de la realimentacin facial aparece en dos En un anlisis social y cultural de las emociones, las
formas: dbil y fuerte. Segn la versin fuerte, las expre- dems personas son nuestras fuentes ms ricas de expe-
siones faciales ensayadas activan emociones especficas, riencias emocionales. Durante las relaciones interpersona-
de tal suerte que sonrer activa la alegra. Segn su versin les, es frecuente que nos infectemos de las emociones
dbil, las expresiones faciales exageradas y suprimidas de los otros a travs de un proceso de contagio emocional
aumentan y atenan las emociones de ocurrencia natural. que inicia con imitacin, realimentacin y, a la larga, con el
Las investigaciones no son concluyentes para la versin contagio en s. Tambin compartimos y revivimos nues-
fuerte, y la evidencia confirma la validez de la versin d- tras experiencias emocionales recientes durante nuestras
bil. El manejo facial modera la experiencia emocional, ya conversaciones con otros, un proceso que se denomina
que las personas pueden intensificar o reducir sus expe- reparto social de la emocin. Y la cultura socializa a sus
Lecturas adicionales 271

miembros para experimentar y expresas sus emociones en ciones (conocimiento emocional), la forma en que debera-
formas particulares. En general, otras personas y la cultu- mos expresarlas (manejo de expresiones) y el momento en
ra nos instruyen en cuanto a las causas de nuestras emo- que es necesario controlarlas (manejo emocional).

LECTURAS ADICIONALES

Aspectos biolgicos de la emocin


Ekman, P. (1993). Facial expression and emotion. American Lazarus, R. S., y Smith, C. A. (1988). Knowledge and apprai-
Psychologist, 48, 384-392. sal in the cognition-emotion relationship. Cognition and
Izard, C.E. (1989). The structure and functions of emotions: Emotion, 2, 281-300.
Implications for cognition, motivation, and persona- Scherer, K. R. (1993). Studying the emotion-antecedent
lity. En I. S. COHEN (Ed.), The G. Stanley Hall lecture appraisal process: An expert system approach. Cognition
series (vol. 9, pp. 39-73). Washington, DC: American and Emotion, 7, 325-355.
Psychological Association. Shaver, P., Schwartz, J., Kirson, D., y OConnor, C. (1987).
Levenson, R. W. (1992). Autonomic nervous system differences Emotion knowledge: Further exploration of a prototype
among emotions. Psychological Science. 3, 23-27. approach. Journal of Personality and Social Psychology,
McIntosh, D. N. (1996). Facial feedback hypotheses: Evidence, 52, 1061-1086.
implications, and directions. Motivation and Emotion,
20, 121-147.
Aspectos culturales de la emocin
Pollak, L. H., y Thoits, P. A. (1989). Processes in emotional so-
Aspectos cognitivos de la emocin cialization. Social Psychology Quarterly, 52, 22-34.
Lazarus, R.S. (1991). Progress on a cognitive-motivational- Smith, A. C., III, y Kleinman, S. (1989). Managing emotions in
relational theory of emotion. American Psychologist, 46, medical school: Students contacts with the living and the
819-834. dead. Social Psychology Quarterly, 52, 56-69.
Parte IV
Diferencias
individuales
Captulo 13
Caractersticas de personalidad
Es usted feliz? Si unos investigadores le siguieran todo el da durante varios das, observaran a una
persona que con frecuencia es feliz? Veran a un individuo que experimenta emociones positivas con
frecuencia o slo raramente? Cuando est feliz, de qu tipo de felicidad se trata: una alegra intensa y
profunda o algo ms parecido a la satisfaccin? Sonre ampliamente y re a carcajadas? Se siente lleno
de energa y vida?
Es infeliz? Sufre emocionalmente? Con cunta frecuencia durante el da se siente infeliz? Si unos
investigadores le siguieran veran a alguien que sufre angustia emocional con frecuencia, raramente o
slo en respuesta a circunstancias especiales? Cuando sufre los embates de la emocionalidad negativa,
con cunta intensidad siente sus emociones negativas? Sus emociones negativas le afectan slo su-
perficialmente y se desvanecen con rapidez o le afectan profundamente y se quedan a su lado durante
das? La emocin negativa es frecuente y tiene la suficiente profundidad como para provocar sntomas
fsicos como dolores de cabeza? Su da tpico es una montaa rusa de emociones llena de altas y bajas
o es tan plano como un paseo por las llanuras de Nebraska?
De hecho, los investigadores llevan a cabo estudios acerca de experiencias como stas utilizando el
mtodo de muestreo de experiencias (Larsen, 1989). En estas investigaciones, los participantes llevan
consigo un dispositivo electrnico (p. ej., una Palm Pilot) que los investigadores utilizan para enviar una
seal en diversos momentos durante el da a los participantes para pedirles que registren sus emociones
y estado de nimo en ese momento especfico. Cuando la gente informa su emocionalidad cotidiana,
en general reporta altos niveles de emocin positiva y bajos niveles de emocin negativa. Este patrn
de emociones se presenta en estudiantes universitarios (Thomas y Diener, 1990) y tambin en madres
trabajadoras que reparten su atencin entre diversos roles durante el da (William, Suls, Alliger, Learner
y Choi, 1991). Bsicamente, la mayora de la gente es feliz (Diener y Diener, 1996). No obstante, un tema
que se tratar a lo largo de este captulo es que algunas personas son ms felices que otras. Y algunas son
ms infelices que otras. La prediccin de quin es feliz y quin infeliz se puede lograr en forma confiable
con base en las caractersticas de personalidad.

Diferencias individuales en felicidad, excitacin y control


Este captulo se enfoca en tres principios motivacionales relacionados con las caractersticas de perso-
nalidad: 1) felicidad, 2) excitacin y 3) control. Cualquier acontecimiento situacional ofrece el potencial
de afectar estas tres experiencias subjetivas. Las caractersticas de personalidad presentadas en el cap-
tulo extraversin, neuroticismo, bsqueda de sensaciones, intensidad de afecto, control percibido y
deseo de control explican por qu las diferentes personas tienen distintos estados motivacionales y
emocionales incluso ante la misma situacin.
Por ejemplo, presentar un examen es por lo comn una situacin estresante (infeliz), estimuladora
y un tanto controlable en trminos de su resultado. Considere que todas las situaciones varan en su ca-
pacidad para producir emociones positivas y negativas en nosotros (p. ej., las fiestas son divertidas, los
accidentes producen angustia). Todas las situaciones varan en la cantidad de estimulacin y actividad
que producen (p. ej., las bibliotecas son tranquilas, los conciertos de rock son estimulantes); y todas las
situaciones varan en la cantidad de control que se tiene sobre ellas (p. ej., bajar de peso es algo que est
hasta cierto grado bajo su control y relativamente fuera de su control). En este captulo se considera
tambin particularmente importante el que los individuos poseen caractersticas de personalidad que
afectan la forma en que responden a estas situaciones en trminos de la felicidad y activacin que sien-
ten y el control que perciben.
A lo largo de este captulo se debe tener en cuenta la siguiente advertencia: cuando la discusin trate
sobre diferencias individuales especficas, tenga en mente que relativamente pocas personas se encuen-
tran en cualquiera de los extremos de esa caracterstica. Unas cuantas personas buscan sensaciones y
276 CAPTULO 13 Caractersticas de personalidad

unas cuantas personas evitan las sensaciones, pero la ma- 1996). Las personas de grupos de bajos ingresos por lo
yora de la gente se encuentra en algn sitio intermedio, general dicen ser felices, las personas con poca educacin
como se presenta de manera grfica en la parte superior formal dicen en general ser felices y las personas de casi
de la figura 13.1. Como se ilustra all, cuando un gran cualquier pas tambin dicen ser felices. No obstante, to-
nmero de individuos responde a la escala de bsqueda dos sabemos de manera intuitiva que los sucesos de nues-
de sensaciones (SSS, por sus siglas en ingls), slo una tras vidas afectan nuestras emociones y estados de nimo.
minora (cerca de 15%) obtiene puntuaciones entre 15 y Es cierto que la gente a la que siempre se le presentan
21, el extremo superior de la SSS, con lo cual demuestran todas las oportunidades es ms feliz que quien no las tiene?
ser buscadores empedernidos de sensaciones. Slo una Considere la felicidad de los ganadores de la lote-
minora (cerca de 15%) obtiene puntuaciones entre 0 y 7, ra y de las vctimas de accidentes (Brickman, Coates y
el extremo inferior de la SSS que identifica a quienes evi- Janoff-Bulman, 1978). Estos sucesos vitales dramticos
tan las sensaciones. La mayora (aproximadamente 70%) producen fuertes emociones. Podemos decir sin lugar a
logran puntuaciones entre 7 y 15 (la mitad) y, por ende, dudas que ganar la lotera es un suceso positivo en la vida
se les identifica como individuos que no buscan ni evitan y tambin podemos decir sin duda que sufrir un acciden-
las sensaciones. Tambin tenga cuidado al considerar las te que le deja a uno cuadripljico es un suceso vital ne-
tipologas que se muestran en la parte inferior de la figura gativo. Cuando los investigadores preguntaron a algunas
13.1. Las tipologas catalogan a las personas con uno u personas que ganaron la lotera y a vctimas de accidentes
otro tipo de personalidad (p. ej., como persona que busca si eran felices luego de un ao del acontecimiento sobre-
o que evita las sensaciones). Al hacerlo, estas tipologas saliente, la gente que gan grandes cantidades de dinero
simplifican en exceso la contribucin de los procesos de y la gente que sufri lesiones debilitantes no difirieron en
personalidad a la motivacin. Las caractersticas de per- gran medida de la persona promedio.
sonalidad existen dentro de todos los individuos. Slo Las personas reaccionan intensamente ante los suce-
unas cuantas personas albergan un nivel alto o intenso sos de la vida y tienen fuertes reacciones hacia aconteci-
de la caracterstica de personalidad, la mayora tiene una mientos como la suerte en la lotera y los accidentes que
cantidad moderada y unas cuantas tienen slo un nivel ponen en peligro su vida. Pero tambin parecen regresar
bajo o menor de la caracterstica. al mismo nivel de felicidad que tenan antes de ese he-
cho. Cuando los investigadores monitorearon las emo-
ciones de las vctimas de lesiones en la mdula espinal,
Felicidad encontraron que estas personas tenan intensas emocio-
La mayora de la gente es feliz y esto es vlido casi sin to- nes negativas y rara vez presentaban emociones positivas
mar en cuenta sus circunstancias vitales (Diener y Diener, una semana despus del accidente, como se esperara en

Curva de distribucin normal

Nmero
de casos
70%

15% 15%
0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21
Puntuacin en la prueba de personalidad (SSS)

Tipologa
Las personas son

Buscadores Evitadores
de sensaciones de sensaciones
(50%) (50%)

Figura 13.1 Caractersticas de personalidad como se explican a travs de la distribucin normal versus una tipologa.
Felicidad 277

vista de las circunstancias que enfrentaban. Sin embargo, los extravertidos son diferentes de los introvertidos por-
despus de dos meses, las emociones negativas dismi- que tienen mayor tendencia a la sociabilidad, la aserti-
nuan, en tanto que las emociones positivas aumentaban. vidad y a estar emocionados (Dupue y Collins, 1999;
Despus de dos meses, sus emociones positivas eran ms Watson y Clark, 1997).
fuertes y ms frecuentes que sus emociones negativas En sentido emocional, los extravertidos son ms fe-
(Silver, 1982). lices que los introvertidos y disfrutan de estados de ni-
La gente parece tener un punto fijo de felicidad mo positivos ms frecuentes que los introvertidos (Costa
(Lykken y Tellegen, 1996). Imagine que usted evaluara y McCrae, 1980; Diener, Sandvik, Pavot y Fujita, 1998;
qu tan feliz es un grupo de individuos de veinte aos Emmons y Diener, 1986; Larsen y Ketelaar, 1991; Lucas
y despus esperara diez aos para dejar que les sucedan y Fujita, 2000; Watson, Clark, McIntyre y Hamaker, 1992;
una serie de acontecimientos vitales (matrimonio, carre- Williams, 1990). Los extravertidos son sumamente socia-
ra, familia, accidentes, problemas econmicos, muerte de bles, pero esto no explica por qu son ms felices; y son
los padres, etc.). Lo que probablemente descubra cuando ms felices ya sea que vivan solos o con otros, que vivan
busque a estas mismas personas a los treinta aos de edad en grandes ciudades o en reas rurales remotas y que tra-
es que aquellos que eran felices a los veinte aos sigan bajen en labores sociales o no. Los extravertidos no son
sindolo a los treinta y que aquellos que eran infelices a ms felices que los introvertidos porque sean ms socia-
los veinte tambin sigan sindolo ahora. De la misma ma- bles, sino porque son ms sensibles a las recompensas in-
nera que las personas tienen un punto fijo que regula su herentes a la mayora de las situaciones sociales (Lucas
peso corporal (lo cual se analiza en el captulo 4), tambin et al., 2000). Al ser ms sensibles a las recompensas, los
parecen tener un punto fijo que regula su felicidad y bien- extravertidos son ms susceptibles a los sentimientos
estar subjetivo (Williams y Thompson, 1993). Un grupo positivos que los introvertidos. Por ende, debido a que
de investigadores incluso lleg a la conclusin de que tienen esta mayor sensibilidad a los sentimientos positi-
quiz sea tan intil hacer el intento de ser ms feliz como vos, los extravertidos estn ms dispuestos a abordar con
tratar de ser ms alto (Lykken y Tellegen, 1996, p. 189). entusiasmo las situaciones potencialmente compensato-
Con toda certeza, esta declaracin es demasiado contun- rias que los introvertidos (Elliot y Thrash, 2002), como se
dente, pero s transmite el concepto de que la felicidad ilustra en la figura 13.2.
est tan relacionada con nuestra gentica y personalidad Los extravertidos son ms felices que los introverti-
como lo est respecto a los sucesos de nuestras vidas. dos porque poseen una mayor capacidad inherente para
De hecho, parece ser que tenemos dos puntos fijos experimentar emociones positivas. Por ejemplo, observe
emocionales en lugar de uno. Un punto fijo se relaciona las reacciones emocionales de un extravertido y de un
con la emocionalidad positiva (un punto fijo de felici- introvertido cuando les suceden acontecimientos vitales
dad). Otro tiene que ver con la emocionalidad negativa positivos y ver algo parecido a la alegra en el extraver-
(un punto fijo de infelicidad). Adems, nuestra felicidad e tido, pero slo ver satisfaccin en el introvertido. Esta
infelicidad resultan ser indicadores independientes (ms capacidad diferencial para las emociones positivas ocurre
que opuestos) del bienestar. porque extravertidos e introvertidos poseen niveles dife-
El estatus de nuestros puntos fijos de felicidad e in- rentes de sensibilidad a un sistema subyacente de motiva-
felicidad se puede explicar a travs de las diferencias in- cin biolgica introducido en el captulo 3, el sistema de
dividuales en nuestras personalidades. El punto fijo de activacin conductual (SAC; Dupue y Collins, 1999). As
felicidad surge en mayor medida de las diferencias indivi- que, bsicamente, los extravertidos tienen un SAC ms
duales en extraversin, en tanto que el punto fijo de infe- fuerte que los introvertidos. Este sistema cerebral detecta
licidad surge mayormente de las diferencias individuales y regula las seales de recompensa en el ambiente. En el
en neuroticismo. SAC, las seales de una recompensa prxima son la fuen-
te de las emociones positivas. De este modo, la emocio-
nalidad de los extravertidos se beneficia de seales ms
Extraversin y felicidad frecuentes y ms intensas de recompensa que les hacen
La caracterstica de personalidad asociada con la pre- anticipar las situaciones con entusiasmo, sintindose feli-
gunta quin es feliz?, es la extraversin (DeNeve, 1999; ces y con el deseo de aproximarse a las situaciones.
DeNeve y Cooper, 1998). Para definir la extraversin, los La funcin motivacional del SAC es energizar un
psiclogos de la personalidad analizan sus tres facetas. comportamiento dirigido a metas y orientado a la aproxi-
La primera es la sociabilidad, o la preferencia y disfrute macin (como sociabilidad, asertividad y audacia). Para
de otras personas y situaciones sociales. La segunda es la los extravertidos, las seales de recompensa activan de
asertividad, o la tendencia a la dominancia social. La ter- manera intensa su SAC, en tanto que las mismas sea-
cera es la audacia, o una tendencia a buscar y disfrutar de les ambientales de recompensa slo activan ligeramente
situaciones emocionantes y estimulantes. De este modo, el SAC de los introvertidos. Por ende, los extravertidos
278 CAPTULO 13 Caractersticas de personalidad

Extravertidos

Mayor capacidad que los introvertidos para experimentar


emociones positivas; sistemas de activacin conductual
(SAC) ms fuertes y sensibles

Entusiasmo para abordar situaciones


potencialmente compensatorias

Mayor sociabilidad Mayor dominancia social Mayor audacia


(que los introvertidos) (que los introvertidos) (que los introvertidos)

Figura 13.2 Componentes de la extraversin.

experimentan un estado de incentivo motivacional ms El bienestar hednico es la totalidad de los momentos


fuerte que energiza y gua su conducta de aproximacin. agradables que uno tenga. El bienestar hednico refleja
El SAC activado tambin les proporciona un flujo conti- una vida placentera y representa lo que la mayora de la
nuo de estados motivacionales y emocionales expresados gente considera como felicidad. En contraste, el bienes-
en sentimientos como felicidad, deseo, anhelo, emocin, tar eudaimnico tiene que ver con la autorrealizacin; se
entusiasmo, energa, potencia y confianza (Dupue y relaciona con involucrarse en empresas significativas y
Collins, 1999). En consecuencia, los extravertidos tienen con hacer aquello que es digno de hacerse. En esencia, es
mayor probabilidad de mostrar conducta de aproxima- la realizacin personal y se logra a travs de la bsqueda
cin y tambin mayor probabilidad de disfrutar de con- y consecucin de la autenticidad y el crecimiento perso-
ductas como conversar y actuar de manera asertiva. nales. Daimnico significa personalmente autntico, de
La idea de que la extraversin se asocia con el fun- modo que eudaimnico significa vivir de manera autn-
cionamiento cerebral (un SAC fuerte) significa que la tica. Debido a que se relaciona tan estrechamente con
extraversin es una diferencia individual que tiene una la motivacin de crecimiento, analizaremos el bienestar
base biolgica. El sustento de la idea de que los extraver- eudaimnico en el captulo 15.
tidos nacen y no se hacen se puede encontrar en estudios
que muestran que la extraversin es hereditaria (Eaves,
Eysenck y Martin, 1989; Pedersen, Plomin, McClearn
Neuroticismo y sufrimiento
y Friberg, 1988; Shields, 1976; Viken, Rose, Kaprio y La caracterstica de personalidad asociada con la cuestin
Kosken, 1994). Por ejemplo, los gemelos criados por se- de quin es infeliz? es el neuroticismo. El neuroticismo
parado en ambientes muy diferentes obtendrn puntua- se define como una predisposicin a experimentar afecto
ciones similares en cuestionarios diseados para evaluar negativo y a sentirse insatisfecho e infeliz de manera cr-
la extraversin, lo cual sugiere que esta caracterstica se nica (McCrae, 1990; Watson y Clark, 1984). Da tras da,
basa ms en factores genticos que en factores ambienta- los neurticos experimentan mayor estrs, mayor emo-
les (Pedersen et al., 1988). cionalidad negativa y un constante flujo de estados de ni-
mo como ansiedad, temor e irritabilidad. Lo contrario del
DIFERENCIANDO: DOS TIPOS DE FELICIDAD neuroticismo es la estabilidad emocional. De este modo,
La discusin anterior hara parecer que los introvertidos la emocionalidad de los neurticos sufre en un mayor
estn genticamente destinados a una vida emocional in- grado que la de los individuos emocionalmente estables
sulsa e insatisfecha. Aunque es posible que esto sea cierto (Bolger y Zuckerman, 1995; Suls, Green y Hillis, 1998).
en parte, no es as del todo porque existen dos tipos de Los neurticos sufren a nivel emocional. Esto ocurre
felicidad: hednica y eudaimnica (Ryan y Deci, 2001). por su mayor capacidad para experimentar las emocio-
Excitacin 279

nes negativas y porque albergan pensamientos alterados res incluso afirman que la extraversin y el neuroticismo
y perturbadores de manera crnica (McCrae y Costa, representan las dimensiones bsicas de la personalidad
1987). As, los sucesos negativos de la vida traen para el (Eysenck, 1991). La dimensin de personalidad que pre-
neurtico no slo el suceso negativo en s, sino tambin dispone al individuo hacia la emocionalidad positiva, el
una multitud de pensamientos molestos y pesimistas que SAC y un temperamento de aproximacin es la extra-
tienen el hbito de permanecer largo tiempo despus de versin. La dimensin de personalidad que predispone
que ha terminado el suceso negativo. al individuo hacia una emocionalidad negativa, el SIC y
Esta capacidad diferencial para las emociones nega- un temperamento de evitacin es el neuroticismo (Costa
tivas ocurre debido a que los individuos neurticos y los y McCrae, 1980; McCrae y Costa, 1991; Elliot y Thrash,
emocionalmente estables poseen diferentes niveles de 2002; Gray, 1982, 1987a, 1987b; Tellegen, 1985).
sensibilidad en el sistema biolgico motivacional subya- Existen varias pruebas confiables y vlidas para medir
cente que se present en el captulo 3 como sistema de estas dimensiones de la personalidad, incluyendo las esca-
inhibicin conductual (SIC; Gray, 1987a; Tellegen, 1985). las del inventario de personalidad NEO (NEO-PI-R; Costa
Los neurticos tienen un SIC fuerte y sumamente sen- y McCrae, 1992), el Big Five Inventory (BFI: Inventario
sible. Este sistema cerebral detecta y regula las seales de los cinco grandes factores; John y Srivastrava, 2000)
ambientales de castigo. En el SIC, las seales de un cas- y el cuestionario de personalidad de Eysenck (EPQ-R;
tigo prximo son la fuente de emociones negativas como Eysenck, Eysenck y Barrett, 1985). Con base en las pun-
temor y ansiedad. Por esta razn, los neurticos son ms tuaciones de los examinandos en estos cuestionarios, los
vulnerables y ms susceptibles a las emociones negativas psiclogos pueden pronosticar de manera confiable quin
(Larsen y Ketelaar, 1991). De este modo, la emocionali- mostrar emocin, entusiasmo y felicidad ante situacio-
dad de los neurticos sufre de seales ms frecuentes e nes potencialmente gratificantes (es decir, extravertidos) y
intensas de castigo que les dejan con la anticipacin de quin se sentir inhibido, dudoso y ansioso ante situacio-
que las situaciones que enfrenten les traern temor y an- nes potencialmente amenazantes (es decir, neurticos). La
siedad. Esto provoca la suficiente angustia como para en- confianza de los psiclogos se deriva de saber lo siguien-
gendrar un deseo motivacional de evitar un amplio rango te: cuando los extravertidos entran en una situacin, en
de situaciones. general su sistema motivacional SAC les hace sensibles
La funcin motivacional del SIC es energizar la con- en particular a los aspectos de recompensa potencial y, en
ducta dirigida a metas y orientada a la evitacin (como consecuencia, experimentan las emociones positivas que
escape, retraimiento y evitacin). Para los neurticos esto implica y de manera voluntaria se aproximan a esa
que se exponen a una situacin que implica un castigo situacin. Cuando los neurticos entran en una situacin,
potencial (p. ej., una entrevista de trabajo, presentar un en general su sistema motivacional SIC les sensibiliza en
examen, estar en una casa ruidosa), las seales de cas- particular a los aspectos de castigo potencial y, en conse-
tigo activan de manera intensa su SIC, en tanto que las cuencia, experimentan las emociones negativas que esto
mismas seales de castigo slo activan en forma leve el implica y de manera voluntaria evitan esa situacin.
SIC de los individuos emocionalmente estables. Por ende,
los neurticos experimentan un estado de incentivo mo-
tivacional ms fuerte que energiza y gua su conducta Excitacin
de evitacin. El SIC activado tambin le proporciona al
La excitacin representa una variedad de procesos que
neurtico un flujo continuo de estados motivacionales
gobiernan el estado de alerta, la vigilia y la activacin
y emocionales que se expresa como sentimientos de te-
mor, ansiedad, irritabilidad, angustia, hostilidad, enojo, (Anderson, 1990). Estos procesos son mecanismos corti-
depresin y cohibicin (McCrae y Costa, 1986). En con- cales, conductuales y autnomos. De este modo, en con-
secuencia, los neurticos tienen mayor probabilidad de junto, la actividad del cerebro (cortical), sistema mscu-
presentar comportamientos de evitacin y ms proba- lo-esqueltico (conductual) y sistema nervioso autnomo
bilidad de sufrir angustia emocional durante conductas (autnomo) constituyen la mayor parte del constructo de
como presentar un examen (Bolger, 1990) o discutir con la excitacin.
su cnyuge (Bolger y Schilling, 1991). Cuatro principios explican la contribucin de la exci-
tacin a la motivacin:
Los extravertidos son generalmente 1. El nivel de excitacin de una persona est en funcin
felices; los neurticos son generalmente de qu tan estimulante es el ambiente.
2. Las personas participan en actividades para aumentar
infelices o disminuir su nivel de excitacin.
La extraversin y el neuroticismo representan dos dimen- 3. Cuando las personas estn subexcitadas, buscan
siones bsicas de la personalidad. Algunos investigado- oportunidades para incrementar sus niveles de exci-
280 CAPTULO 13 Caractersticas de personalidad

tacin porque el aumento en la estimulacin ambien- en atletismo o tener una entrevista de trabajo. Cuando se
tal es placentero y mejora el desempeo, en tanto que siente indiferente y subexcitado o cuando est ansioso y
la disminucin es aversiva y socava el desempeo. sobreexcitado, el desempeo tiende a mermar. Cuando la
4. Cuando las personas estn sobreexcitadas, buscan excitacin es moderada estar alerta, pero no tenso el
oportunidades para reducir su nivel de excitacin desempeo tiende a ser ptimo.
porque el aumento en la estimulacin ambiental es Un nivel moderado de excitacin coincide con la
aversivo y socava el desempeo, en tanto que la dis- experiencia de placer (Berlyne, 1967). La baja estimula-
minucin es placentera y mejora el desempeo. cin produce aburrimiento e intranquilidad; la alta esti-
mulacin produce tensin y estrs. Tanto el aburrimiento
Estos cuatro principios se pueden organizar en forma como el estrs son experiencias aversivas y la gente se
colectiva en la relacin de U invertida entre activacin y esfuerza por escapar de ambas. Cuando est subexcita-
desempeo/bienestar que se presenta en la figura 13.3. La da y experimenta afecto negativo, una persona buscar
curva de U invertida, presentada inicialmente hace poco actividades que le ofrezcan estimulacin, oportunidades
ms de un siglo por Robert Yerkes y John Dodson (1908), para explorar algo nuevo y quizs incluso querr asumir
ayuda a explicar la relacin entre la activacin percibida riesgos. Por otro lado, cuando la excitacin es mayor al
y los consiguientes estados motivacionales y emocionales nivel ptimo, la persona evitar y rechazar los posterio-
en las personas (Berlyne, 1967; Duffy, 1957; Hebb, 1955; res incrementos en estimulacin ambiental. Cuando la
Lindsley, 1957; Malmo, 1959). excitacin es excesiva, el aumento en estimulacin, no-
vedad y riesgo crean afecto negativo: estrs, frustracin y
Desempeo y emocin molestia. Las personas sobreexcitadas se sienten atradas
a la calma ambiental: unas vacaciones, lectura informal
La curva de U invertida ilustra que un bajo nivel de ac- del peridico o salir a una caminata tranquila. De este
tivacin produce un desempeo relativamente deficiente modo, la curva de U invertida predice cundo los aumen-
(parte inferior izquierda). A medida que el nivel de ex- tos y disminuciones en excitacin conducirn a un afecto
citacin aumenta de bajo a moderado, mejoran tanto la positivo y conducta de aproximacin y cundo conduci-
intensidad como la calidad del desempeo. A medida que rn a afecto negativo y evitacin.
contina aumentando el nivel de excitacin de modera-
do a alto, disminuyen la calidad y eficiencia (pero no la
intensidad) del desempeo (parte inferior derecha). De Estimulacin insuficiente y subexcitacin
este modo, el desempeo ptimo est en funcin de estar La investigacin sobre privacin sensorial ilustra las con-
activado (excitado), pero no demasiado. Para compren- secuencias psicolgicas de estar sometido a subexcitacin
der la relacin de excitacin y desempeo, recuerde la (Bexton, Heron y Scott, 1954; Heron, 1957; Zubek, 1969).
eficiencia de su propio desempeo mientras hace algo La privacin sensorial se refiere a la experiencia sensorial
importante; por ejemplo, al hablar en pblico, competir y emocional de un individuo en un ambiente rgidamente

Eficiencia
del desempeo
y afecto

Aumento en alerta, Aumento


inters, emocin en alteracin
positiva emocional, ansiedad

Baja Moderada Alta


Excitacin

Figura 13.3 Curva de U invertida: relacin entre el nivel de excitacin y el desempeo/bienestar.


Fuente: Tomado de D. O. Hebb, Drive and the C. N. S. Conceptual Nervous System, en Psychological Review, 62, 1955, pp. 245-254.
Excitacin 281

constante. Durante sus investigaciones, Woodburn Heron tantes como un divorcio, lesiones fsicas y desempleo
(1957) pag una cantidad sustancial de dinero por da a (Holmes y Rahe, 1967; Iversen y Sabroe, 1989); de las di-
estudiantes universitarios varones para que se recostaran ficultades cotidianas como no encontrar o perder cosas
en una cmoda cama durante tantos das como quisieran y quedarse atrapado en el trnsito (DeLongis, Folkman y
permanecer all (vase figura 13.4). La tarea de los par- Lazarus, 1988; Lazarus y DeLongis, 1983); y de circuns-
ticipantes era simplemente permanecer en un ambiente tancias crnicas, como atencin infantil inadecuada,
constante, con tiempo aparte para las comidas y visitas al hacinamiento o problemas repetitivos en una relacin
bao. Para restringir la informacin sensorial relaciona- (DeLongis, Coyne, Dakof, Folkman y Lazarus, 1982;
da con el tacto, los participantes llevaban guantes de al- Eckenrode, 1984). Los acontecimientos vitales importan-
godn con largos puos de cartn. Tambin llevaban un tes dan una sacudida a los sistemas nervioso y endocrino
visor translcido especial que restringa su informacin del cuerpo, en tanto que las molestias diarias y las cir-
visual. Para restringir la informacin auditiva, un aparato cunstancias crnicas producen un intenso efecto acumu-
de aire acondicionado emita un zumbido constante que lativo sobre los sistemas del organismo.
enmascaraba la mayora de los sonidos. Los ambientes estresantes y sobreestimulantes tras-
Incluso en el primer da los participantes informaron tornan los estados emocionales, obstaculizan la actividad
una incapacidad para pensar con claridad. A medida que cognitiva y aceleran los procesos fisiolgicos. Las altera-
pasaban las horas, muchos participantes dijeron experi- ciones emocionales se manifiestan en sentimientos de an-
mentar periodos en blanco (se les acababan las cosas en siedad, irritabilidad y enojo (Horowitz, Wilner, Kaltreidr
qu pensar) y otros simplemente dejaban vagar sus pensa- y Alvarez, 1980). Las alteraciones cognitivas se manifies-
mientos. Casi todos informaron sueos y visiones duran- tan en confusin, olvidos y problemas de concentracin
te la vigilia. A lo largo del estudio, los hombres sometidos (Broadbent, Cooper, FitzGerald y Parkes, 1982). Las alte-
a privacin sensorial realizaron una serie de pruebas de raciones fisiolgicas se manifiestan en hiperactividad del
aritmtica, anagramas y asociaciones de palabras lue- sistema nervioso simptico, como ocurre a travs de ele-
go de 12, 24 y 48 horas de privacin. El desempeo in- vacin en la presin arterial (Seyle, 1956). Como un ejem-
cluso en los problemas matemticos simples se redujo plo especfico, imagine que tiene que presentar un trabajo
con rapidez. Despus del segundo da, clculos como final de clase en dos horas y no est ni cerca de terminar-
16 65 eran demasiado difciles de resolver. Los parti- lo. Es probable que su amabilidad sea francamente nula
cipantes tambin fueron volvindose ms irritables. De (pocos individuos demasiado estresados sonren, ren o
hecho, para Heron result difcil mantener a sus irritados cuentan chistes), es probable que su eficiencia mental est
participantes dentro del experimento por ms de dos o trastornada (al no poder pensar con claridad) y que su
tres das, a pesar del fuerte incentivo econmico ofrecido frecuencia cardiaca, tono muscular y vulnerabilidad a un
a cambio de quedarse. dolor de cabeza sean elevados y estn en ascenso.
Los estudios sobre privacin sensorial destacan el Debido a que el estrs y la tensin son sensaciones
hecho de que el cerebro y el sistema nervioso prefieren aversivas, la gente en general quiere escapar de los am-
un nivel continuo y moderado de excitacin generada bientes demasiado estimulantes. Cuando no puede hacer-
por la estimulacin ambiental. Imagine las experiencias lo, el funcionamiento cotidiano se caracteriza por afecto
emocionales de los animales en las jaulas de los zoolgi- negativo, confusin cognitiva, deficiencias en el desem-
cos, a los presos dentro de celdas de prisin, a los adultos peo y problemas de salud, como se analiza en el apar-
mayores en asilos, los presos polticos en confinamiento tado 13. Por fortuna, de la misma manera que contamos
solitario, los pacientes crnicos en los pabellones hos- con incentivos para contrarrestar la falta de estimulacin
pitalarios y a los estudiantes que soportan exposiciones y la subexcitacin, tambin los tenemos para contrarres-
montonas. Pero los seres humanos no son simplemente tar la estimulacin excesiva y la sobreexcitacin.
receptores pasivos de cualquier estimulacin que ofrezca
el ambiente. Cuando se encuentran subestimuladas, las Credibilidad de la hiptesis
personas dependen de varios medios cognitivos y con-
ductuales para aumentar el nivel de excitacin(p. ej., im- de la U invertida
genes mentales, interaccin social); es decir, los seres hu- La credibilidad de la curva de U invertida (vase figura
manos tienen motivos para contrarrestar la estimulacin 13.3) no est libre de cuestionamientos. Rob Neiss (1988)
insuficiente y la subexcitacin. propuso cuatro crticas contra la hiptesis, dos de las
cuales se aplican a la motivacin y emocin (Anderson,
1990). La primera crtica de Neiss es que la curva de U
Estimulacin excesiva y sobreexcitacin invertida es ms una descripcin que una explicacin.
A veces la vida es aburrida, pero en otras ocasiones es Esto es, la hiptesis resume la relacin entre excitacin
estresante. El estrs proviene de acontecimientos impor- y desempeo/emocin, pero se queda corta en cuanto a
282 CAPTULO 13 Caractersticas de personalidad

Figura 13.4 Cmara de privacin sensorial.


Fuente: Tomado de W. Heron, The Pathology of Boredom, en Scientific American, 196, 1957, pp. 52-56. Copyright 1957 de Scientific American. Adaptado con
autorizacin de la ilustracin hecha por Eric Mose.
Excitacin 283

A PARTADO 13

Excitacin y estrs experimenta directamente una elevacin en el nivel de epinefrina


sino que, en lugar de ello, experimenta una elevacin en el es-
tado de activacin corporal. Es este estado el que las personas
experimentan como excitacin.
Pregunta: Por qu es importante esta informacin? Nuestros organismos tambin responden a los ambientes
Respuesta: Para explicar la manera en que las experiencias estimulantes y estresantes con una respuesta crnica y de larga
psicolgicas de control percibido y competencia percibida duracin producida por el sistema hipotlamo-corticosuprarre-
pueden apagar la respuesta fisiolgica ante el estrs. nal. Cuando las demandas y retos son elevados, las glndulas
suprarrenales segregan corticosteroides, de los cuales el ms
importante en sentido motivacional es la hidrocortisona. A di-
ferencia de la epinefrina, que se libera al organismo en segun-
Los ambientes nos estimulan y desafan. La excitacin y el dos, la hidrocortisona se libera en el cuerpo a travs del sistema
estrs son dos respuestas motivacionales ante los ambientes hipotlamo-corticosuprarrenal en cuestin de minutos y horas.
estimulantes y demandantes. En respuesta a la estimulacin En tanto que la persona siga experimentando estrs, la hidro-
y desafo, intentamos afrontar la situacin y adaptarnos. Por cortisona contina siendo liberada. En la medida en que ese
ejemplo, conocer a los padres de nuestra pareja nos estimu- individuo afronte con xito el suceso estresante, la secrecin de
la y desafa y, para afrontar bien las cosas, nuestro corazn se hidrocortisona se vuelve ms lenta o se detiene por completo.
acelera y nuestra atencin se enfoca en la tarea. Las respuestas Cuando el afrontamiento exitoso inhibe la liberacin de hidrocor-
corporales hacia los ambientes estimulantes y demandantes tisona, la persona tiene la experiencia psicolgica de reduccin
constituyen los fundamentos biolgicos de la excitacin y del en el estrs (a travs de un aumento en su sensacin de domi-
estrs que sentimos. nio). Cuando el afrontamiento falla en apagar la hidrocortiso-
La excitacin en gran medida est en funcin de qu tan es- na, la persona tiene la experiencia psicolgica de aumento en
timulante es el ambiente, mientras que el estrs est en funcin el estrs.
de qu tan demandante y controlable es el ambiente. La supresin de la hidrocortisona es esencial para el afron-
Nuestro organismo responde a los ambientes estimulantes tamiento eficiente, porque los niveles elevados de esta hormona
y estresantes con una respuesta aguda y breve producida por el reducen el funcionamiento intelectual, alteran el metabolismo,
sistema simptico-suprarrenal-medular. Cuando la estimulacin disminuyen la respuesta del sistema inmunitario, reducen la
es elevada, el sistema simptico-suprarrenal-medular activa la respuesta del cuerpo a las infecciones y suprimen el proceso
rama nerviosa simptica para gastar energa (como en la res- reproductivo. Por ejemplo, cuando la hidrocortisona es alta, la
puesta de pelea o huida). Cuando la estimulacin es baja, el sis- capacidad de la gente para resolver problemas intelectuales se
tema activa la rama nerviosa parasimptica a fin de conservar altera en forma significativa (Kirschbaum et al., 1996). Como un
energa (como cuando se est en reposo y al digerir alimentos). detalle ms positivo, la percepcin de competencia, dominio o
Un suceso clave en la excitacin del sistema nervioso simpti- control suprimen la hidrocortisona (Booth, Shelley, Mazur, Tharp
co es la liberacin de epinefrina (o adrenalina). La epinefrina y Kittok, 1989). En consecuencia, las ganancias en la funcin de
es la catecolamina responsable del aumento en la frecuencia control percibido son el antdoto tanto para la hidrocortisona
cardiaca, presin arterial y frecuencia respiratoria. La gente no como para el estrs.

explicar de qu manera la excitacin facilita u obstaculiza di a estudiantes universitarios que resolvieran un par de
el desempeo/emocin. pruebas de vocabulario dentro de una condicin ya fuera
La segunda crtica de Neiss (1988) es que incluso si de ocio o de estrs (presin de tiempo; Revelle, Amaral
la hiptesis de la U invertida es cierta, sigue siendo irre- y Turriff, 1976). Adems, antes de someterse a las prue-
levante. En otras palabras, esta hiptesis slo se aplica bas, todos los estudiantes tomaron una pastilla con 200
cuando los niveles de activacin son extremos, como en mg de cafena (equivalente a la cafena de dos tazas de
los estudios sobre privacin sensorial. Neiss concluye caf) o una pastilla placebo (sin cafena). El propsito de
que la hiptesis de la U invertida no se aplica a cues- las manipulaciones en la presin de tiempo y cantidad
tiones cotidianas en las que el nivel de excitacin cam- de cafena era crear el tipo de elevacin en la estimula-
bia relativamente poco. Aunque algunos psiclogos de cin que ocurre en la vida diaria. El experimento tena
la motivacin coinciden con esta crtica, otros estn en una variable importante adicional: cada estudiante res-
desacuerdo. pondi a una encuesta de personalidad para diferenciar
Para ilustrar cmo se aplica la hiptesis de la U in- a los introvertidos (personas con sobreexcitacin cr-
vertida a los cambios cotidianos en la excitacin, se pi- nica) de los extravertidos (personas con subexcitacin
284 CAPTULO 13 Caractersticas de personalidad

crnica). Con base en la hiptesis de la U invertida, los BSQUEDA DE NUEVAS EXPERIENCIAS


experimentadores pronosticaron que: 1) los introvertidos Quien busca sensaciones explora de manera continua
con sobreexcitacin tendran un buen desempeo en la experiencias novedosas, como probar comida picante
situacin de relajacin, pero su desempeo sera diferen- (Terasaki e Imada, 1988), cambiar los programas en la te-
te al estimularlos, en tanto que 2) los extravertidos con levisin (Schierman y Rowland, 1985), escuchar msica
subexcitacin tendran un desempeo deficiente en la con cierto vigor (Litle y Zuckerman, 1986), entre otras.
relajacin, pero bueno al ser estimulados. Los resultados Una manifestacin de la bsqueda de nuevas experiencias
confirmaron las predicciones. El experimento es impor- es el sexo. En comparacin con las personas que evitan
tante porque muestra que la hiptesis de la U invertida se las sensaciones, quienes son buscadores de sensaciones
aplica muy bien a las fuentes cotidianas de estimulacin: informan una mayor frecuencia y variedad (nmero de
cafena y presin de tiempo. La activacin diaria modera- parejas) en la actividad sexual (Zuckerman, Bone, Nearu,
da se asocia con desempeo y emocin ptimos, en tanto Mangelsdorff y Brustman, 1972; Zuckerman, Tushup
que no ocurre lo mismo con la excitacin baja o excesiva. y Finner, 1976). Los buscadores de sensaciones infor-
man que la relacin y el involucramiento emocional son
Bsqueda de sensaciones prerrequisitos menos importantes para involucrarse
en una relacin sexual, en comparacin con personas
Los seres humanos difieren en su nivel gentico basal de
que evitan las sensaciones (Hendrick y Hendrick, 1987;
excitacin y en su capacidad de reaccin a los estmulos
Zuckerman et al., 1976). Es ms, como padres, las perso-
ambientales. El nivel basal de activacin es qu tanta ex-
nas con elevada bsqueda de sensaciones establecen nor-
citacin tiene una persona sin estimulacin externa. Por
mas ms permisivas para la actividad sexual de sus hijos
otro lado, la capacidad de reaccin se refiere a la reac-
(Zuckerman et al., 1976).
cin de excitacin cuando se expone a la persona a una
Asimismo, las drogas pueden dar el medio para una
estimulacin externa.
elevacin rpida en la excitacin. Tambin abren la puer-
La bsqueda de sensaciones es la caracterstica de
ta a nuevas experiencias (alucinaciones), reducen las inhi-
personalidad relacionada con la excitacin y la capaci-
biciones contra comportamientos de riesgo y sirven como
dad de reaccin. Una persona con una bsqueda elevada
escape del aburrimiento. A travs de cualquiera o todos
de sensaciones prefiere una provisin externa continua de
estos significados de alterar las experiencias, el uso de
estimulacin cerebral, se aburre con la rutina y continua-
drogas funciona como una forma de bsqueda de sensa-
mente busca maneras de aumentar la excitacin mediante
ciones (Zuckerman, 1978, 1994; Zuckerman et al., 1972).
experiencias emocionantes. La persona con un bajo nivel
Para fundamentar estas afirmaciones, Zuckerman y sus
de bsqueda de sensaciones prefiere menor estimulacin
colaboradores (1972) pidieron a estudiantes universitarios
cerebral y tolera relativamente bien la rutina. En gene-
que respondieran a la escala de bsqueda de sensaciones
ral, el constructo de bsqueda de sensaciones se refiere al
(SSS) y a un cuestionario sobre su uso de alcohol y drogas.
grado en que el sistema nervioso central de la persona (su
Los buscadores de sensaciones informaron uso frecuente
cerebro y mdula espinal) requiere cambio y variabilidad,
ya que quienes buscan sensaciones prefieren cambiar ac- de estas sustancias. Su exploracin de nuevas experiencias
tividades, cambiar los canales de televisin, cambiar de tambin se extiende a actos aberrantes como vandalismo,
drogas, cambiar de pareja sexual, y as sucesivamente agresin, robo y criminalidad (Newcomb y McGee, 1991;
(Zuckerman, 1994). White, Labourvie y Bates, 1985; Zuckerman, 1979).
La bsqueda de sensaciones se define como la bs-
queda de experiencias variadas, novedosas, complejas e ASUMIR RIESGOS
intensas, y la disposicin a asumir riesgos fsicos, sociales, A nadie le gusta el riesgo en s, que es esencialmente el
legales y econmicos en beneficio de obtener tales expe- presagio de que un comportamiento producir conse-
riencias (Zuckerman, 1994). Marvin Zuckerman (1994) cuencias negativas. No es que quien busca sensaciones
utiliza el ejemplo de conducir un automvil a gran velo- se sienta atrado por los riesgos fsicos, sociales, legales o
cidad despus de ingerir grandes cantidades de alcohol econmicos; ms bien, estas personas consideran que por
para ilustrar la disposicin del buscador de sensaciones a las sensaciones y experiencias vale la pena asumir esos
asumir riesgos fsicos (sufrir dao l mismo u otras per- riesgos, en tanto que quienes evitan las sensaciones no lo
sonas), riesgos sociales (ser expuesto como conductor al- ven as. En consecuencia, aceptacin de riesgos parece
coholizado), riesgos legales (ser arrestado y encarcelado) un trmino ms apropiado que asumir riesgos.
y riesgos econmicos (ser despedido del empleo). Tales Los individuos con una elevada bsqueda de sen-
riesgos son el precio que est dispuesto a pagar quien saciones participan en forma voluntaria en pasatiem-
busca las sensaciones para lograr las sensaciones y expe- pos arriesgados en sentido fsico, como motociclismo
riencias que busca. (Brown, Ruder, Ruder y Young, 1974), paracaidismo y
Excitacin 285

paracaidismo acrobtico (Hymbaugh y Garrett, 1974), Intensidad del afecto


viajes de aventura (Jacobs y Koeppel, 1974), inmigracin
(Winchie y Carment, 1988), tabaquismo (Zuckerman, La intensidad del afecto tiene que ver con la capacidad
Ball y Black, 1990), descenso en esqu (Calhoon, 1988) y de las personas para excitarse en sentido emocional. Se
aficin por juegos de azar (Kohlman, 1975). En contraste, le define en funcin de la fuerza con la que los indivi-
las personas con baja bsqueda de sensaciones muestran duos experimentan tpicamente sus emociones (Larsen y
una capacidad de reaccin aversiva hacia las fuentes ries- Diener, 1987). Los individuos con afecto intenso experi-
gosas de estimulacin (Mellstrom, Cicala y Zuckerman, mentan fuertemente sus emociones y muestran capaci-
1976). La aficin por los juegos de azar ilustra parte de la dad de respuesta emocional y variabilidad entre muchas
motivacin de los buscadores de sensaciones en cuanto a situaciones diferentes que provocan emocin. Los indi-
asumir riesgos, ya que la emocin, ms que el dinero, es viduos con afecto estable experimentan slo de manera
lo que motiva a la mayora de la gente a jugar (Anderson leve sus emociones y muestran slo fluctuaciones meno-
y Brown, 1984). res en sus reacciones emocionales de un momento a otro
El asumir riesgos por parte de las personas que bus- o de un da a otro.
can sensaciones se manifiesta en muchas reas de la vida, Los investigadores miden la intensidad del afecto con
como en la conducta delictiva (robo menor, venta de un cuestionario de autoinformacin que incluye reacti-
drogas), violaciones menores (infracciones de trnsito), vos como los siguientes: Cuando estoy feliz, esto repre-
economa (juegos de azar, negocios riesgosos) y depor- senta una fuerte sensacin desbordante y Cuando estoy
tes (paracaidismo) (Horvath y Zuckerman, 1993). Por nervioso, siento que todo mi cuerpo tiembla (Larsen y
ejemplo, conducir a alta velocidad ofrece riesgos fsicos, Diener, 1987). Originalmente los investigadores evalua-
sociales, legales y econmicos potenciales. En compara- ron la intensidad del afecto de una manera interesante,
cin con quienes evitan las sensaciones, aquellos que las aunque laboriosa, que ilustra muy bien la emocionalidad
buscan informan conducir a mayor velocidad (bastante de la gente a lo largo del tiempo (Larsen, 1988). Durante
ms que el lmite de velocidad establecido) (Arnett, 1991; un periodo de 80-90 das consecutivos, los individuos res-
Clement y Jonah, 1984; Zuckerman y Neeb, 1980) y no pondieron diariamente a un cuestionario de estado de ni-
perciben que conducir muy cerca del vehculo que lle- mo que inclua palabras relacionadas con estado de nimo
van enfrente sea riesgoso o que provoque trastornos en positivo (p. ej., feliz, dichoso) y negativo (p. ej., deprimi-
sentido fisiolgico (Heino, Van der Molen y Wilde, 1992, do, preocupado). Para calcular la intensidad del afecto, se
segn se informa en Zuckerman, 1994). sum la puntuacin diaria de cada sujeto para las palabras
sobre estado de nimo negativo y este total se rest de la
suma para las palabras relacionadas con estado de nimo
BASE BIOLGICA positivo a fin de obtener un estado de nimo diario. En
Los sucesos bioqumicos en el cerebro influyen en cmo cada da consecutivo, la puntuacin total diaria de estado
reacciona la gente a la estimulacin ambiental, por lo que de nimo se registr en una grfica. La intensidad del afec-
los investigadores estudian los vnculos entre el rasgo de to se defina por cunto se desviaba la puntuacin diaria
bsqueda de sensaciones y estos hechos bioqumicos ce- de estado de nimo de la persona con respecto a una pun-
rebrales. El hallazgo ms confiable es que los buscadores tuacin neutra (0). En la figura 13.5 se presenta el estado
de sensaciones tienen bajos niveles de monoaminooxida- de nimo diario de tres personas diferentes en el experi-
sa (MAO) (Schooler, Zahn, Murphy y Buchsbaum, 1978). mento. El estado de nimo diario del individuo con afecto
La MAO es una enzima del sistema lmbico involucrada intenso (sujeto 23) se elevaba y caa de manera bastante
en descomponer los neurotransmisores cerebrales como sustancial. Sus das eran muy buenos o muy malos. El es-
la dopamina y la serotonina. La dopamina contribuye tado de nimo del individuo con afecto estable (sujeto 21)
a las experiencias de recompensa y, en consecuencia, se situaba continuamente cerca del nivel neutro. Los das
facilita las conductas de aproximacin (Stellar y Stellar, eran en su mayora iguales, en un sentido emocional. La
1985). La serotonina contribuye a la inhibicin biolgi- grfica de estado de nimo diario ms tpica se encuentra
ca, o al sistema de detencin fisiolgica del cerebro y, por al centro (sujeto 74) y muestra la emocionalidad cotidiana
ende, inhibe las conductas de aproximacin (Panksepp, de una persona que no tiene afecto intenso ni estable.
1982). Los buscadores de sensaciones tienden a presentar Con propsitos de ilustracin, imagine que cada uno
niveles relativamente elevados de dopamina, de aqu que de los siguientes acontecimientos, unos buenos y otros
su bioqumica favorezca la aproximacin por encima de malos, le han sucedido recientemente: obtuvo una beca
la inhibicin (Zuckerman, 1994). Tambin tienden a pre- que necesitaba con desesperacin o recibi una carta de
sentar niveles relativamente bajos de serotonina, de aqu un amigo al que dej de ver hace largo tiempo (aconte-
que su bioqumica impida la inhibicin en cuanto a ries- cimientos vitales positivos); su automvil tiene una llan-
gos y nuevas experiencias. ta ponchada o vio a su ex novio o novia con un nuevo
286 CAPTULO 13 Caractersticas de personalidad

amor (acontecimientos vitales negativos) (Larsen, Diener emocionalidad negativa significativamente peor que los
y Emmons, 1987). Suponga adems que se le pide que ca- individuos con afecto estable. En todos los acontecimien-
lifique con precisin qu tan bueno o qu tan malo fue tos buenos (figura inferior), los individuos con afecto in-
cada suceso inmediatamente despus de ocurrido. Por tenso (cuadrados negros) informaron una emocionalidad
ejemplo, qu tan bien se sinti al recibir la carta de su significativamente ms positiva que los individuos con
amigo perdido? Qu tan mal se sinti cuando se desinfl afecto estable.
la llanta? En la figura 13.6 se presenta qu tan buenos o Los individuos con afecto intenso y afecto estable no
malos fueron los acontecimientos para las vidas de los in- difirieron entre s en sentido fisiolgico (Blascovich et al.,
dividuos con afecto intenso y con afecto estable. Para to- 1992). Ms bien, difirieron en trminos psicolgicos, ya
dos los acontecimientos (figura superior), los individuos que aquellos con afecto intenso tienen una mayor sensi-
con afecto intenso (cuadrados negros) informaron una bilidad psicolgica a los cambios en la excitacin respecto

Datos del sujeto 21


6
5
4
3
2
1
Estado
0
de nimo
1
2
3
4
5
6
0 10 20 30 40 50 60 70 80 90
Da

Datos del sujeto 74


6
5
4
3
2
1
Estado
0
de nimo
1
2
3
4
5
6
0 10 20 30 40 50 60 70 80 90
Da

Datos del sujeto 23


6
5
4
3
2
1
Estado
0
de nimo
1
2
3
4
5
6
0 10 20 30 40 50 60 70 80 90
Da

Figura 13.5 Informes de estado de nimo diario graficados a lo largo de ochenta das consecutivos.
Fuente: Tomado de R. J. Larsen, Individual Differences in Affect Intensity, ponencia presentada en la Reunin Anual de la Conferencia de Motivacin y Emocin,
en Nags Head, Carolina del Norte, 1988.
Control 287

Baja intensidad de afecto


Alta intensidad de afecto
Estado de
nimo muy
malo
Estado
de nimo
moderadamente
malo

Estado
de nimo
ligeramente
malo

Estado Estado Estado


de nimo de nimo de nimo
ligeramente moderadamente muy malo
malo malo

Estado de
nimo muy
bueno
Estado
de nimo
moderadamente
bueno

Estado
de nimo
ligeramente
bueno

Estado Estado Estado


de nimo de nimo de nimo
ligeramente moderadamente muy bueno
bueno bueno

Figura 13.6 Reacciones afectivas a sucesos buenos y malos en individuos con afecto intenso y estable.
Fuente: Tomado de R. J. Larsen, E. Diener y R. A. Emmons, Affect Intensity and Reactions to Daily Life Events, en Journal of Personality and Social Psychology, 51, 1987,
pp. 803-814. Copyright 1987 de American Psychological Association. Adaptado con autorizacin.

de las personas cuyo afecto es estable. Es casi como si las Manfredo y Al-Falaij, 1987) y autoeficacia (Bandura,
personas con afecto intenso tuvieran un termostato de 1986; Berry y West, 1993). Sin embargo, dos de estas ca-
excitacin sumamente sensible que vigila sus aumentos ractersticas de personalidad capturan de modo adecua-
en activacin. Por el otro lado, los individuos con afecto do la mayor parte del espritu de las creencias de control:
estable tienen un termostato relativamente aletargado e control percibido y deseo de control. El control percibido
insensible a la excitacin (Blascovich et al., 1992). se refiere a las diferencias en las expectativas de las per-
sonas antes de ejecutar una accin en cuanto a poseer la
capacidad necesaria para producir resultados positivos
Control
(Skinner et al., 1998). El deseo de control tiene que ver
Muchas caractersticas posibles de personalidad se po- con el grado en que las personas se esfuerzan en tomar
dran incluir dentro de la categora de creencias de sus propias decisiones, influir en los dems, asumir roles
control personal, como son lugar de control (Findley y de liderazgo y entrar en situaciones con una preparacin
Cooper, 1983; Levenson, 1981; Rotter, 1966), control excesiva (Burger, Oakman y Bullard, 1983).
percibido (Skinner, 1985), orientaciones de causalidad
(Deci y Ryan, 1985a), orientacin de dominio frente al
desamparo (Diener y Dweck, 1978, 1980), estilo expli- Control percibido
cativo (Peterson y Seligman, 1984), deseo de control El control percibido se refiere a las creencias y expectati-
(Burger, 1992), patrn conductual tipo A (Strube, Boland, vas que tiene una persona en cuanto a si puede interac-
288 CAPTULO 13 Caractersticas de personalidad

tuar con el ambiente de modo que produzca resultados en consecuencia. A lo largo del tiempo, tales sucesos con-
deseados y prevenga resultados indeseables (Skinner, ducen a la gente a volverse ms pesimista, a reducir sus
1995; Skinner et al., 1998). A fin de percibir que uno tiene expectativas de control futuro y a abandonar la idea de
el control sobre una situacin determinada, se requiere hacer planes y estrategias para prevenir tal recurrencia.
que dos cosas sean ciertas. Primero, el sujeto debe ser ca- Para evaluar las diferencias individuales en las per-
paz de obtener el resultado deseable disponible. Segundo, cepciones de control, los investigadores utilizan cuestio-
la situacin sobre la cual se intenta ejercer control necesi- narios que contienen los siguientes reactivos (Skinner,
ta ser por lo menos un tanto predecible y sensible. Chapman y Baltes, 1988):
La investigacin sobre desamparo aprendido (captu-
1. Si decidieras sentarte y aprender realmente bien algu-
lo 9) muestra que cuando las personas se encuentran en
na cosa, podras aprenderlo?
ambientes impredecibles y que no responden, aprenden
2. Apuesto que no te gustan las bajas calificaciones.
que sus acciones y esfuerzos son intiles. Pero lo contra-
Puedes hacer algo para evitar recibirlas?
rio no necesariamente es cierto. Cuando los ambientes
3. Digamos que decides que no tendrs errores en nin-
son fciles de predecir y responden a los intentos hechos,
guno de los problemas (como en un trabajo de mate-
la gente no necesariamente hace un esfuerzo intenso por
mticas u ortografa). Puedes lograrlo?
ejercer control sobre sus resultados. Esto es as porque
incluso las situaciones estructuradas pueden ser difciles En estos reactivos (escritos para estudiantes de pri-
de controlar, como ocurre con frecuencia en la educa- maria), el control percibido parece ser conceptualmente
cin, deportes, relaciones y en el trabajo. Cuando alguna similar a constructos relacionados, como la competen-
barrera como la dificultad de la tarea separa a la persona cia percibida, la autoeficacia y la capacidad percibida.
de los resultados buscados (p. ej., buenas calificaciones, Sin embargo, una primera diferencia es que el control
fama, matrimonio, ascensos), intervienen las diferencias percibido funciona como el apoyo antecedente sobre el
individuales en las percepciones de control, lo cual ex- cual se construyen estas otras creencias. Por ejemplo,
plica cundo y por qu la gente est dispuesta a hacer el el control percibido refuerza la competencia percibida y
esfuerzo necesario para controlar su destino. sta, a su vez, pronostica los resultados en el desempeo,
Las creencias de control percibido predicen cunto como la preferencia por el reto y la emocionalidad posi-
esfuerzo estar dispuesta a ejercer la persona (Skinner, tiva (Boggiano, Main y Katz, 1988). Por ende, el control
1985; Skinner et al., 1998). Cuando un individuo con un percibido es un precedente necesario para construir las
control percibido relativamente alto enfrenta una situa- creencias sobre la propia competencia, eficacia y capaci-
cin razonablemente estructurada, busca y selecciona dad. Una segunda diferencia es que las creencias de con-
tareas relativamente desafiantes, establece metas relativa- trol percibido pueden emanar de cualquier capacidad, no
mente elevadas y genera planes complejos acerca de cmo slo de la propia competencia, eficacia o habilidad. Por
tener xito y qu debe hacer si el progreso es lento. Con ejemplo, un atleta podra percibir un elevado control de-
esta previsin, una persona con control percibido alto bido a una capacidad para pedir ayuda del entrenador,
inicia la accin, ejerce el esfuerzo, enfoca su concentra- de sus compaeros de equipo o de los cielos. La creencia de
cin y persiste ante la dificultad. Durante el desempeo, que uno tiene un alto control sobre los resultados sig-
el individuo con control percibido alto mantiene en men- nifica que uno tiene el control sobre cualquier cosa que
te sus planes y estrategias, conserva estados emocionales determine los resultados: uno mismo, los compaeros de
positivos, vigila sus estrategias de solucin de problemas, equipo, la suerte o los cielos.
y genera y vigila la realimentacin para adaptarse o mejo-
rar las habilidades pertinentes. Tal atencin concentrada CICLOS AUTORREAFIRMANTES DE COMPROMISO ALTO Y BAJO
en la tarea conduce por lo general a un fuerte desempe- El compromiso con el esfuerzo de adquirir control so-
o y posibilita el control sobre los resultados deseables bre un resultado importante existe en un continuo que
e indeseables. En contraste, cuando una persona con un va desde el desinters hasta el compromiso alto (Skinner
control percibido relativamente bajo enfrenta la misma y Belmont, 1993; Wellborn, 1991). Cuando las personas
situacin, busca y selecciona tareas relativamente fciles, estn fuertemente comprometidas, ejercen un esfuerzo
establece metas menores y ms ambiguas, y genera planes intenso y persistente y expresan emocin positiva; cuan-
sencillos con pocas estrategias de respaldo. Si las cosas do la gente est desinteresada, se comporta en forma pa-
salen mal, es probable que la concentracin se diluya, la siva y expresa emocin negativa (Patrick et al., 1993). De
confianza desciende con rapidez y a menudo la atencin este modo, el compromiso captura la intensidad y calidad
se dirige a ensimismarse en las razones por las que la ta- emocional de la participacin de un individuo durante
rea es tan difcil. A medida que disminuye el esfuerzo y empresas un tanto difciles para controlar los resultados
el compromiso cognitivo y emocional descienden, se ins- que les importan (Connell y Wellborn, 1991; Skinner,
tauran el desaliento y la pasividad, y el desempeo sufre 1991).
Control 289

Las creencias de control percibido influyen en el los sucesos en sus vidas (Burger, 1992; Burger y Cooper,
compromiso, emocin, afrontamiento y bsqueda de re- 1979). Las personas con alto DC abordan las situaciones
tos del individuo (Boggiano et al., 1988; Skinner, 1995; preguntndose si podrn controlar lo que sucede. No es-
Skinner et al., 1998). Las personas con alto control perci- tn contentos con aceptar cualquier cosa que les brinde
bido muestran un nivel de esfuerzo relativamente alto, se la vida, sino que estn motivados para influir en ella y
concentran y prestan atencin, persisten ante el fracaso, en lo que sucede (Burger, 1992). Las personas con alto
mantienen el inters y curiosidad en la tarea, y conservan DC prefieren tomar sus propias decisiones, prepararse
el optimismo acerca de resultados positivos en el futu- con anticipacin para las situaciones, evitar depender de
ro. Las personas con bajo control percibido muestran un otros y asumir roles de liderazgo en entornos de grupo.
esfuerzo relativamente bajo, dudan de sus capacidades, Las personas con bajo DC tienden a evitar las responsa-
tienden a darse por vencidas ante el reto o el fracaso, se bilidades y se sienten cmodas con que otros tomen de-
desalientan con rapidez, estn propensas a la pasividad, cisiones por ellos (Burger, 1992; Burger y Cooper, 1979).
ansiedad e incluso el enojo, y parecen hacer apenas lo Prefieren aceptar la vida como es e improvisar.
necesario en su participacin (Skinner et al., 1998). Los La escala para evaluar el deseo de control es la escala
niveles de compromiso versus desinters son importantes DC (Burger, 1992; Burger y Cooper, 1979). Dos reacti-
porque pronostican los resultados que la gente obtiene. vos de la escala DC son, por ejemplo, los siguientes: 1)
A su vez, estos resultados obtenidos afectan las percep- Prefiero un trabajo sobre el que tenga mucho control de
ciones de control posteriores al desempeo en una tarea. lo que hago y cundo lo hago y 2) Me gusta conocer
En consecuencia, el esfuerzo comprometido produce los de qu se trata un trabajo antes de comenzarlo.
resultados positivos y percepciones posteriores de control Lo que hace que el deseo de control sea diferente del
elevado que produjeron en primer trmino el esfuerzo control percibido es que los individuos con alto deseo
comprometido. El desinters (es decir, hacer pasivamente de control quieren controlar sus destinos sin importar
apenas lo indispensable) produce los resultados negati- cunto control tengan actualmente y tampoco qu tan
vos y percepciones posteriores de bajo control que pro- estructurada o respondiente parezca ser la situacin. El
dujeron en primer lugar el esfuerzo desinteresado. Esto deseo de control se relaciona con (es decir, predice) una
se denomina ciclo de autoconfirmacin del compromiso variedad de experiencias y conductas que son fundamen-
alto versus el bajo. tales para las creencias de control personal, incluyendo el
Un grupo de investigadores puso a prueba la validez desamparo aprendido, depresin, ilusin de control, hip-
de estos ciclos de autoconfirmacin a lo largo de un pe- nosis, logro, aprovechamiento, aglomeracin percibida,
riodo de cuatro meses mediante la peticin a estudian- estrs y afrontamiento, estilo interpersonal con amigos,
tes de primaria de que respondieran cuestionarios breves hbitos de salud e incluso en la eleccin de un adulto ma-
(Schmitz y Skinner, 1993). Los investigadores evaluaron yor del sitio en el que morir: dentro de su propia casa
el control esperado de los nios, su grado de compromiso, o cuidado por otros en un hospital (Burger, 1984, 1992;
desempeo real, desempeo percibido y sus estimaciones Burger y Arkin, 1980; Burger y Cooper, 1979; Burger et
de control futuro. En cada tarea calificada, los investiga- al., 1983; Burger y Schnerring, 1982; Smith et al., 1984).
dores examinaron las siguientes relaciones: 1) efectos del Los vnculos comunes entre el deseo de control y estas
control esperado previo al desempeo en el compromiso manifestaciones personales de control personal son, pri-
subsiguiente, 2) efectos del compromiso sobre el desem- mero, el elevado deseo de establecer control y, segundo,
peo real y 3) efectos de los resultados del desempeo en de restaurar el control perdido.
las expectativas subsiguientes de control. Los resultados
dieron apoyo a la validez de estos tres efectos. Las creen- ESTABLECIMIENTO DEL CONTROL
cias de control percibido contribuyeron de manera posi- A menudo el control es un problema en nuestras con-
tiva al esfuerzo, lo cual mejor el desempeo, que a su versaciones y relaciones diarias con otras personas. Para
vez impuls ganancias adicionales en las percepciones establecer cierto grado de control sobre las conversa-
que desarrollaron los nios en cuanto a su control en ese ciones interpersonales (de qu se hablar, qu actitudes
dominio (Schmitz y Skinner, 1993). A lo largo de muchos tienen las personas en las conversaciones, qu planes se
meses y aos, este ciclo de autoconfirmacin explica cmo harn), los individuos con alto DC hablan con un volu-
y por qu algunas personas desarrollan fuertes creencias men alto, de manera explosiva y rpida, responden con
de control personal en tanto que otras personas no. rapidez a las preguntas y comentarios, e interrumpen a
sus compaeros y hablan en lugar de ellos (Dembroski,
MacDougall y Musante, 1984). Las personas con alto DC
Deseo de control tambin tienden a terminar las conversaciones cuando
El deseo de control (DC) refleja el grado en que los in- ellos lo quieren, en general despus de concluir con lo
dividuos estn motivados para establecer control sobre que queran decir o luego de haber persuadido con xito
290 CAPTULO 13 Caractersticas de personalidad

a la otra persona de que sus propios puntos de vista son en tareas difciles y son lentos para darse por vencidos y
correctos (es decir, despus de establecer control; Burger, seguir adelante, y hacen atribuciones autocomplacientes
1990, 1992). y que aumentan el control, como asumir el crdito del xi-
El deseo de control es generalmente adaptativo y pro- to y atribuir el fracaso a una causa inestable (Burger, 1985,
ductivo cuando las situaciones son controlables. Sin em- 1992). El deseo de control es en general un recurso posi-
bargo, con frecuencia las personas con alto DC desean y tivo en situaciones de logro. Pero la figura 13.7 tambin
esperan tener control sobre acontecimientos cuando, de describe el deseo de control en su aspecto contraprodu-
hecho, los resultados estn determinados por el azar. Por cente. Debido a que los individuos con alto DC tienen un
ejemplo, muchas oportunidades de juego, como las m- fuerte deseo de control, a veces intentan conseguir metas
quinas tragamonedas, los juegos de lotera y las ruletas, demasiado difciles, exhiben un efecto de reaccin hos-
estn determinadas por el azar (Burger y Cooper, 1979). til ante el fracaso, persisten demasiado tiempo en tareas
No obstante, los individuos con alto DC tienden a perci- irresolubles y desarrollan una ilusin de control. Lo que
bir que pueden controlar esos resultados a travs de un muestran estos datos es que el deseo de control conduce a
esfuerzo personal. El deseo de control se convierte en ilu- la gente a sobreestimar qu tan bueno ser su desempeo,
sin de control (Burger, 1986, 1992). a desgastar sus energas, a persistir demasiado tiempo en
Las situaciones de logro proporcionan un escenario una tarea difcil y a interpretar la realimentacin de xito
para los deseos de establecer control de las personas con y fracaso de modos que alimentan la ilusin de control.
alto DC (Burger, 1985). Estas personas tpicamente inter-
pretan una tarea difcil como un reto para su capacidad PRDIDA DEL CONTROL
de control. En consecuencia, cuando se enfrentan a una A veces las personas enfrentan situaciones en las que tie-
tarea difcil, los individuos con alto DC persistiran ms nen poco control. En situaciones como las aglomeracio-
tiempo que las personas con bajo DC. Ceder ante una ta- nes, la vida militar, las casas de reposo para ancianos, los
rea difcil es admitir que la tarea est ms all del control hospitales, prisiones y vivir junto a un tiradero hediondo
personal. Para someter a prueba esta idea, Jerry Burger o un aeropuerto ruidoso, es posible un control mnimo.
dio a estudiantes una serie de acertijos irresolubles y ob- Tales situaciones representan un obvio apuro para el indi-
serv cunto tiempo persistan los individuos con alto y viduo con alto DC. Cuando su control est bajo amenaza
bajo DC. Como se haba pronosticado, los estudiantes o lo han perdido por completo, las personas con alto DC
con alto DC persistieron ms tiempo en los acertijos que exhiben reacciones precisas, como angustia, ansiedad,
los individuos con bajo DC. depresin, dominancia y afrontamiento asertivo (Burger,
La figura 13.7 muestra un modelo de cuatro pasos 1992).
para ilustrar la naturaleza multidimensional de la bs- Visitar el consultorio del dentista es una de estas si-
queda de los individuos con alto DC por establecer con- tuaciones de bajo control (Law, Logan y Baron, 1994).
trol en situaciones de logro (Burger, 1985). Las personas Cuando las personas con alto DC visitan al dentista, la
con alto DC seleccionan tareas difciles porque en ge- idea de que otra persona utilice herramientas en sus dien-
neral tienen elevadas aspiraciones y normas, ejercen un tes provoca niveles inusualmente elevados de ansiedad,
esfuerzo inusualmente alto ante los desafos, persisten dolor anticipado y angustia. Es interesante sealar que

Atribuciones
Nivel de aspiracin Respuesta ante el reto Persistencia
del xito y fracaso
Alto DC comparado Selecciona tareas Reacciona con mayor Trabaja ms tiempo Ms probable que
con bajo DC ms difciles, establece esfuerzo en tareas difciles atribuya el xito a s
metas en forma ms mismo y el fracaso
realista a una fuente inestable
Beneficio del alto DC Se logran metas Termina las tareas Termina las tareas El nivel de motivacin
ms altas difciles difciles permanece alto
Desventaja del alto Quizs intente metas Quiz desarrolle Quizs invierta Quiz desarrolle ilusin
DC ms difciles reacciones que inhiben demasiado esfuerzo de control
el desempeo

Figura 13.7 Influencia del deseo de control durante el desempeo relacionado con logros.
Fuente: Tomado de J. M. Burger, Desire for Control and Achievement Related Behaviors, en Journal of Personality and Social Psychology, 48, 1985, pp. 1520-1533.
Copyright 1985 de American Psychological Association. Adaptado con autorizacin.
Resumen 291

una sesin de veinte minutos de inoculacin de estrs Cuando la gente desea tener control, pero el ambiente
realizada inmediatamente antes de la visita al dentista no lo permite, la persona se siente vulnerable al desam-
puede dar a los individuos con alto DC las estrategias y paro aprendido y a la depresin. Jerry Burger y Robert
respuestas de afrontamiento-control que ellos desean Arkin (1980) pidieron a individuos con alto y bajo DC
(Law et al., 1994). que participaran en un experimento tpico de desamparo
Las aglomeraciones son otras situaciones de bajo aprendido en el que se les expona a un ruido intenso,
control. La aglomeracin, definida por el nmero de incontrolable e impredecible (p. ej., vase captulo 9). En
personas por metro cuadrado, reduce el control debido comparacin con personas con bajo DC, los individuos
a que uno no puede moverse con libertad (Stokols, 1972). con alto DC informaron mayores niveles de depresin
Tener mucha gente alrededor, como en el trnsito denso, posterior a la tarea. Lo que es ms, la magnitud del des-
las aceras superpobladas y las largas filas en las cajas del amparo y de la depresin vari en proporcin con cun
supermercado, interfiere con la capacidad de cualquie- importante era el control para esa persona en esa situa-
ra para lograr alguna cosa. Los individuos con alto DC cin (Mikulincer, 1986). As que, en ambientes controla-
son ms vulnerables a las percepciones de aglomeracin bles, el deseo de control funciona como una ventaja mo-
y, por ende, intentan evitar esas situaciones angustiantes tivacional pero, en situaciones incontrolables, el deseo de
(Burger, 1992). control funciona como una desventaja motivacional.

Resumen
El captulo 1 identific varias preguntas en el estudio de comportamiento orientado a la aproximacin. Cuando los
la motivacin que se pueden responder mejor a travs del neurticos tienen contacto con una situacin, su SIC les
estudio de la personalidad y de las diferencias individua- predispone a ser particularmente sensibles a los aspectos
les. Estas preguntas fueron las siguientes: Para cules de castigo potencial y experimentan emociones negativas
motivos existen diferencias individuales? Cmo surgen es- y muestran comportamientos orientados a la evitacin.
tas diferencias individuales entre las personas? y Cules La bsqueda de sensaciones y la intensidad del afecto
son las implicaciones de tales diferencias individuales en representan dos caractersticas de la personalidad que se
cuanto a la motivacin? Este captulo identific dos carac- relacionan con la activacin y con la curva de U invertida
tersticas de personalidad relacionadas con la felicidad y de excitacin, desempeo y emocin/estado de nimo.
el bienestar, dos caractersticas de personalidad relacio- La bsqueda de sensaciones es la necesidad de obtener
nadas con la excitacin y dos relacionadas con el control. sensaciones variadas, novedosas, complejas e intensas y
Al hacerlo, explic cmo surgen estas diferencias de per- la disposicin a asumir riesgos fsicos, sociales, legales y
sonalidad y qu implicaciones tienen para la motivacin, econmicos en beneficio de tales experiencias. Para ob-
emocin y la vida diaria. tener tales sensaciones, estas personas buscan experien-
Dos caractersticas de personalidad relacionadas con cias nuevas, como en el sexo y las drogas, y participan en
la felicidad son la extraversin y el neuroticismo. La carac- comportamientos de riesgo, como los juegos de azar. La
terstica que explica quin es feliz?, es la extraversin. Los intensidad del afecto representa la fortaleza con la que los
extravertidos son ms felices que los introvertidos. Son individuos experimentan de manera tpica sus emociones.
felices porque tienen un sistema de excitacin conductual Los individuos con afecto intenso experimentan con ma-
(SAC) ms fuerte que les hace responder con mayor inten- yor fuerza sus emociones y presentan una hiperactividad
sidad a las seales de recompensa en el ambiente. La ca- emocional en situaciones que provocan emocin. Los indi-
racterstica de personalidad que explica quin es infeliz?, viduos con afecto estable experimentan sus emociones de
es el neuroticismo. Los neurticos sufren en un sentido manera apenas leve y muestran slo fluctuaciones meno-
emocional. Esto ocurre as porque tienen un sistema de res en sus reacciones emocionales.
inhibicin conductual (SIC) ms fuerte que les hace res- El control percibido y el deseo de control representan
ponder con ms intensidad a las seales de castigo en el dos caractersticas de personalidad relacionadas con el
ambiente. control. El control percibido tiene que ver con la capaci-
La extraversin predispone al individuo a la emocio- dad para iniciar y regular la conducta necesaria para ob-
nalidad positiva, al sistema de excitacin conductual y a tener los resultados deseables y prevenir los indeseables.
un temperamento de aproximacin. El neuroticismo pre- Cuando el control percibido es fuerte, la gente se compro-
dispone al individuo a la emocionalidad negativa, al sis- mete en las tareas con un afrontamiento activo y emocin
tema de inhibicin conductual y a un temperamento de positiva, y este compromiso con la tarea aumenta la pro-
evitacin. Cuando los extravertidos tienen contacto inicial babilidad de que logren los resultados que buscan. Pero
con una situacin, su SAC les predispone a ser particular- cuando el control percibido es dbil, la gente se involucra
mente sensibles a sus aspectos de recompensa potencial en tareas de manera indolente, ya que muestran pasivi-
y, por ende, experimentan emociones positivas y muestran dad y emocin negativa. Este desinters, a su vez, dismi-
292 CAPTULO 13 Caractersticas de personalidad

nuye la probabilidad de que obtengan los resultados que taurarlo cuando lo han perdido o se ha visto amenazado.
buscan. As, al afectar el compromiso, las creencias de Para establecer el control, los individuos con alto DC tie-
control percibido inician un ciclo de autoconfirmacin en nen elevadas normas y aspiraciones, hacen ms esfuer-
el que las personas con elevado control percibido inician zo ante los retos, tienen mayor persistencia ante tareas
el esfuerzo que produce los resultados positivos que, a difciles e interpretan la realimentacin del xito/fracaso
su vez, aumentan las percepciones posteriores de control de modos autocomplacientes y que aumentan el control.
elevado. El deseo de control refleja el grado en que los in- Cuando el control se ve amenazado o se pierde, como al
dividuos estn motivados a controlar los acontecimientos visitar al dentista, entrar en una habitacin aglomerada
dentro de sus vidas. Los individuos con alto DC abordan o participar en un experimento de desamparo aprendi-
las situaciones queriendo controlar lo que les sucede, de do, los individuos con alto DC tienen reacciones precisas
modo que se esfuerzan por establecer el control y res- como angustia y depresin.

LECTURAS ADICIONALES

Personalidad y felicidad Personalidad y excitacin


Brickman, P., Coates, D., y Janoff-Bulman, R. (1978). Lottery Anderson, K. J. (1990). Arousal and the inverted-U hypo-
winners and accident victims: Is happiness relative? thesis: A critique of Neisss reconceptualizing arousal.
Journal of Personality and Social Psychology, 35, 917-927. Psychological Bulletin, 107, 96-100.
Costa, P. T., y McCrae, R. R. (1980). Influence of extraver- Larsen, R. J., y Diener, E. (1987). Affect intensity as an individual
sion and neuroticism on subjective well-being: Happy difference characteristic: A review. Journal of Research in
and unhappy people. Journal of Personality and Social Personality, 21, 1-39.
Psychology, 38, 668-678. Zuckerman, M., Bone, R. N., Neary, R., Mangelsdorff, D.,
Deneve, K. M. (1999). Happy as an extraverted clam?: The y Brustman, B. (1972). What is the sensation see-
role of personality for subjective well-being. Current ker?: Personality trait and experience correlates of the
Directions in Psychological Science, 8, 141-144. Sensation Seeking Scale. Journal of clinical and Counseling
Dupue, R.A., y Collins, P. F. (1999). Neurobiology of the struc- Psychology, 39, 308-321.
ture of personality: Dopamine facilitation of incenti-
ve motivation and extraversion. Behavioral and Brain
Personalidad y control
Sciences, 22, 491-569. Burger, J. M. (1985). Desire for control and achievement-related
Elliot, A. J., y Thrash, T. M. (2002). Approach-avoidance mo- behaviors. Journal of Personality and Social Psychology,
tivation in personality: Approach and avoidance tem- 53, 1520-1533.
perament and goals. Journal of Personality and Social Schmitz, B., y Skinner, E. A. (1993). Perceived control, effort,
Psychology, 82, 804-818. and academic performance: Interindividual, intraindi-
vidual, and multivariate time-series analyses. Journal of
Personality and Social Psychology, 64, 1010-1028.
5. El proceso de emocin
,QWURGXFFLyQ
7RGRVORVVHUHVYLYRVSRVHHQHQVXGRWDFLyQJHQpWLFDORQHFHVDULRSDUDPRVWUDU
LQGLFLRVPiVRPHQRVGHVDUUROODGRVPiVRPHQRVSULPLWLYRVGHXQSURFHVRDIHF-
tivo esencial: el de aproximarse a lo grato y evitar lo desagradable./DHPRFLyQ
es un proceso adaptativo que forma parte de los procesos afectivos. Es decir, si
bien toda emocin puede ser considerada como una forma de proceso afectivo, no
WRGRVORVSURFHVRVDIHFWLYRVVRQSURFHVRVHPRFLRQDOHV)LORJHQpWLFDPHQWHKDEODQ-
do, la emocin es un proceso anterior a la consciencia, ya que esta es un producto
GHODSURSLDHYROXFLyQTXHDSDUHFHFXDQGRHOFHUHEURDGTXLHUHODVXFLHQWHFDSD-
cidad de desarrollo.

/RVSURFHVRVHPRFLRQDOHVFRPRSDUWHGHORVSURFHVRVDIHFWLYRVSXHGHTXHQRVH
HQFXHQWUHQSUHVHQWHVHQWRGDVODVIRUPDVGHYLGDSHURHVVHJXURTXHVtTXHHVWiQ
SUHVHQWHVHQGLYHUVDVHVSHFLHV/DVHPRFLRQHVQRVRQSDWULPRQLRH[FOXVLYRGHOD
especie humana. Sin embargo, hay un aspecto que puede ser especialmente rele-
YDQWH\HVHOTXHVHUHHUHDODHVSHFLDOFRQH[LyQH[LVWHQWHHQWUHODVHPRFLRQHV\
las ideas complejas, los valores, los juicios, etc., que, al menos en principio, parece
que solo poseemos los humanos.

&RQVLJXLHQWHPHQWHFUHHPRVTXHODHPRFLyQUHSUHVHQWDXQDIRUPDPiVGHDGDSWD-
cin al medio ambiente, ejecutada por aquellas especies que poseen en su bagaje
gentico la infraestructura apropiada para que los individuos de la misma lleguen
DGHVDUUROODU\PDQLIHVWDUORVSURFHVRVHPRFLRQDOHV/DHPRFLyQHVXQDUHVSXHVWD
elicitada por un estmulo o situacin temporalmente prximos y conocidos. Puede
tener connotaciones positivas o negativas, pero siempre se encuentra vinculada a
ODDGDSWDFLyQDQWHVLWXDFLRQHVTXHVXSRQHQXQDLPSRUWDQWHDPHQD]DSDUDHOHTXL-
librio del organismo. Dicha respuesta tiene caractersticas explosivas, de alta in-
WHQVLGDG \ GH PX\ EUHYH GXUDFLyQ$GHPiV HVD UHVSXHVWD VH PDQLHVWD LQWHUQD
y/o externamente, hecho que denota la necesidad de ajustar el organismo a las
H[LJHQFLDVGHOHVWtPXORRVLWXDFLyQTXHSURYRFyODHPRFLyQPHFDQLVPRVVLR-
lgicos autonmicos y corticales de preparacin, y la conveniencia de trasmitir
informacin al exterior acerca de la situacin en la que se encuentra el organismo
mecanismos expresivos y motores de comunicacin.

As pues, se puede proponer que todas las emociones desempean un importante


papel regulador orientado a la adaptacin del organismo, siendo el objetivo ltimo
ayudar para mantener la vida de dicho organismo. Si se mantienen en el bagaje
gentico de tantas especies es porque algn papel adaptativo tienen que cumplir,
ya que, de no ser as, habran ido desapareciendo a lo largo de la evolucin.

(QODVHVSHFLHVPHQRVGHVDUUROODGDVGHODHVFDODORJHQpWLFDHVHSURFHVRDIHFWLYREiVLFRTXHVHGHVSOD]DDORODUJRGH
XQFRQWLQXRTXHYDGHVGHORPiVJUDWLFDQWHKDVWDORPHQRVJUDWLFDQWHWLHQHFRQQRWDFLRQHVGHVXSHUYLYHQFLDHYLWDUDORV
depredadores y conseguir la reproduccin.
(QWUHODVHPRFLRQHVQHJDWLYDVKD\TXHVHxDODUODLUDODWULVWH]DHODVFR\HOPLHGR(QWUHODVHPRFLRQHVSRVLWLYDVOD
DOHJUtD\ODHVSHUDQ]D

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 130 Manual de teoras emocionales y motivacionales - UJI
,QGHSHQGLHQWHPHQWHGHODVGLIHUHQWHVLQXHQFLDVVRFLDOHV\FXOWXUDOHVTXHHMHUFHQ
sus efectos sobre el desencadenamiento y la expresin, las emociones son pro-
cesos biolgicamente determinados, dependiendo de la activacin de estructuras
QHXUDOHVHVSHFtFDVTXHVHGLVWULEX\HQGHVGH]RQDVVXEFRUWLFDOHVFRQFUHWDPHQWH
GHVGHHOWURQFRHQFpIDORKDVWDODFRUWH]DFHUHEUDOSDVDQGRSRUODVLPSRUWDQWHVHV-
tructuras del diencfalo y el sistema lmbico.

$XQTXHODVHPRFLRQHVPDQLHVWDQVXVHIHFWRVPiVYLVLEOHVHQHOSODQRGHODVJOiQ-
dulas, vsceras y msculos, tambin repercuten de forma importante en los distin-
tos procesos cognitivos en curso e inmediatamente siguientes a la ocurrencia de
una emocin. Esta ltima caracterstica ha llevado a que, en ocasiones, se proponga
que la emocin es disfuncional, que repercute de forma negativa en el rendimiento
y en la capacidad de adaptacin de un organismo. Esta apreciacin tiene que ser
PDWL]DGD(VFLHUWRHQSULPHUOXJDUTXHODHPRFLyQSXHGHVHUFRQVLGHUDGDFRPR
una suerte de resorte que perturba, y que incluso puede llegar a detener todos los
procesos que estaban en curso en el momento de su ocurrencia; es cierto tambin,
HQVHJXQGROXJDUTXHODHPRFLyQWLHQHFDSDFLGDGSDUDGHVRUJDQL]DUODMHUDUTXtDGH
las eventuales respuestas y manifestaciones que el individuo tena programadas para
VHUHMHFXWDGDV6LQHPEDUJRQRHVPHQRVFLHUWRTXHGLFKDGHVRUJDQL]DFLyQRFXUUHD
H[SHQVDVGHXQDQXHYDRUJDQL]DFLyQMHUiUTXLFDTXL]iPiVUXGLPHQWDULD\HVWHUHRWL-
SDGDSHURRUJDQL]DFLyQDOQ(VWDQXHYDRUJDQL]DFLyQMHUiUTXLFDGHODVHYHQWXDOHV
respuestas que pueden producirse posee connotaciones claramente funcionales, ya
que el organismo activa aquellos resortes y mecanismos que considera apropiados a
cada situacin. Consiguientemente, no hay duda de que al hablar de la emocin nos
UHIHULPRVDXQSURFHVRDGDSWDWLYREiVLFR\QHFHVDULRSDUDODVXSHUYLYHQFLD

%LRORJtDGHODVHPRFLRQHV
(QORV~OWLPRVGLH]DxRVKHPRVDVLVWLGRDXQIHQyPHQRSUROLIHUDWLYRHQODE~VTXHGD
GHODVEDVHVQHXURELROyJLFDVGHORVSURFHVRVHPRFLRQDOHV(VWiEDVWDQWHFRQVROL-
dada la idea de que las estructuras subcorticales son imprescindibles para entender
todas las dimensiones de la conducta emocional. Es decir, si, en primer lugar, las
HPRFLRQHVVRQSURFHVRVDGDSWDWLYRVEiVLFRVTXHVHHQFXHQWUDQSUHVHQWHVHQHOVHU
humano antes de que este desarrolle por completo la estructura y funcionalidad del
sistema nervioso central; si, en segundo lugar, las emociones son mecanismos adap-
tativos que se encuentran presentes en muchas de las especies inferiores, porque en
VXEDJDMHJHQpWLFRVHHQFXHQWUDODGRWDFLyQDSURSLDGDSDUDTXHDSDUH]FDQ\VHGHVD-
rrollen; parece sensato, en tercer lugar, proponer que la infraestructura biolgica o,
GHQXHYRQHXURELROyJLFDVHHQFXHQWUDXELFDGDHQ]RQDVGHOVLVWHPDQHUYLRVRFHQ-
tral que son relativamente antiguas, y ese es el caso de las estructuras subcorticales.

Este argumento, que es correcto, no es completo, y, de hecho, llev a una serie de gran-
des errores,GHORVTXHSRUIRUWXQDODSVLFRORJtDGHODHPRFLyQVHHVWiOLEHUDQGRHQ

8QRGHORVJUDQGHVHUURUHVKDVLGRFRQVLGHUDUODFRJQLFLyQ\ODHPRFLyQPiVDSURSLDGDPHQWHHODIHFWR
FRPRGLPHQVLRQHVLQGHSHQGLHQWHV'HULYDGRGHHVHHUURUVHSHUOy\PDQWXYRGXUDQWHPXFKRWLHPSRRWUR
JUDQHTXtYRFRTXHODFRJQLFLyQVXSHULRUSRUGHQLFLyQimpona toda suerte de decisiones sobre la emocin.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 131 Manual de teoras emocionales y motivacionales - UJI
los ltimos tiempos. Sin embargo, en honor a la verdad, se tiene que explicar que este
DUJXPHQWRHUDDVXYH]ODFRQVHFXHQFLDGHODYLVLyQTXHVHWHQtDDFHUFDGHODUHODFLyQ
entre sistemas cognitivos y sistemas afectivos: por una parte, los desrdenes cogniti-
vos eran el resultado de las lesiones corticales, mientras que los desrdenes afectivos
eran el resultado de las lesiones subcorticales; por otra parte, se apreciaba un notable
incremento en las conductas emocionales cuando se produca la desconexin entre
estructuras corticales y estructuras subcorticales, esto es, cuando se impeda la ac-
FLyQLQKLELGRUDGHODFRUWH]DVREUHODVFRQGXFWDVFRQWURODGDVSRUODVHVWUXFWXUDVVXE-
corticales. Se poda defender que las funciones cognitivas y las funciones afectivas
GHSHQGtDQGH]RQDVGLIHUHQWHVSHUPLWLHQGRTXHODV]RQDVFRUWLFDOHVODVVXSHULRUHV
FRQWURODVHQDODV]RQDVVXEFRUWLFDOHVODVLQIHULRUHV

En cualquiera de los casos, admitiendo la relevancia de las estructuras subcor-


WLFDOHVHQHOiPELWRGHODHPRFLyQODDFWXDOLGDGHVWiHYLGHQFLDQGRTXHPXFKRV
trabajos recientes se orientan tambin hacia el papel que juegan otras estructuras
QHXURELROyJLFDVGHPiVUHFLHQWHDSDULFLyQHQHOGHVDUUROORORJHQpWLFRODVHVWUXF-
turas neocorticales. En cierta medida, el inters por el estudio de estas estructuras
PiVUHFLHQWHVSURFHGHGHOiPELWRFOtQLFR\DTXHVHDSUHFLDFyPRODVOHVLRQHVHQ
los lbulos frontales se encuentran claramente asociadas con notables cambios en la
conducta emocional.

$GHPiVFRPRFRQVWDWDFLyQGHODFRPSOHMLGDGTXHLPSOLFDHOHVWXGLRGHODQHX-
URELRORJtDHPRFLRQDORWURDVSHFWRDFRQVLGHUDUVHUHHUHDODHYHQWXDOSDUWLFLSD-
cin de las distintas estructuras neurobiolgicas en cada uno de los dos planos a
WUDYpVGHORVFXDOHVVHKDHVWXGLDGRODHPRFLyQDVDEHU HOTXHWLHQHTXHYHU
con el conocimiento de la emocin reconocimiento, denominacin, evaluacin
\YDORUDFLyQ HOTXHWLHQHTXHYHUFRQODH[SUHVLyQPHGLDQWHHOOHQJXDMHORV
gestos, los cambios faciales, y cualquier otro movimiento con connotaciones de
FRPXQLFDFLyQVRFLDO$PERVSODQRVSRGUtDQVHUGHQLGRVFRPRSURFHVDPLHQWR
de la estimulacin emocional y preparacin de la respuesta emocional.

3URFHVDPLHQWRGHODHVWLPXODFLyQHPRFLRQDO
/DVHVWUXFWXUDVFHUHEUDOHVTXHPD\RUDWHQFLyQHVWiQUHFLELHQGRHQODDFWXDOLGDGHQ
HOiPELWRGHOUHFRQRFLPLHQWRHYDOXDFLyQ\YDORUDFLyQGHODHPRFLyQKDQVLGROD
amgdala y los hemisferios cerebrales.

En cuanto a la amgdala, su especial ubicacin, as como la importante conectivi-


GDGFRQRWUDVHVWUXFWXUDVFHUHEUDOHVODFRQYLHUWHQHQXQD]RQDGHHVSHFLDOUHOHYDQ-
FLDHPRFLRQDO/DDPtJGDODUHFLEHLQIRUPDFLyQVHQVRULDOGHWRGDVODVPRGDOLGDGHV
\HVWiHQFRQWDFWRFRQHOKLSRFDPSRHOSURVHQFpIDOREDVDO\ORVJDQJOLRVEDVDOHV
que son estructuras importantes en los procesos de memoria y de atencin, as
FRPRFRQHOKLSRWiODPRTXHHVIXQGDPHQWDOSDUDHOFRQWUROGHODKRPHRVWDVLV\
ODUHJXODFLyQQHXURHQGRFULQD7UDVODOHVLyQELODWHUDOGHODDPtJGDODVHKDSRGLGR
DSUHFLDUODH[LVWHQFLDGHDJQRVLDSDUDODVLJQLFDFLyQHPRFLRQDO\VRFLDOGHORVHV-
tmulos, cuando los sujetos experimentales son animales inferiores. Sin embargo,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 132 Manual de teoras emocionales y motivacionales - UJI
cuando se estudian casos de lesiones bilaterales de la amgdala en seres humanos,
los resultados son bastante heterogneos. No obstante, en trminos generales, pre-
domina la visin participativa activa de dicha estructura en la emocin. Incluso,
no se descarta la posibilidad de que la amgdala se encuentre implicada en una
IXQFLyQ GH SURFHVDPLHQWR HPRFLRQDO PiV DPSOLD \ JHQHUDO FRQ FRQQRWDFLRQHV
sociales.

En cuanto a los hemisferios cerebralesVRQ\DFOiVLFDVODVVXJHUHQFLDVUHIHULGDVD


ODLPSOLFDFLyQGHOKHPLVIHULRL]TXLHUGRHQDTXHOORVDVSHFWRVHPRFLRQDOHVTXHVH
transmiten a travs del lenguaje, o que implican la descripcin verbal de una emo-
FLyQPLHQWUDVTXHHOKHPLVIHULRGHUHFKRHVWDUtDPiVUHODFLRQDGRFRQORVDVSHFWRV
emocionales que se transmiten mediante caractersticas expresivas y gestuales.

0iVUHFLHQWHPHQWHVHKDVXJHULGRODHVSHFLDOUHOHYDQFLDGHOKHPLVIHULRGHUHFKR
para el procesamiento de la informacin con connotaciones emocionales, tanto en
HOFDVRGHVHUHVKXPDQRVFRPRHQHOFDVRGHDQLPDOHVGHHVSHFLHVLQIHULRUHV/D
implicacin del hemisferio derecho en el procesamiento emocional parece clara.
Sin embargo, el porqu de este tipo diferencial de funcionamiento sigue suscitando
GXGDV\FRQWURYHUVLDV'HKHFKRDVXPLHQGRXQRGHORVSULQFLSLRVPiVDFHSWDGRV
HQODDFWXDOLGDGHOTXHVHEDVDHQODGHWHUPLQDFLyQMHUiUTXLFDELROyJLFDVHSRGUtD
VXJHULUTXHODVIRUPDVPiVSULPLWLYDVGHHPRFLyQTXHSRUUHJODJHQHUDOWLHQHQ
valencia negativa, se encuentran especialmente vinculadas al funcionamiento del
KHPLVIHULRGHUHFKRPLHQWUDVTXHDTXHOODVRWUDVHPRFLRQHVORJHQpWLFDPHQWHPiV
DYDQ]DGDV\FRQFRQQRWDFLRQHVVRFLDOHVVHHQFXHQWUDQHVSHFLDOPHQWHYLQFXODGDV
DOIXQFLRQDPLHQWRGHOKHPLVIHULRL]TXLHUGR

$QXHVWURPRGRGHYHUTXLHQPHMRUKDSHUODGRODUHOHYDQFLDGHOKHPLVIHULRGHUH-
FKRHQHOSURFHVDPLHQWRGHODLQIRUPDFLyQHPRFLRQDOKDVLGR'DPDVLR 'DPDVLR
$GROSKV\'DPDVLR &RQXQDUJXPHQWRDOTXHGHQRPL-
na hiptesis del marcador somtico'DPDVLRGHHQGHTXHHOSURFHVDPLHQWRGHOD
HPRFLyQGHSHQGHGHOSURFHVDPLHQWRGHODLQIRUPDFLyQVRPiWLFD(QHVWHPDUFRGH
UHIHUHQFLDHOKHPLVIHULRGHUHFKRSDUHFHHVWDUHVSHFLDOL]DGRHQODUHSUHVHQWDFLyQ
GHOFXHUSR\DTXHODVOHVLRQHVHVSHFtFDVGHGLFKRKHPLVIHULRSURGXFHQXQDPD-
yor prdida de control sobre el estado general del cuerpo, que cuando las lesiones
VHHQFXHQWUDQFLUFXQVFULWDVDOKHPLVIHULRL]TXLHUGR(VSUREDEOHVHxDOD'DPDVLR
que las funciones referidas a la emocin y a la representacin del cuerpo, que
IRUPDQSDUWHGHODPLVPDIXQFLyQKRPHRVWiWLFDRUJDQtVPLFDVHHQFXHQWUHQODWHUD-
OL]DGDVHQHOKHPLVIHULRGHUHFKR

3UHSDUDFLyQGHODUHVSXHVWDHPRFLRQDO
7DPELpQHQHOSODQRGHODH[SUHVLyQHPRFLRQDOHQSDUWLFXODU\GHODPDQLIHVWD-
cin emocional en general, las estructuras neurobiolgicas que mayor atencin
HVWiQUHFLELHQGRSRUSDUWHGHORVLQYHVWLJDGRUHVVRQODDPtJGDOD\ORVKHPLVIHULRV
cerebrales.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 133 Manual de teoras emocionales y motivacionales - UJI
En cuanto a la amgdala, hay que sealar que, en la ltima dcada, y merced al es-
IXHU]RSURGXFWLYRGHDXWRUHVFRPR/H'RX[ DE HVWDHVWUXFWXUD
VHHVWiUHYHODQGRFRPRXQD]RQDIXQGDPHQWDOSDUDHQWHQGHUHOVXVWUDWRQHXURELR-
lgico de las emociones, al menos de la emocin de miedo. Por lo que respecta a la
preparacin de la respuesta emocional, se propone la existencia de dos sistemas neu-
URELROyJLFRV3RUXQDSDUWHHOVLVWHPDFOiVLFRPiVODUJRTXHLQFOX\HHOWiODPROD
FRUWH]DDVRFLDWLYDHVSHFtFDDOWLSRGHHVWtPXORLPSOLFDGR\ODVGLVWLQWDVHVWUXFWXUDV
subcorticales que participaran en la respuesta del organismo, incluyendo en la mis-
ma las manifestaciones emocionales tambin. En este caso, el estmulo, a travs de
ODVYtDVDIHUHQWHVDOFDQ]DODIRUPDFLyQUHWLFXODUOOHJDQGRKDVWDHOWiODPRGHVGHHVWD
HVWUXFWXUDGLHQFHIiOLFD\GHIRUPDHVSHFtFDODHVWLPXODFLyQVHGLULJHKDFLDOD]RQD
FRUWLFDOHVSHFLDOL]DGDHQHODQiOLVLV\VLJQLFDFLyQGHOPLVPR7UDVHVWHSURFHVRHQ
el que tiene lugar la evaluacin y la valoracin del estmulo o situacin, se prepara
la respuesta apropiada para superar la exigencia concreta. El otro sistema propuesto
SRUHVWRVDXWRUHVHVPiVFRUWR\GLUHFWR\DTXHHOHVWtPXORXQDYH]TXHDOFDQ]DHO
WiODPRDGHPiVGHVHJXLUODUXWDUHFLpQFRPHQWDGDVLJXHXQDSUR\HFFLyQPiVFRUWD
hasta la amgdala, la cual tiene capacidad para preparar una respuesta organsmica
LQPHGLDWDDQWHODHYHQWXDODPHQD]DTXHSXHGDVXSRQHUHOHVWtPXORHQFXHVWLyQ(Q
esta segunda posibilidad, solo se encuentran implicadas ciertas estructuras subcor-
WLFDOHVGHODVTXHODPiVLPSRUWDQWHHVODDPtJGDOD'HKHFKRVHJ~Q/H'RX[ODV
HPRFLRQHVVRQHOSURGXFWRGHODDFWLYLGDGGHHVWHVLVWHPD(OFDPLQRPiVFRUWRGH
los dos es el segundo, por lo tanto es esta va la que permite la respuesta casi inme-
diata ante las seales de peligro. Pero, inmediatamente despus llega tambin hasta
OD DPtJGDOD HO UHVXOWDGR GHO DQiOLVLV PiV SRUPHQRUL]DGR GH HVH HVWtPXOR TXH KD
WHQLGROXJDUHQODFRUWH]DDVRFLDWLYDHVSHFtFDFRQUPDQGRVLODLQLFLDOUHVSXHVWD
preparada por la amgdala ha sido correcta o no. Si la respuesta inicial fue correcta,
DKRUDVHUHQDHQVXPDQLIHVWDFLyQDMXVWiQGRVHDODVLJQLFDFLyQHVSHFtFDGHOHV-
tmulo y del dao asociado al mismo. Si, por el contrario, la respuesta inicial no fue
DSURSLDGDWUDWiQGRVHGHXQDfalsa alarmaDXWRPiWLFDPHQWHFHVDODUHVSXHVWD\ORV
PHFDQLVPRVDXWRQyPLFRVDFWLYDGRVSDUDSURWHJHUHOHTXLOLEULRGHORUJDQLVPR+D\
TXHWHQHUHQFXHQWDTXHODPD\RUUDSLGH]HQODUHVSXHVWDGHODDPtJGDODDSDUWLUGHOD
LQIRUPDFLyQGLUHFWDTXHOHOOHJDGHVGHHOWiODPRVHSURGXFHDH[SHQVDVGHODFDOLGDG
HQHODQiOLVLVGHGLFKDHVWLPXODFLyQ(VGHFLUODHVWLPXODFLyQOOHJDGDGLUHFWDPHQWH
GHVGHHOWiODPRHVWiPX\SRFRHODERUDGDFRQORFXDOODUHVSXHVWDGHODDPtJGDOD
WDPELpQHVEDVWDQWHLQHVSHFtFD&RPRPXFKRSRGUtDPRVSODQWHDUODSRVLELOLGDG
de que se trate de una respuesta elemental de preparacin, de defensa en general. En
QXHVWUDRSLQLyQHOYDORUDGDSWDWLYRTXHSRVHHODDSRUWDFLyQGH/H'RX[HVLQQHJDEOH
$XQTXHODUHVSXHVWDUiSLGDprecipitada, que produce la amgdala no sea correcta,
HVWRHVDXQTXHODVPiVGHODVYHFHVVHWUDWHVRORGHXQDIDOVDDODUPDHVSUHIHULEOH
ese tipo de error al que supondra no reaccionar a tiempo y sufrir las consecuencias
GHXQDVLWXDFLyQSHOLJURVD2ORTXHHVORPLVPRHQWpUPLQRVHYROXFLRQLVWDVHVPiV
adaptativa la existencia de muchas situaciones catalogadas como falso positivo que
de una sola catalogada como falso negativo, ya que esa sola situacin puede llegar
a ser tambin la ltima.

(QFXDOTXLHUDGHORVFDVRVPiVDOOiGHODVGXGDVTXHSXHGDVXVFLWDUODSDUWLFL-
pacin real de la amgdala en los procesos emocionales, la mayor parte de los

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 134 Manual de teoras emocionales y motivacionales - UJI
resultados existentes en la actualidad apuntan hacia su implicacin, tanto en el
procesamiento de la informacin entrante, como en la preparacin de la respuesta
emocional.

En cuanto a los hemisferios cerebrales, en los ltimos aos ha habido revisiones


importantes que, a grandes rasgos, tambin encuentran una relativa implicacin
diferencial de los hemisferios en la expresin emocional. En este orden de cosas,
HQXQWUDEDMRSUHYLR 3DOPHUR KDFtDPRVUHIHUHQFLDDFLHUWRVDVSHFWRVGH
inters, resaltando que la expresin emocional adquiere matices diferenciales en
DPEDVSDUWHVGHODFDUD/DSDUWHGHUHFKDGHODPLVPDHVOD]RQDS~EOLFDSXHV
UHHMDODVHPRFLRQHVTXHHOVXMHWRTXLHUHTXHORVGHPiVSHUFLEDQPLHQWUDVTXH
ODSDUWHL]TXLHUGDGHODFDUDHVOD]RQDPiVSULYDGDHQODH[SUHVLyQHPRFLRQDO
6RQ DUPDFLRQHV EDVWDQWH DFHSWDGDV HQ OD DFWXDOLGDG \D TXH HQ HO VHQWLGR GH
ODVDSRUWDFLRQHVGH(NPDQ  VHKDSRGLGRHVWDEOHFHUTXHFXDQGRXQVXMHWR
PDQLHVWDYROXQWDULD\QJLGDPHQWHXQDHPRFLyQODH[SUHVLyQGHODPLVPDHV
DVLPpWULFDREVHUYiQGRVHTXHKDELWXDOPHQWHODSDUWHGHUHFKDGHODFDUDH[SUHVD
con mayor intensidad la emocin en cuestin, mientras que, cuando un individuo
PDQLHVWDHVSRQWiQHDPHQWHXQDHPRFLyQODH[SUHVLyQGHODPLVPDHVEDVWDQWHVL-
mtrica en ambas partes de la cara. Ahora bien, incluso en los casos de expresin
de emociones verdaderas, es decir, en los casos de simetra expresiva entre ambas
SDUWHV GH OD FDUD KD\ TXH WHQHU SUHFDXFLyQ FRQ OD H[FHVLYD JHQHUDOL]DFLyQ (Q
HIHFWR 6DFNKHLP \ *XU   UHDOL]DURQ XQ HVWXGLR HQ HO TXH FRJtDQ IRWRJUD-
ItDVGHFDUDVTXHH[SUHVDEDQGLVWLQWDVHPRFLRQHVHVSRQWiQHDVSRVWHULRUPHQWHODV
FRUWDEDQYHUWLFDOPHQWHSRUHOFHQWURIRUPDQGRQXHYDVLPiJHQHVFRPSOHWDVFRQ
FDGDSDUWH L]TXLHUGDRGHUHFKD \VXFRUUHVSRQGLHQWHLPDJHQHVSHFXODU(VGHFLU
formaban caras completas con la parte derecha y su imagen en espejo, y con la parte
L]TXLHUGD\VXLPDJHQHQHVSHMR3XGLHURQFRQVWDWDUTXHODVFDUDVIRUPDGDVDSDUWLU
GHODVPLWDGHVL]TXLHUGDVGHODVUHVSHFWLYDVIRWRJUDItDVRULJLQDOHVH[SUHVDEDQPiV
LQWHQVDPHQWHODHPRFLyQLQFOXVRFRPRLQGLFD*DLQRWWL  HVWDGLIHUHQFLDH[-
SUHVLYDHQWUHODVGRVSDUWHVGHODFDUDHUDPiVDFXVDGDGHQXHYRDIDYRUGHODSDUWH
L]TXLHUGDFXDQGRODH[SUHVLyQVHUHIHUtDDODVHPRFLRQHVQHJDWLYDV6LVDEHPRV
TXHODH[SUHVLyQGHODSDUWHL]TXLHUGDGHODFDUDHVWiFRQWURODGDSRUHOKHPLVIHULR
GHUHFKR\ODSDUWHGHUHFKDSRUHOKHPLVIHULRL]TXLHUGRSRGHPRVFRQFOXLUTXHLQ-
FOXVRHQDTXHOORVFDVRVGHHPRFLRQHVHVSRQWiQHDV\UHDOHVHOKHPLVIHULRGHUHFKR
HVWiPiVLPSOLFDGRHQODH[SUHVLyQHPRFLRQDO

/RVSURSLRVDXWRUHVVLQHPEDUJRHQIDWL]DQODQHFHVLGDGGHUDWLFDUVXVDSRUWD-
ciones. Por otra parte, el hecho de que la asimetra expresiva, a favor de la parte
L]TXLHUGDGHODFDUDIXHUDPD\RUHQODVHPRFLRQHVQHJDWLYDVKDFtDVRVSHFKDUTXH
HOKHPLVIHULRGHUHFKRSRGUtDHVWDUPiVLPSOLFDGRHQHVWHWLSRGHHPRFLRQHVPLHQ-
WUDVTXHHOKHPLVIHULRL]TXLHUGRSRGUtDMXJDUXQSDSHOPiVLPSRUWDQWHHQODVHPR-
FLRQHVSRVLWLYDV(UDXQDUJXPHQWRDWUDFWLYRTXHPHUHFtDODYHULFDFLyQ&RPR
LQGLFD.LQVERXUQH  ODUHDOL]DFLyQGHHVWXGLRVFRQSDFLHQWHVDIHFWDGRVSRU
OHVLyQFHUHEUDOORFDOL]DGDHQDOJXQRGHORVKHPLVIHULRVOOHYyDTXHVHSURSXVLHUD
TXHHQSDFLHQWHVFRQGDxRFHUHEUDOORFDOL]DGRODOHVLyQGHOKHPLVIHULRL]TXLHUGR
desinhiba la funcionalidad pesimista y negativa del hemisferio derecho, apare-
ciendo una mayor profusin de emociones negativas la UHDFFLyQFDWDVWUyFD;

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 135 Manual de teoras emocionales y motivacionales - UJI
por otra parte, la lesin del hemisferio derecho desinhiba la funcionalidad opti-
PLVWD\SRVLWLYDGHOKHPLVIHULRL]TXLHUGRDSDUHFLHQGRXQFRQVLGHUDEOHLQFUHPHQWR
en el nmero de emociones positivas.

En ltima instancia, como parece desprenderse de la situacin actual del tema


en este campo, la aparicin de resultados heterogneos nos lleva a ser prudentes
D OD KRUD GH HVWDEOHFHU XQD GHOLPLWDFLyQ ORFDOL]DFLRQLVWD GHPDVLDGR FHUUDGD \D
TXHDXQTXHSUHVXPLEOHPHQWHVHHVWiQLQYHVWLJDQGRODVHVWUXFWXUDVQHXURELROyJL-
cas que se encuentran implicadas en el control de la conducta emocional, el papel
H[DFWRTXHMXHJDFDGDXQDGHHOODVVLJXHVLHQGRDPELJXR/DVKLSyWHVLVTXHFRQ
PD\RUIUHFXHQFLDVHXWLOL]DQDODKRUDGHORFDOL]DUODSDUWLFLSDFLyQGHORVKHPLVIH-
rios cerebrales en las emociones son las siguientes:

a (OKHPLVIHULRGHUHFKRSRVHHXQDPDUFDGDVXSHULRULGDGVREUHHOKHPLVIHULRL]-
TXLHUGRHQHOSODQRGHODFRQGXFWDHPRFLRQDOHQJHQHUDO *DLQRWWL 

b /RVGRVKHPLVIHULRVSRVHHQXQDHVSHFLDOL]DFLyQFRPSOHPHQWDULDSDUDHOFRQWURO
de los distintos aspectos relacionados con el afecto. En particular, el hemisferio
L]TXLHUGRWHQGUtDXQSDSHOSUHGRPLQDQWHSDUDODVHPRFLRQHVSRVLWLYDVPLHQWUDV
que el hemisferio derecho sera predominante para las emociones negativas
6DFNKHLP*UHHQEHUJ:HLPDQ*XU+XQJHUEXKOHU\*HVFKZLQG 

c /DH[SUHVLyQHPRFLRQDODOLJXDOTXHHOOHQJXDMHHVXQDIRUPDHVHQFLDOGHFR-
municacin. El hemisferio derecho es dominante para la expresin emocional,
GHXQDIRUPDVLPLODUDODVXSHULRULGDGTXHSRVHHHOKHPLVIHULRL]TXLHUGRSDUD
HOOHQJXDMH 5RVV 

d (OKHPLVIHULRGHUHFKRHVGRPLQDQWHSDUDODSHUFHSFLyQGHWRGRVDTXHOORVHYHQ-
tos emocionalmente relacionados, tales como expresiones faciales, movimientos
FRUSRUDOHVHWF $GROSKV'DPDVLR7UDQHO\'DPDVLR 

(QGHQLWLYDHOFDPSRGHLQYHVWLJDFLyQHVDPSOLRODVSRVWXUDVWHyULFDVYDULDGDV
y, lgicamente, los resultados heterogneos. Estas limitaciones impiden el con-
senso acerca del papel concreto que juegan los hemisferios en general. Algunos
DXWRUHVFRPR/H'RX[ D VHxDODQTXHKD\TXHEXVFDUDOWHUQDWLYDVPHWR-
GROyJLFDVHQHOFDPSRGHODQHXURELRORJtD\HQGRKDFLDODHYHQWXDOORFDOL]DFLyQ
HVSHFtFDGHXQD]RQDFHUHEUDOFRQFUHWDLPSOLFDGDHQXQDHPRFLyQSDUWLFXODU6LQ
HPEDUJRSDUHFHPiVSUXGHQWHHYLWDUFXDOTXLHUDSUR[LPDFLyQH[FHVLYDPHQWHORFD-
OL]DFLRQLVWDHQXQiPELWRFRPRHOGHORVSURFHVRVHPRFLRQDOHVKDELGDFXHQWDGH
ODFDGDYH]PiVHYLGHQWHH[LVWHQFLDGHXQDLQWHUDFFLyQHQWUHSURFHVRVDIHFWLYRV\
procesos cognitivos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 136 Manual de teoras emocionales y motivacionales - UJI
/DVHPRFLRQHVEiVLFDV
(VIiFLOFRQVWDWDUFyPRGHIRUPDVLVWHPiWLFDVHKDXWLOL]DGRFRQEDVWDQWHH[L-
bilidad un gran nmero de trminos para referirse a los procesos emocionales.
De todos ellos, las denominaciones de afecto, humor y emocinVRQODVTXHPiV
frecuentemente han sido consideradas como intercambiables. Incluso, particulari-
]DQGRXQSRFRPiVGHORVWUHVWpUPLQRVUHVHxDGRVHOKXPRU\ODHPRFLyQVRQORV
TXHFRQPD\RUIUHFXHQFLDLQGXFHQDODFRQIXVLyQ3RUHVWDUD]yQFRQVLGHUDPRVTXH
HVFRQYHQLHQWHSURSRQHUDOJXQRVPDWLFHVTXHSHUPLWDQHQWHQGHUPHMRUFXiOHVVRQ
ODVYHQWDMDV\FXiOHVODVOLPLWDFLRQHVFXDQGRVHXWLOL]DFDGDXQRGHORVWpUPLQRV
tanto en las formulaciones tericas como en la investigacin.

Afecto. Si consideramos los conceptos de humor, emocin y afecto, podemos ob-


VHUYDUTXHHVWH~OWLPRHVHOPiVJHQHUDOGHORVWUHV$GHPiVGHVGHXQSXQWRGHYLVWD
ORJHQpWLFR\RQWRJHQpWLFRHVHOPiVSULPLWLYR(ODIHFWRSRVHHWRQRRYDOHQFLDTXH
puede ser positiva o negativa, e intensidad, que puede ser baja o alta. Se especula con
la posibilidad de que el tono o valencia est directamente relacionado con algunas
HVWUXFWXUDVGLHQFHIiOLFDV KLSRWiODPR \ODLQWHQVLGDGFRQODIRUPDFLyQUHWLFXODU(O
afecto tiene que ver con la preferencia; permite el conocimiento del valor que tienen
para el sujeto las distintas situaciones a las que se enfrenta. Existe una tendencia
innata hacia el afecto positivo, de tal suerte que la meta de un sujeto es obtener
placer. Podramos decir que el afecto representa la esencia de la conducta, enten-
GLGDHVWDHQODIRUPXODFLyQPiVHOHPHQWDOGHDSUR[LPDUVHDORTXHJXVWDJUDWLFD
o satisface, y de alejarse de aquello que proporciona las consecuencias opuestas.

Humor(OKXPRURHVWDGRDIHFWLYRHVXQDIRUPDHVSHFtFDGHOFRQMXQWRGHORV
SURFHVRVDIHFWLYRV7DPELpQLPSOLFDODH[LVWHQFLDGHWRQRHLQWHQVLGDG(OKXPRU
DGHPiVGHQRWDODH[LVWHQFLDGHXQFRQMXQWRGHFUHHQFLDVDFHUFDGHODSUREDELOLGDG
que tiene el sujeto de experimentar placer o dolor en el futuro; esto es, de expe-
rimentar el afecto positivo o el afecto negativo. Un humor concreto puede durar
varios das, variando segn lo haga la expectativa de futuro del sujeto. Relaciona-
GRFRQHODIHFWRWLHQHXQDGXUDFLyQPiVEUHYHSHURUHODFLRQDGRFRQODHPRFLyQ
VXHOHVHUPiVGXUDGHUR

Emocin7DPELpQHVXQDIRUPDHVSHFtFDGHOFRQMXQWRGHORVSURFHVRVDIHFWLYRV
Se corresponde con una respuesta multidimensional, con connotaciones adapta-
tivas, que suele ser muy breve, muy intensa y temporalmente asociada con un
estmulo desencadenante actual, tanto externo como interno; esto es: hace refe-
rencia a una relacin concreta del sujeto con su ambiente en el momento presente.
/RVSURFHVRVHPRFLRQDOHVFRPRSDUWHGHORVSURFHVRVDIHFWLYRVSXHGHTXHQRVH
encuentren presentes en todas las formas de vida, pero tampoco son patrimonio
H[FOXVLYRGHOVHUKXPDQRSXGLHQGRVHUORFDOL]DGDVHQGLYHUVDVHVSHFLHV6LQHP-
bargo, la conexin entre emociones y procesos cognitivos en el ser humano nos
lleva a sugerir la relevancia que adquiere la dimensin subjetiva de la emocin: el
sentimiento.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 137 Manual de teoras emocionales y motivacionales - UJI
Sentimiento+DFHUHIHUHQFLDDODWRPDGHFRQFLHQFLDUHVSHFWRDODRFXUUHQFLDGH
una emocin. Cuando la emocin es considerada como proceso, y as tiene que
ser considerada, el sentimiento es una fase o etapa en dicho proceso. Aunque no
es necesario para poder hablar de proceso emocional, es imprescindible para que un
individuo sepaTXHHVWiH[SHULPHQWDQGRXQDHPRFLyQ+DEODUGHVHQWLPLHQWRLPSOLFD
ODUHIHUHQFLDREOLJDGDDODFRQVFLHQFLD)LORJHQpWLFDPHQWHKDEODQGRODHPRFLyQHVXQ
proceso anterior a la consciencia, ya que esta es un producto de la propia evolucin,
TXHDSDUHFHFXDQGRHOFHUHEURDGTXLHUHODVXFLHQWHFDSDFLGDGGHGHVDUUROOR3RU
ese motivo, cabe perfectamente hablar de emociones en los individuos de espe-
cies inferiores, sin que tengamos que admitir de forma obligatoria la existencia de
sentimiento emocional en dichos individuos. En cuanto a la duracin, entendido
como percepcin sbita de una emocin, el sentimiento emocional es muy breve,
SUREDEOHPHQWH OD PiV EUHYH GH ODV GLVWLQWDV YDULDEOHV LQFOXLGDV HQ ORV SURFHVRV
afectivos. No obstante, el sentimiento puede dar lugar a una experiencia sostenida
HQHOWLHPSRDSUHFLDEOHPHQWHPiVGXUDGHUDLQFOXVRTXHHOSURSLRSURFHVRHPR-
cional: el humor.

&RQHVWRVSUHVXSXHVWRVKDEODUGHHPRFLRQHVEiVLFDVLPSOLFDUHIHULUVHDXQDIRUPD
particular de procesos afectivos relacionados directamente con la adaptacin, con
la funcionalidad y con la supervivencia.

/DVHPRFLRQHVEiVLFDVUHSUHVHQWDQXQDSDUWDGRPX\DWUDFWLYRSDUDHOHVWXGLRGHO
iPELWRHPRFLRQDOHQSVLFRORJtD$OPLVPRWLHPSRSXHGHQUHSUHVHQWDUXQSXHQWH
que permita el estudio comparado de las emociones en el ser humano y en otras
especies. En este orden de cosas, el hecho de considerar la existencia de un nme-
URPiVRPHQRVUHGXFLGRGHHPRFLRQHVEiVLFDVSHUPLWHODFRQXHQFLDGHLQWHUHVHV
procedentes de disciplinas relacionadas con los aspectos evolucionistas, del desa-
UUROORELROyJLFRVHWF/DXWLOLGDGGHOFRQFHSWRGHHPRFLyQEiVLFDHVHYLGHQWHHQ
psicologa de la emocin. Podra ocurrir, no obstante, que existiera alguna que otra
GLFXOWDGDODKRUDGHGHPRVWUDUHPStULFDPHQWHODSHUWLQHQFLDGHGLFKDXWLOL]DFLyQ
LQFOXVRODH[LVWHQFLDPLVPDGHHPRFLRQHVEiVLFDV&RPRKHPRVH[SXHVWRHQXQ
WUDEDMRDQWHULRU 3DOPHURVRPHWLGRDUHYLVLyQ HVPX\SUREDEOHTXHODSULPHUD
XWLOL]DFLyQ GH OD H[SUHVLyQ HPRFLRQHV EiVLFDV VH GHED D 'HVFDUWHV TXLHQ HQ
su trabajo 3DVLRQHVGHODOPD0HGLWDFLRQHVPHWDItVLFDV  SURSRQHOD
H[LVWHQFLDGHVHLVHPRFLRQHVEiVLFDVIHOLFLGDGWULVWH]DDPRURGLRGHVHR\DG-
miracin. El resto de las posibles emociones es, para Descartes, una combinacin
GHHVWDVVHLV(OpQIDVLVHQODH[LVWHQFLDGHHPRFLRQHVEiVLFDVVHFRQVLJXHFRQHO
trabajo de Darwin /DH[SUHVLyQGHODVHPRFLRQHVHQHOKRPEUH\HQORVDQLPDOHV
 FRQFODUDVUHSHUFXVLRQHVHQHOFDPSRGHODELRORJtD\ODSVLFRORJtD

+DKDELGRP~OWLSOHVDSUR[LPDFLRQHVDOHVWXGLRGHODVHPRFLRQHVEiVLFDVDSUHFLiQ-
GRVHDUJXPHQWRVDIDYRU\HQFRQWUD4XLHQHVDUJXPHQWDQDIDYRUGHODH[LVWHQFLD
GH HPRFLRQHV EiVLFDV SURSRQHQ XQRV FULWHULRV EDVDGRV HQ OD H[SUHVLyQ (NPDQ
E HQODUHVSXHVWDVLROyJLFD /HYHQVRQ&DUWHQVRQ)ULHVHQ\(NPDQ 
\PiVUHFLHQWHPHQWHHQODYDORUDFLyQ 3RZHU\'DOJOHLVK (OGHQRPLQDGRU
comn a todas estas formulaciones tiene que ver con la existencia de una asociacin
HVSHFtFDFRQFUHWD\GLIHUHQFLDOHQWUHXQSDWUyQH[SUHVLYR\XQDHPRFLyQHQWUH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 138 Manual de teoras emocionales y motivacionales - UJI
XQSHUOGHUHVSXHVWDVLROyJLFD\XQDHPRFLyQHQWUHXQDYDORUDFLyQUHODFLRQDGD
con una meta y una emocin. Por su parte, quienes cuestionan la existencia de emo-
FLRQHVEiVLFDVORKDFHQFULWLFDQGRODPHWRGRORJtDXWLOL]DGDUHFRQRFLPLHQWRGHOD
H[SUHVLyQPHGLDQWHODHOHFFLyQIRU]RVDRODXWLOL]DFLyQIUHFXHQWHGHH[SUHVLRQHV
QJLGDV ODV PXHVWUDV HVWXGLDGDV FRQ PXFKD IUHFXHQFLD PXHVWUDV GH SHUVRQDV
RFFLGHQWDOHV 5XVVHOO \ODYDOLGH]GHODH[SUHVLyQIDFLDOORDXWpQWLFDPHQWH
XQLYHUVDOHVODDFWLYDFLyQGHORVP~VFXORVVHQFLOORVORVFXDOHVGDQOXJDUDODFRQ-
JXUDFLyQGHODH[SUHVLyQIDFLDO 2UWRQ\\7XUQHU 

0iVDOOiGHFRQVWDWDFLRQHV\UHIXWDFLRQHVSDUHFHFDGDYH]PiVDFHSWDGDODH[LV-
WHQFLDGHHPRFLRQHVEiVLFDV1RREVWDQWHFRPRTXLHUDTXHVRQYDULDGRVORVFULWH-
ULRVXWLOL]DGRVSDUDORFDOL]DUFXiQWDV\FXiOHVGHODVGLVWLQWDVHPRFLRQHVSURSXHVWDV
SXHGHQVHUFRQVLGHUDGDVEiVLFDVVHJXLPRVHQFRQWUDQGRXQDFLHUWDGLVFUHSDQFLDHQ
DOJXQRVHVWXGLRV/RVGLVWLQWRVDXWRUHVIXQGDPHQWDQVXSRVWXUDDSDUWLUGHXQFULWH-
rio concreto, en virtud del cual solo existe un pequeo grupo de emociones puras,
SULPDULDVFHQWUDOHVEiVLFDVHWFHPRFLRQHVTXHSXHGHQVHUGLVWLQJXLGDVDSDUWLU
GHOFULWHULRXWLOL]DGRH[SUHVLyQVLRORJtDYDORUDFLyQ

/DXWLOL]DFLyQGHFXDOTXLHUDGHHVWRVWUHVFULWHULRVFRQGXFHDODSURSXHVWDGHXQ
UHGXFLGRQ~PHURGHHPRFLRQHVEiVLFDVHVHQFLDOPHQWHODVPLVPDV$VtSXHVORV
FULWHULRVTXHDFWXDOPHQWHFDSLWDOL]DQODUHOHYDQFLD\ORVHVWXGLRVTXHVHHVWiQOOH-
YDQGRDFDERVRQORVVLJXLHQWHVODFDUDFWHUtVWLFDH[SUHVLYDODGLPHQVLyQVLROyJL-
ca y el proceso de valoracin.

En cuanto a la caracterstica expresivaHVXQDUJXPHQWRFOiVLFRORFDOL]DGRHQ


HOWUDEDMRGH'DUZLQ  \GHIHQGLGRSRUDXWRUHVFRPR3OXWFKLN  
,]DUG  \IXQGDPHQWDOPHQWHSRU(NPDQ D 'HVGHHVWDSHUVSHFWLYD
VHGHHQGHODXQLYHUVDOLGDGGHDOJXQDVHPRFLRQHVDSDUWLUGHODH[LVWHQFLDGHXQD
H[SUHVLyQIDFLDO\GHXQRVFDPELRVVLROyJLFRVHVSHFtFRVSDUDFDGDXQDGHGL-
FKDVHPRFLRQHVEiVLFDV/DVHPRFLRQHVEiVLFDVORVRQHQODPHGLGDHQODTXHVH
puede demostrar su existencia en los distintos grupos humanos, independientemente
GHODVLQXHQFLDVFXOWXUDOHVORVRQHQODPHGLGDHQODTXHVHSXHGHDSUHFLDUVX
H[LVWHQFLDHQORVQLYHOHVPiVEDMRVGHODHVFDODORJHQpWLFD'HKHFKRFRPR
LQGLFDED3OXWFKLN  ODVHPRFLRQHVEiVLFDVVRQUHOHYDQWHVHQODHVFDODORJH-
ntica entera, ya que juegan un papel importante en la adaptacin.

8QRGHORVDXWRUHVTXHPiVKDGHIHQGLGRHOFDUiFWHUEiVLFRGHDOJXQDVHPRFLRQHVD
SDUWLUGHODFDUDFWHUtVWLFDH[SUHVLYDKDVLGR(NPDQ DE 3DUDHVWHDXWRU
algunas emociones son universales, entendiendo con el trmino universal la propie-
dad de algunas emociones para producirse de forma indefectible ante estmulos que
son considerados con las mismas caractersticas por las personas que se enfrentan a
HOORVLQGHSHQGLHQWHPHQWHGHODFXOWXUDHOJUXSRVRFLDOODUD]DHWF(VPiVLQFOXVR
llega a proponer que ciertas caractersticas expresivas, que denotan la existencia
de una determinada emocin, son susceptibles de ser observadas en individuos de
HVSHFLHVLQIHULRUHVORJHQpWLFDPHQWHSUy[LPDVDODHVSHFLHKXPDQD3DUD(NPDQ
H[LVWHQQXHYHFDUDFWHUtVWLFDVTXHGLVWLQJXHQDODVHPRFLRQHVEiVLFDVHQHOVHUKXPD-
QR  ODXQLYHUVDOLGDGHQORVHYHQWRVTXHDQWHFHGHQDODHPRFLyQ  ODH[SUHVLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 139 Manual de teoras emocionales y motivacionales - UJI
XQLYHUVDOGLVWLQWLYD  ODVLRORJtDGLVWLQWLYD  ODSUHVHQFLDHQRWUDVHVSHFLHVGH
SULPDWHV  ODFRKHUHQFLDHQODUHVSXHVWDHPRFLRQDO  XQUiSLGRLQLFLR  XQD
EUHYHGXUDFLyQ  XQDYDORUDFLyQDXWRPiWLFD\  XQDRFXUUHQFLDLPSUHYLVLEOH(O
resultado de sus trabajos pone de relieve la existencia de un pequeo grupo de emo-
FLRQHVEiVLFDVODLUDODWULVWH]DHOPLHGRHODVFRODDOHJUtD HQRFDVLRQHVWDPELpQ
VHKDLQFOXLGRODVRUSUHVD 1RREVWDQWHFRPRKHPRVVHxDODGRDQWHULRUPHQWHHQ
WUDEDMRVPiVUHFLHQWHV (NPDQDE HODXWRUKDPRGLFDGRVXSURSXHVWD
UHULpQGRVHDXQFRQMXQWRPiVDPSOLRGHFDUDFWHUtVWLFDVGLVWLQWLYDVGHODVHPRFLRQHV
EiVLFDV$OQDO(NPDQVHUHHUHDXQFRQMXQWRGHHPRFLRQHVEiVLFDVHQWUHODVTXH
se incluyen las siguientes: diversin, ira, desprecio, alegra, asco, turbacin, excita-
FLyQPLHGRFXOSDRUJXOORDOLYLRWULVWH]DGLVWUpVVDWLVIDFFLyQSODFHUVHQVRULDO\
YHUJHQ]D(QWRWDOTXLQFHHPRFLRQHVEiVLFDV$XQTXHQRGXGDPRVGHODHYHQWXDO
existencia de todas y cada una de ellas, permtasenos mostrar nuestras reservas res-
pecto a que todos y cada uno de estos trminos hagan referencia, no solo a la pecu-
OLDULGDGGHHPRFLyQEiVLFDVLQRLQFOXVRDODSURSLDGHQRPLQDFLyQGHHPRFLyQ(QWUH
las emociones dudosas, podramos referirnos al placer sensorial y a la satisfaccin.
En cualquier caso, como venimos reseando a lo largo de nuestra exposicin, somos
conscientes de la existencia de controversia en diversos aspectos referidos a los pro-
cesos emocionales, por lo que cualquier propuesta merece ser considerada, aunque
WDPELpQYHULFDGDHPStULFDPHQWH

(QFXDQWRDODUHVSXHVWDVLROyJLFDODFOiVLFDSUHWHQVLyQGH-DPHVFXDQGRWUDWDED
GHORFDOL]DUXQSDWUyQSVLFRVLROyJLFRHVSHFtFRHQFDGDHPRFLyQVLJXHYLJHQWH
\GHKHFKRFRQUHQRYDGREUtRSXHVHOSHUOSVLFRVLROyJLFRVHHVJULPHFRPR
criterio determinante para explicar las distintas emociones que pueden ser consi-
deradas como emociones bsicas6LELHQSDUHFHHQRUPHPHQWHGLItFLOLGHQWLFDU
ODVHPRFLRQHVEiVLFDVDSDUWLUGHODVHVWUXFWXUDVQHXUDOHV\DTXHHVWDVFDPELDQ
con la evolucin, y los organismos menos desarrollados son capaces de mostrar
emociones aunque su sistema nervioso sea precario y rudimentario, s que parece
YLDEOHHVWXGLDUODVUHVSXHVWDVVLROyJLFDVSRUVLFXSLHVHODSRVLELOLGDGGHHQFRQ-
trar patrones de respuesta caractersticos de cada emocin.

+DVWDKDFHUHODWLYDPHQWHSRFRWLHPSRH[LVWtDXQLPSRUWDQWHSUREOHPDFRQODXWLOL-
]DFLyQGHOFULWHULREDVDGRHQODUHVSXHVWDVLROyJLFD$VtHUDPX\IUHFXHQWHXWLOL]DU
FRPRQ~FOHRVGHPHGLFLyQGHODUHVSXHVWDVLROyJLFDORVVLVWHPDVVLPSiWLFRDGUH-
QRPHGXODUHKLSRVDULRDGUHQRFRUWLFDO(OSULPHURGHHOORVFRQODVGRVUDPLFD-
FLRQHVFRQRFLGDVVLPSiWLFD\SDUDVLPSiWLFDHVWLPXODODPpGXODGHODVJOiQGXODV
VXSUDUUHQDOHV R JOiQGXODV DGUHQDOHV GDQGR OXJDU D TXH HVWDV VLQWHWLFHQ \ OLEHUHQ
epinefrina y norepinefrina. El segundo de los sistemas propuestos, mediante la se-
FUHFLyQGHKRUPRQDV\IDFWRUHVGHOLEHUDFLyQKRUPRQDOHVWLPXODODFRUWH]DGHODV
JOiQGXODVDGUHQDOHVKDFLHQGRTXHHVWDVVLQWHWLFHQ\OLEHUHQFRUWLFRLGHVFRPROD
aldosterona, glucocorticoides, entre los que se encuentra el cortisol, y esteroides
andrognicos, como la androstendiona.

&RQHVWRVGRVVLVWHPDVHVWHUULEOHPHQWHGLItFLOHVWDEOHFHUODH[LVWHQFLDGHSHU-
OHVSVLFRVLROyJLFRVGLIHUHQFLDOHVSDUDFDGDHPRFLyQ/DUD]yQSDUHFHVHQFLOOD
 VLODVHPRFLRQHVVXSRQHQXQDUHVSXHVWDDGDSWDWLYDDQWHVLWXDFLRQHVTXHHQWUDxDQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 140 Manual de teoras emocionales y motivacionales - UJI
DPHQD]D SHOLJUR GHVHVWDELOL]DFLyQ GHVHTXLOLEULR HWF   VL OD RFXUUHQFLD GH
XQDHPRFLyQOOHYDFRQVLJRODDFWLYDFLyQGHXQDGHWHUPLQDGDUHVSXHVWDVLROyJL-
FD  VLORVVLVWHPDVVLROyJLFRVTXHWLHQHQTXHSURGXFLUODUHVSXHVWDVRQORVGRV
TXHKHPRVUHVHxDGR  VLHQFDGDXQDGHODVHPRFLRQHVVHSURGXFHODDFWLYDFLyQ
GHDPERVVLVWHPDV  HVEDVWDQWHSUREDEOHTXHVHREVHUYHQORVPLVPRVSDUi-
PHWURVSVLFRVLROyJLFRVRSDUiPHWURVSVLFRVLROyJLFRVPX\SDUHFLGRVHQPiV
GHXQDHPRFLyQ  HVGLItFLODSHODUDODH[LVWHQFLDGHXQSDWUyQSVLFRVLROyJLFR
diferencial caracterstico de cada una de las emociones.

Aunque intuitivamente podemos pensar que parece lgico que cada emocin se
HQFXHQWUHDVRFLDGDDXQSHUOSVLFRVLROyJLFRHVSHFtFRORFLHUWRHVTXHODXWL-
OL]DFLyQH[FOXVLYDGHORVGRVVLVWHPDVUHVHxDGRVLPSRQHVHULDVUHVWULFFLRQHVGL-
ItFLOHV GH VDOYDU 1R REVWDQWH HQ ORV ~OWLPRV DxRV VH HVWi DFODUDQGR EDVWDQWH OD
VLWXDFLyQ$VtSRUXQDSDUWHODXWLOL]DFLyQGHSURFHGLPLHQWRV\WpFQLFDVPiVVR-
VWLFDGDVSHUPLWHSRUPHQRUL]DUPiVH[KDXVWLYDPHQWHFXiOHVVRQODVPDQLIHVWDFLR-
QHVSDUWLFXODUHVLPSOtFLWDVHQODUHVSXHVWDVLROyJLFDGHFDGDHPRFLyQ$GHPiV
SRURWUDSDUWHVDEHPRVTXHSDUDHQWHQGHUODUHVSXHVWDVLROyJLFDJHQHUDOGHXQ
organismo en el momento en el que ocurre una emocin, junto con la relevante
implicacin del sistema autonmico, hay que considerar tambin la implicacin
del sistema nervioso central y del sistema inmunitario. Estas dos peculiaridades
reseadas incrementan apreciablemente la probabilidad de conocer con exactitud
HOSHUOSVLFRVLROyJLFRDVRFLDGRDFDGDHPRFLyQEiVLFD

+D\DOJ~QHMHPSORTXHLOXVWUDORTXHDFDEDPRVGHFRPHQWDU$OUHVSHFWRGHVGH
TXH&DQQRQ  SURSXVLHUDODH[LVWHQFLDGHSDWURQHVHQGRFULQRVDVRFLD-
dos a las respuestas de lucha y de huida, pasando por las importantes aportaciones
GH+HQU\  VHKDDUJXPHQWDGRFRQIUHFXHQFLDTXHHQODVHPRFLRQHVGHPLHGR
y de ira se produce un importante incremento en la secrecin de catecolaminas
HSLQHIULQD\QRUHSLQHIULQD GHVGHODPHGXODDGUHQDO&RQHVDDUPDFLyQQRHUD
SRVLEOHGLVFHUQLUODHYHQWXDOHVSHFLFLGDGSVLFRVLROyJLFDHQDPEDVHPRFLRQHV
(VD DUPDFLyQ HUD FRUUHFWD \ OR VLJXH VLHQGR 6LQ HPEDUJR KR\ VDEHPRV TXH
aunque en ambas emociones se produce un importante incremento en la secrecin
de catecolaminas desde la mdula adrenal, en la emocin de ira es mayor el incre-
mento de norepinefrina, mientras que, en la emocin de miedo, el mayor incremento
VHSURGXFHHQODHSLQHIULQD &DUOVRQ\+DWHOG 

(VWDVSHFXOLDULGDGHVGHQRWDQORTXHFRPHQWiEDPRVDQWHULRUPHQWHODH[LVWHQFLDGH
SURFHGLPLHQWRV\WHFQRORJtDPiVGHVDUUROODGRVSHUPLWHGHOLPLWDUPLQXFLRVDPHQWH
HOSHUOSVLFRVLROyJLFRSDUWLFXODU\FDUDFWHUtVWLFRGHFDGDHPRFLyQ3UREDEOHPHQ-
te, la idea de James no fuera tan descabellada cuando propona la correspondencia
HQWUHXQSDWUyQSVLFRVLROyJLFRFRQFUHWR\XQDHPRFLyQSDUWLFXODU1RVDEHPRVVL
FRQHOGHVDUUROORGHSURFHGLPLHQWRVPiVVRVWLFDGRVVHSRGUiOOHJDUDXQDGHOLPL-
WDFLyQPiVQD\SRUPHQRUL]DGDGHWRGRVDTXHOORVFDPELRVVLROyJLFRVFDUDFWH-
rsticos de cada una de las emociones.

En cuanto al proceso de valoracinHODUJXPHQWRTXHFRQPiVIUHFXHQFLDVHXWLOL-


]DSDUDMXVWLFDUODH[LVWHQFLDGHHPRFLRQHVEiVLFDVKDVLGRH[SOLFLWDGRFRQPXFKD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 141 Manual de teoras emocionales y motivacionales - UJI
FODULGDGSRU6WHLQ\7UDEDVVR  HQWpUPLQRVGHfuncionalidad derivada de la
valoracin(QHIHFWRHVWRVDXWRUHVSURSRQHQTXHODQDWXUDOH]DGHODYDORUDFLyQ
DVRFLDGDFRQFDGDHPRFLyQEiVLFDSXHGHVHUGHQLGDIXQFLRQDOPHQWH(VXQDIRU-
ma de proponer el valor adaptativo de las emociones en general, y especialmente
GHODVHPRFLRQHVEiVLFDV([LVWHXQSHTXHxRQ~PHURGHPHWDVXREMHWLYRVFHQWUD-
les en el ser humano que son compartidos por todos los individuos de cualquier
grupo, independientemente de la cultura en la que se ha desarrollado ese individuo
\ HVH JUXSR$ VX YH] HVWDV PHWDV X REMHWLYRV VH HQFXHQWUDQ DVRFLDGRV FRQ XQ
SHTXHxRFRQMXQWRGHSURFHVRVGHYDORUDFLyQSODQLFDFLyQ\DFFLyQUHIHULGRVD
ODFRQVHFXFLyQPDQWHQLPLHQWR\UHFXSHUDFLyQGHGLFKDVPHWDVXREMHWLYRV/DV
HPRFLRQHVEiVLFDVVRQDTXHOODVHQODVTXHVXSURFHVRGHYDORUDFLyQVHHQFXHQWUD
unido a cualquiera de las citadas metas universales u objetivos centrales que con-
forman ese particular y reducido grupo.

/DV HPRFLRQHV EiVLFDV VRQ DTXHOODV TXH LQGHSHQGLHQWHPHQWH GH ODV LQXHQFLDV
TXHSXHGDQHMHUFHUORVIDFWRUHVVRFLDOHVGHDSUHQGL]DMHFXOWXUDOHVHWFVRQHOUH-
sultado de procesos idnticos de valoracin. En este caso, el criterio fundamental
SDUDKDEODUGHHPRFLyQEiVLFDVHUHHUHDODH[LVWHQFLDGHXQSURFHVRGHYDORUDFLyQ
FRQFUHWRTXHGHVHPERFDHQODRFXUUHQFLDGHXQDHPRFLyQHVSHFtFD(QODWDEOD
VLJXLHQWHVHH[SRQHODFRQJXUDFLyQGHODVHPRFLRQHVEiVLFDVVHJ~QFDGDXQRGH
ORVGLVWLQWRVFULWHULRVXWLOL]DGRVFDUDFWHUtVWLFDH[SUHVLYDVLRORJtD\YDORUDFLyQ

'LPHQVLyQVLROyJLFD Caractersticas expresivas 9DORUDFLyQ

Ira Alegra Alegra


0LHGR 0LHGR 0LHGR
Asco Asco Asco
7ULVWH]D Ira Ira
7ULVWH]D 7ULVWH]D
RFDVLRQDOPHQWHWDPELpQVRUSUHVD

7DEOD(PRFLRQHVEiVLFDVVHJ~QGLVWLQWRVFULWHULRV

(QFXDQWRDODVRUSUHVDTXLHQHVGHHQGHQHOFULWHULRGHODVFDUDFWHUtVWLFDVH[SUHVL-
YDVFRQVLGHUDQTXHVHWUDWDGHXQDPiVGHGLFKDVHPRFLRQHVEiVLFDV6LQHPEDUJR
no descartamos la posibilidad de que se trate tan solo de una variable cognitiva que
puede formar parte de otra emocin. Esto es, ni tan siquiera una emocin. En oca-
siones asociada a ciertas manifestaciones motoras y expresivas, la sorpresa puede
IRUPDUSDUWHGHGLYHUVDVHPRFLRQHVFRPRXQDVXHUWHGHDQiOLVLVGHGLVFUHSDQFLDR
incongruencia que precede a la interpretacin y valoracin de un estmulo, evento
o situacin. El resultado de esa interpretacin, evaluacin y valoracin puede dar
lugar a una emocin o a otra, o a ninguna. El denominador comn en todas las
posibles circunstancias es la aparicin de algo inesperado, de algo no previsto.
Como consecuencia, se puede producir un bloqueo motor, ciertas manifestaciones
H[SUHVLYDV\XQDSHFXOLDULGDGFRJQLWLYDGHGHVRULHQWDFLyQ$GHPiVHOVHQWLPLHQWR
asociado a la posible emocin de sorpresa es discutible, ya que, dependiendo del
FXUVRTXHWRPHQORVDFRQWHFLPLHQWRVDVtFRPRGHODVFRQQRWDFLRQHV\VLJQLFDFLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 142 Manual de teoras emocionales y motivacionales - UJI
TXHSRVHHHOHYHQWRHQHVDVLWXDFLyQSDUDXQGHWHUPLQDGRLQGLYLGXRDVtVHUiOD
emocin que se desencadene. En suma, ante la duda respecto a la consideracin de
la sorpresa como una emocin, nos parece prudente referirnos a ella en trminos
de variable cognitiva que puede formar parte de mltiples emociones.

$VtSXHVDSDUWLUGHORVDUJXPHQWRVTXHKHPRVHVER]DGRDUJXPHQWRVTXHVHED-
VDQHQORVHVWXGLRVUHDOL]DGRVHQORV~OWLPRVDxRVQXHVWUDYLVLyQGHODVHPRFLRQHV
EiVLFDVFRQWHPSODFLQFRGHHOODVPLHGRWULVWH]DLUDDVFRDOHJUtD

)XQFLRQHVGHODVHPRFLRQHV
Creemos que nadie duda en la actualidad acerca de la existencia de emociones en
el ser humano; hasta cierto punto, somos capaces de comunicar con palabras lo
que se experimenta en el momento de sentir una emocin; expresamos y transmi-
WLPRVDORVGHPiVQXHVWURVHVWDGRVLQWHUQRVPHGLDQWHFLHUWRVVLJQRVJHVWRVPR-
vimientos, etc.; nuestro cuerpo se ajusta a esos estados experimentados mediante
ODDFWLYDFLyQRGHVDFWLYDFLyQVLROyJLFDFRUUHVSRQGLHQWHHQFDGDFDVR<WRGR
eso lo sabemos porque somos conscientes de lo que ocurre en nuestro organismo
y en nuestra vida. Sin embargo, cuando nos enfrentamos al estudio de la emocin
en individuos de especies inferiores, nos encontramos con un problema evidente:
QRH[LVWHXQOHQJXDMHFRP~QTXHQRVSHUPLWDHOUiSLGR\XLGRLQWHUFDPELRGH
informacin. No obstante, dicha limitacin no impide que realicemos inferencias
acerca de la ocurrencia de emociones en animales de especies inferiores. Con el
FRQVLJXLHQWHULHVJRGHUHDOL]DUDWULEXFLRQHVDQWURSRPyUFDVFDEHODSRVLELOLGDG
GHHQFRQWUDUFLHUWDVVLPLOLWXGHVHQODVGLPHQVLRQHVVLROyJLFD\H[SUHVLYD(QHVWH
marco de referencia, la caracterstica expresiva y motora es el criterio susceptible
GHVHUXWLOL]DGRSRUORVVHUHVKXPDQRVSDUDVXSRQHUODH[LVWHQFLDGHXQDHPRFLyQ
HQXQDQLPDOGHHVSHFLHLQIHULRU&XDQWRPD\RUHVODSUR[LPLGDGORJHQpWLFDFRQ
la especie humana, tanto mayor es la similitud en las caractersticas expresivas.

(VGHFLUODVHPRFLRQHVMXHJDQXQSDSHOGHQLGRFRQUHOHYDQFLDHQODVGLVWLQWDV
formas de adaptacin a las que se tiene que ceir el ser humano: las emociones
tienen funciones. A pesar de que ha habido argumentos referidos a los efectos
GHVRUJDQL]DGRUHVGHODHPRFLyQ 'HZH\+HEE DSHVDUGHTXHHQ
RFDVLRQHVWDPELpQVHKDSURSXHVWRTXHODVHPRFLRQHVWXYLHURQXQDIXQFLyQGH-
QLGDHLPSRUWDQWHHQHOSDVDGRSHURDKRUD\DQRFXPSOHQQLQJXQDIXQFLyQ %XVV
+DVHOWRQ 6KDFNHOIRUG %OHVNH \ :DNHHOG   OR ELHQ FLHUWR HV TXH FRPR
LQGLFDQ.HOWQHU\*URVV  SDUHFHXQKHFKRDFHSWDGRTXHODVHPRFLRQHVWLH-
nen funciones en la actualidad porque las tuvieron en el pasado, y ese hecho ha
permitido la consolidacin de las mismas en el bagaje gentico de las especies.

As, desde un punto de vista biolgico, parece evidente que las emociones poseen un
valor extraordinario a la hora de entender cmo un organismo se adapta a las con-
GLFLRQHVFDPELDQWHVGHVXPHGLRDPELHQWH/DVHPRFLRQHVSRVHHQIXQFLRQHVSXHV
si no fuera as, la propia seleccin natural habra ido progresivamente depurando su

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 143 Manual de teoras emocionales y motivacionales - UJI
presencia, hasta hacerlas desaparecer por completo del bagaje gentico de las espe-
FLHV/DVHPRFLRQHVVHHQFXHQWUDQLQFOXLGDV\IRUPDQSDUWHGHODVFRQGXFWDVTXH
QXHVWURVDQWHSDVDGRVOOHYDEDQDFDERFDGDYH]TXHVHHQIUHQWDEDQDVLWXDFLRQHV
que podan suponer un peligro para su vida. Aunque se puede proponer que cada una
GHODVHPRFLRQHVSRVHHXQDVIXQFLRQHVSDUWLFXODUHVFUHHPRVSHUWLQHQWHHQIDWL]DUHQ
este momento que una de las funciones generales de las emociones tiene que ver con
ODH[LELOLGDGTXHDSRUWDQDODVFRQGXFWDVGHXQRUJDQLVPRFXDQGRHVWHVHHQIUHQWD
DVLWXDFLRQHVTXHH[LJHQXQDVROXFLyQPiVRPHQRVGUiVWLFD\~WLO'HHVWHPRGRVH
incrementa la probabilidad de xito, de adaptacin y de supervivencia. Como es l-
gico, si poseen funciones, las presiones ambientales que dan lugar a la propia evolu-
FLyQKDQUHDUPDGRVXSDSHOSHUPDQHFLHQGRHQODGRWDFLyQJHQpWLFDGHODVHVSHFLHV
6LDGHPiVHVDVIXQFLRQHVWLHQHQFRQQRWDFLRQHVGHD\XGDUDVROXFLRQDUSUREOHPDV
GHHYLWDUSHOLJURVHWFHVOyJLFRHQFRQWUDUTXHHQWUHODVHPRFLRQHVEiVLFDVSUHGRPL-
nen aquellas comnmente denominadas emociones negativas, que no tienen por qu
VHUQHJDWLYDVVLVXRFXUUHQFLDHVKRPHRVWiWLFD\SDUVLPRQLRVDSHURTXHGHYLHQHQ
peligrosas para la salud fsica, mental y social de una persona cuando su ocurrencia
es excesiva en frecuencia, intensidad o duracin.

Existe, no obstante, una asociacin entre la dimensin biolgica y la dimensin cul-


tural en la ocurrencia de las emociones. As, estando presente en la dotacin gentica
HOPHFDQLVPRGHODVHPRFLRQHVEiVLFDVFDGDXQDGHHOODVVHDFWLYDUiFRPRFRQVH-
FXHQFLDGHOSURFHVRGHYDORUDFLyQFX\RUHVXOWDGRHVODVLJQLFDFLyQUHIHULGDDODIXQ-
FLyQFRQFUHWDGHFDGDXQDGHGLFKDVHPRFLRQHV/DVLQXHQFLDVVRFLDOHV\FXOWXUDOHV
que recibe cualquier persona a lo largo de su proceso de desarrollo van moldeando
VXSDWUyQFRQGXFWXDOEiVLFRKDFLHQGRTXHVHLQWHULRULFHDTXHOORTXHHVVRFLDOPHQWH
aceptable, aquello que es injusto, etc. Consiguientemente, cuando una determinada
SHUVRQDOOHYDDFDERHODQiOLVLVGHODHVWLPXODFLyQTXHHVWiUHFLELHQGRHYDO~D\YDORUD
las connotaciones de la misma; cuando, tras esos procesos, concluye que dicha situa-
FLyQWLHQHFRQQRWDFLRQHVDVRFLDGDVDODIXQFLyQGHDOJXQDGHODVHPRFLRQHVEiVLFDV
en esa persona se activa el mecanismo biolgico relacionado con dicha emocin.

8QDGHODVSHUVSHFWLYDVPiVIUXFWtIHUDVSDUDHQWHQGHUODVIXQFLRQHVGHODVHPR-
FLRQHVFRQVLVWHHQDERUGDUVXLPSOLFDFLyQDGDSWDWLYDGHOLPLWDQGRFXiOHVVRQVXV
repercusiones, tanto positivas como negativas, en el funcionamiento biolgico,
SVLFROyJLFR\VRFLDOGHXQDSHUVRQD4XHUHPRVUHVHxDUTXHKDEODPRVGHUHSHUFX-
siones positivas y negativas porque, aunque defendemos la funcionalidad de las
emociones, esto es, defendemos la dimensin positiva de dichos procesos, no es
menos cierto que, en ocasiones, se hace preciso ejercer alguna suerte de control o
regulacin voluntarios, tanto en la experiencia, cuanto en la expresin, ya que pue-
GHRFXUULUXQFRQLFWRRLQFRPSDWLELOLGDGHQWUHODQHFHVLGDGRLPSXOVRELROyJLFR
y la necesidad o exigencia social.

A la hora de enfrentarnos a las funciones de las emociones, siguiendo el trabajo


GH/HYHQVRQ  DJUXSDUHPRVODSDUWLFLSDFLyQGHGLFKRVSURFHVRVHQODV
dimensiones intrapersonal e interpersonal. Por lo que respecta a la dimensin in-
WUDSHUVRQDODOJXQDVGHODVPiVLPSRUWDQWHVIXQFLRQHVGHODVHPRFLRQHVVHUHHUHQ
a los siguientes aspectos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 144 Manual de teoras emocionales y motivacionales - UJI
El escape o prdida de la homeostasis. Es una de las importantes funciones intra-
personales de las emociones, ya que permite la separacin, muchas veces nece-
VDULDGHODWLUiQLFDtendencia al centro que muestran los niveles de las variables
esenciales del organismo. En efecto, para funcionar correctamente, es necesario
TXHORVQLYHOHVGHDFWLYDFLyQHQORVVLVWHPDV\SDUiPHWURVLPSRUWDQWHVGHQXHVWUR
RUJDQLVPRVHHQFXHQWUHQGHQWURGHORVOtPLWHVGHFRQDQ]DROtPLWHVGHOD]RQD
ptima. Existe una tendencia a buscar el punto medio o punto ptimo, como ya
SURSXVLHUDQ%HUQDUG  \&DQQRQ  DXQTXHFDGDYH]TXHVHDO-
FDQ]DVHVXHOHVREUHSDVDUWDQWRSRUH[FHVRFRPRSRUGHIHFWR(VWHWLSRGHXF-
tuaciones recurrentes conforman lo que se denomina homeostasis, entendida como
HTXLOLEULR GLQiPLFR 6L QR FXSLHVH OD SRVLELOLGDG GH UHEDVDU FRQ DPSOLWXG HVRV
OtPLWHVGHOD]RQDySWLPDHQPXFKDVRFDVLRQHVQXHVWURRUJDQLVPRQRVHUtDFDSD]
GHRIUHFHUODVLQWHQVDVUHVSXHVWDVTXHPXHVWUD7DOHVUHVSXHVWDVTXHDWRGDVOXFHV
podran ser desadaptativas si se mantuviesen mucho tiempo, o si se repitiesen con
demasiada frecuencia, o si fueran tan intensas que llegaran a producir un desorden
o disfuncin en ese momento, pueden ser consideradas como respuestas necesa-
rias, por lo tanto respuestas adaptativas, en determinadas circunstancias. Pueden
VHULPSUHVFLQGLEOHVSDUDTXHHORUJDQLVPRRIUH]FDXQDFRQGXFWDDSURSLDGDDXQD
situacin excepcional, siempre y cuando esas separaciones importantes de los l-
PLWHVGHFRQDQ]DQRVHDQH[FHVLYDPHQWHIUHFXHQWHVLQWHQVDVQLGXUDGHUDV En
HVWHPDUFRGHUHIHUHQFLDODVHPRFLRQHVUHSUHVHQWDQHVDYiOYXODGHHVFDSHGHOD
SUHVLyQKRPHRVWiWLFD\DTXHSRVLELOLWDQODRFXUUHQFLDGHFDPELRVFRQFUHWRVHQORV
que los niveles de activacin son excesivamente discordantes con el nivel ptimo
GHDFWLYDFLyQSHURQHFHVDULRVHQHVHPRPHQWRSDUDTXHHORUJDQLVPRRIUH]FDOD
respuesta apropiada a la situacin particular que le afecta. Aunque las virtudes del
mantenimiento de esos niveles medios son evidentes, la tirana de la homeostasis
podra, paradjicamente, llegar a ser desadaptativa, pues impedira al organismo
RIUHFHUUHVSXHVWDVLQWHQVDVHQPRPHQWRVFRQFUHWRV/DVHPRFLRQHVPRYLOL]DQFRQ
UDSLGH]ORVUHFXUVRVLQWHUQRVSDUDLQFUHPHQWDUODSUREDELOLGDGGHRIUHFHUODUHV-
SXHVWDPiVDSURSLDGDHQXQDVLWXDFLyQGHDPHQD]DRGHVDItR(VHYLGHQWHTXHVL
ELHQODVHPRFLRQHVSHUPLWHQHVWDVPRGLFDFLRQHVH[WUHPDVHQHOPHGLRDPELHQWH
LQWHUQRHVWDPELpQFLHUWRTXHHQODPHGLGDHQODTXHGLFKDVPRGLFDFLRQHVVHDQ
frecuentes, intensas y duraderas, se incrementa el riesgo de que las emociones
GHMHQGHVHUIXQFLRQDOHV\VHFRQYLHUWDQHQIDFWRUHVGHULHVJR 7XFNHU\)ULHGPDQ
3DOPHUR\)HUQiQGH]$EDVFDO 

La recuperacin de la homeostasis. Es otra funcin intra personal con cierta rele-


vancia. Se podra proponer que alguna emocin positiva, como la alegra, podra
funcionar como una forma de mecanismo para retornar a los valores caractersti-
cos de la homeostasis despus de la separacin importante ocurrida con las emo-
FLRQHVQHJDWLYDV'HKHFKRHQXQHVWXGLRUHDOL]DGRSRU)UHGULFNVRQ\/HYHQVRQ
 VHSXGRDSUHFLDUGLFKDIXQFLyQ$VtWUDVSURYRFDUODHPRFLyQGHWULVWH]D
en un grupo experimental de personas, administraban estmulos que tenan que ver
con la diversin y con la alegra. Aquellas personas que sonrean al observar los
HVWtPXORVUHFXSHUDEDQDQWHVORVYDORUHVEDVDOHVGHODYDULDEOHPHGLGD DFWLYDFLyQ

/RVSDUiPHWURVGHfrecuencia, intensidad y duracinVRQLPSUHVFLQGLEOHVSDUDHQWHQGHUHOIXQFLRQDPLHQWRKRPHRVWiWLFR


GHFXDOTXLHURUJDQLVPRDVtFRPRGHFXDOHVTXLHUDVLVWHPDVRSDUiPHWURVTXHIRUPDQSDUWHGHGLFKRRUJDQLVPR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 145 Manual de teoras emocionales y motivacionales - UJI
FDUGLDFD TXHDTXHOODVRWUDVSHUVRQDVTXHQROOHJDURQDVRQUHtU(VGHFLUFRPR
VHxDOD/HYHQVRQHVPX\SUREDEOHTXHODHPRFLyQGHDOHJUtDIXQFLRQHFRPRXQD
VXHUWHGHFRUWRFLUFXLWRTXHURPSHODWHQGHQFLDDOGHVSOD]DPLHQWRH[FHVLYRGHVGH
OD]RQDySWLPDKRPHRVWiWLFDGHODYDULDEOHHVWXGLDGDFXDQGRRFXUUHXQDHPRFLyQ
negativa. Se podra sugerir que el ser humano dispone de una herramienta impor-
tante para contrarrestar los eventuales efectos negativos asociados a la ocurrencia
sostenida de las emociones negativas.

/DFRPELQDFLyQGHHVWDVGRVIXQFLRQHVUHVHxDGDVSHUPLWLUtDSURSRQHUODH[LVWHQFLD
de una simetra emocional. Si bien las emociones negativas permiten esa funcin
relevante relacionada con la preparacin del organismo para ofrecer una respuesta
intensa mediante la prdida amplia de la homeostasis, la emocin positiva per-
PLWLUtD OD UHFXSHUDFLyQ UiSLGD GH OD KRPHRVWDVLV (Q HVWH PDUFR GH UHIHUHQFLD
&DUVWHQVHQ*RWWPDQ\/HYHQVRQ  KDQFRQUPDGRODKLSyWHVLVGHODVLPH-
tra emocional estudiando relaciones matrimoniales, pues han podido comprobar
cmo, tras la generacin de una situacin de ira, la recuperacin de la activacin
VLROyJLFDHUDPiVUiSLGDFXDQGRORVFRQWHQGLHQWHVLQWURGXFtDQHODIHFWRSRVLWLYR
en este caso con connotaciones sexuales.

(OFDPELRHQODMHUDUTXtDFRJQLWLYD\FRQGXFWXDO. Parece que las emociones jue-


JDQXQSDSHOLPSRUWDQWHDODKRUDGHHVWDEOHFHUODMHUDUTXtDGHODVUHVSXHVWDVPiV
probables. Es como si en un momento dado la ocurrencia de una emocin oca-
VLRQDUDXQFRODSVRHQWRGDVODVDFWLYLGDGHVTXHHOLQGLYLGXRHVWiOOHYDQGRDFDER
UHRUJDQL]DQGRODVUHVSXHVWDVHQRUGHQGHSULRULGDGSDUDVROXFLRQDUHOSUREOHPD
RODVLWXDFLyQDODTXHVHHQIUHQWDHVHLQGLYLGXR/DHPRFLyQWHQGUtDODIXQFLyQ
LPSRUWDQWHGHUHRUJDQL]DUODVHYHQWXDOHVUHVSXHVWDVTXHSXHGHOOHYDUDFDERGLFKR
individuo. No obstante, aunque existe una tendencia a proponer que las emociones
WLHQHQ FRQQRWDFLRQHV GHVRUJDQL]DGRUDV VH SXHGH GHIHQGHU TXH ODV GRV SRVWXUDV
son correctas, ya que, si bien es cierto que la ocurrencia de una emocin interrum-
pe cualquier actividad conductual motora y cognitiva en curso, con lo cual podra
GHFLUVHTXHODVHPRFLRQHVGHVRUJDQL]DQODFRQGXFWDQRHVPHQRVFLHUWRTXHHVDGHV-
RUJDQL]DFLyQSURGXFLGDORHVDH[SHQVDVGHRWUDIRUPDGHRUJDQL]DFLyQPiVEiVLFD\
PiVSULPLWLYDUHODFLRQDGDFRQODVXSHUYLYHQFLD\ODDGDSWDFLyQFRQORTXHGHVGH
HVWDRWUDSHUVSHFWLYDODVHPRFLRQHVSXHGHQVHUFRQVLGHUDGDVFRPRRUJDQL]DGRUDV
de una forma concreta de conducta.

La motivacin. En ocasiones se propone que las emociones pueden funcionar


como motivadores esenciales. Sin negar de frente esta funcin, sugerimos que ese
papel motivador de las emociones podra ser discutible. En efecto, si las emocio-
nes se encuentran asociadas a la prdida o al fracaso en la consecucin, a la con-
secucin o al mantenimiento, de unos objetivos, lo que motiva a un individuo es
el objetivo en s. No se lucha por conseguir un objetivo atendiendo a la emocin o
DIHFWRSRVLWLYRTXHUHSRUWDUiXQDYH]FRQVHJXLGRVHOXFKDSRUFRQVHJXLUHOREMHWL-
vo, por el valor que posee en s mismo ese objetivo. No obstante, tambin es cierto
que, en ocasiones, la sola obtencin de afecto positivo, emocin, placer, puede ser
ORVXFLHQWHPHQWHLQFHQWLYDGRUDFRPRSDUDGHVDUUROODUXQDFRQGXFWDPRWLYDFLRQDO
dirigida a la meta, no por la meta en s misma, sino por las consecuencias hednicas

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 146 Manual de teoras emocionales y motivacionales - UJI
asociadas a dicha meta. Esa dimensin afectiva placentera posee connotaciones
subjetivas, por lo que es el sentimiento la variable emocional relacionada con la
IXQFLyQPRWLYDGRUDGHODVHPRFLRQHV$OUHVSHFWRH[LVWHXQDGLFXOWDGLPSRUWDQ-
te a la hora de explicar con palabras la experiencia subjetiva: se tiene consciencia
de un sentimiento, por lo tanto se sabe de su existencia y de su cualidad, otra cosa
es describir el tipo de sentimiento. Sin embargo hay un hecho relevante, y es el que
VHUHHUHDODVIXQFLRQHVTXHSXHGHGHVHPSHxDU

En este marco terico, la emocin, particularmente la dimensin subjetiva de la


misma, o sentimiento, cumple la funcin de avisar de la situacin existente, cola-
ERUDQGRHQODSXHVWDHQPDUFKDGHFRQGXFWDVYROXQWDULDVDGDSWDWLYDV2WUDIXQFLyQ
relevante de la dimensin subjetiva de la emocin tiene que ver con la implica-
FLyQHQORVSURFHVRVGHDSUHQGL]DMH&RQFUHWDPHQWHHQHOiPELWRGHOFRQGLFLRQD-
miento operante, la experiencia emocional placentera puede ser considerada como
XQDIRUPDGHUHIXHU]RSRVLWLYRLQFUHPHQWDQGRODSUREDELOLGDGGHTXHVHUHSLWDOD
conducta que dio lugar a esa experiencia emocional. Por su parte, la experiencia
emocional displacentera o aversiva puede ser considerada como una forma de cas-
tigo positivo, incrementando la probabilidad de que se eviten las conductas que
OOHYDQDHVDH[SHULHQFLD(QHOiPELWRGHOFRQGLFLRQDPLHQWRFOiVLFRWDPELpQHV
IiFLOPHQWHFRPSUHQVLEOHFyPRODH[SHULHQFLDHPRFLRQDOSRVLWLYDRQHJDWLYDTXH
puede ser considerada como la respuesta incondicionada a los estmulos incondi-
cionados que de forma natural la elicitan, puede aparecer de forma condicionada tras
la ocurrencia de un estmulo que, aunque no tiene la capacidad incondicionada para
elicitarla, en algn momento pasado result asociado al estmulo incondicionado.
(VUHODWLYDPHQWHIiFLOODRFXUUHQFLDGHOFRQGLFLRQDPLHQWRFOiVLFRGHODH[SHULHQFLD
emocional.5

As pues, hemos visto cmo, desde un punto de vista intra personal, y de forma
genrica, las emociones cumplen la funcin de interrumpir cualquier actividad
HQFXUVRHMHUFLHQGRXQDVHOHFFLyQSULRULWDULDGHODVDFWLYLGDGHVDUHDOL]DU\GHODV
metas a conseguir.

Sin embargo, es un hecho evidente que las emociones tambin tienen una clara
repercusin sobre los restantes elementos del medio ambiente externo en el que
se desenvuelve un individuo. De forma concreta, las emociones se encuentran im-
plicadas en la regulacin de la distancia existente entre personas en un grupo o en
una relacin. Es decir, existe una clara conexin entre las emociones y el ambiente
VRFLDO6LJXLHQGRODVSURSXHVWDVGH.HOWQHU\+DLGW  VHSXHGHVXJHULUTXH
las funciones de las emociones en la dimensin social, interpersonal, ambiental,
HWFSXHGHQPDQLIHVWDUVHHQFXDWURSODQRVLQGLYLGXDO VHUtDODIXQFLyQLQWUDSHU-
VRQDODODTXHQRVDFDEDPRVGHUHIHULU GLiGLFR FRQIRUPDGRSRUGRVSHUVRQDV 
JUXSDO UHIHULGRDXQFRQMXQWRGHSHUVRQDVTXHLQWHUDFW~DQGHXQDIRUPDVRVWHQLGD
DORODUJRGHXQFLHUWRWLHPSR \FXOWXUDO TXHWLHQHTXHYHUFRQODLQWHUDFFLyQTXH
se establece entre los miembros de un gran grupo que comparte creencias, valores,
QRUPDV\PRGHORVVRFLDOHV /DVDVXQFLRQHVEiVLFDVTXHLPSUHJQDQODH[SOLFDFLyQ

5HFXpUGHVHHOFDVRGH$OEHUWR\HOFRQGLFLRQDPLHQWRGHODH[SHULHQFLDGHPLHGRSRUSDUWHGH:DWVRQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 147 Manual de teoras emocionales y motivacionales - UJI
GHODVIXQFLRQHVTXHWLHQHQODVHPRFLRQHVHQIDWL]DQTXHHVWRVSURFHVRVVRQUHV-
SXHVWDVUiSLGDVLQYROXQWDULDV\DXWRPiWLFDVTXHD\XGDQDODVSHUVRQDVDUHJXODU
usar y mantener diferentes relaciones sociales. Dicho de otra forma: las emociones
representan formas concretas de coordinar las interacciones y relaciones sociales con
HOREMHWLYRGHVXSULPLURPLQLPL]DUORVSUREOHPDVGHULYDGRVGHODSURSLDLQWHUDFFLyQ
una interaccin social que es cambiante y, en ocasiones, imprevisible.

En el plano didico, lo relevante es establecer el papel de las emociones en la


RUJDQL]DFLyQGHODVUHODFLRQHVVLJQLFDWLYDV(QHVWHFDVRHOVLVWHPDVREUHHOTXH
UHSHUFXWHQ ODV HPRFLRQHV HV OD LQWHUDFFLyQ GLiGLFD &RPR HV HYLGHQWH HQ HVWH
plano adquieren una especial relevancia todas las manifestaciones externas de la
HPRFLyQWDOHVFRPRORVJHVWRVODVH[SUHVLRQHVODVSDODEUDVHWF/DVIXQFLRQHV
SURSXHVWDVHQHVWHSODQRVHUHHUHQDORVVLJXLHQWHVDVSHFWRVHQSULPHUOXJDUOD
expresin de las emociones ayuda a los individuos a conocer las emociones, las
FUHHQFLDV\ODVLQWHQFLRQHVGHODRWUDSHUVRQDFRQTXLHQPDQWLHQHODUHODFLyQGLi-
GLFD(VGHFLUODIXQFLyQGHODVHPRFLRQHVWHQGUtDTXHYHUFRQODFRRUGLQDFLyQUi-
pida de las interacciones sociales. Con la manifestacin externa de las emociones
se transmite informacin del estado interno de quien expresa a quien percibe tales
PDQLIHVWDFLRQHV(VDLQIRUPDFLyQSHUPLWHLQIHULUODHYHQWXDOHPRFLyQPRPHQWi-
nea, las intenciones, la intencin respecto a la propia relacin, etc. Incluso, en este
WLSRGHIXQFLyQGHODVHPRFLRQHVFDEHKDEODUGHODSUHQGL]DMHGHODVLJQLFDFLyQ
de eventos nuevos o ambiguos, tal como ocurre en las relaciones entre un padre
y su hija ante la presencia de un estmulo que conoce el padre pero no la hija. En
HVWRVFDVRVODKLMDDSUHQGHODVLJQLFDFLyQLQFOXVRODH[SUHVLyQGHFLHUWDVSDXWDV
concretas, a partir de la observacin de lo que expresa el padre al percibir el est-
mulo. Relacionado con el aspecto que acabamos de comentar, en segundo lugar,
RWUDIXQFLyQGHODH[SUHVLyQGHODVHPRFLRQHVHQHOSODQRGLiGLFRWLHQHTXHYHU
FRQHODSUHQGL]DMHGHSDXWDVVRFLDOHV3RUHMHPSORODVRQULVDWDQWRGDVLHVWDHV
HVSRQWiQHDRQJLGDFXPSOHXQDIXQFLyQUHOHYDQWHHQODVRFLHGDG\DTXHFRQ
ODH[FHSFLyQGHODVVLWXDFLRQHVSDUWLFXODUHVHVSHFLDOPHQWHQRSURSLFLDVVXDYL]D\
KDFHXLGDODUHODFLyQLQWHUSHUVRQDO6HDSUHQGHTXHODVRQULVDWLHQHHVDHVSHFLDO
IXQFLyQ GHO PLVPR PRGR TXH VH DSUHQGH TXH FXDQGR VH UHDOL]D XQD FRQGXFWD
VRFLDOPHQWHFRUUHFWDORVGHPiVPXHVWUDQWDPELpQODVRQULVDFRQORFXDOVHHVWD-
blece una asociacin entre esta forma caracterstica de expresin emocional y la
conducta y objetivos socialmente aceptables. En tercer lugar, esta comunicacin
emocional en forma de manifestaciones externas es el primer paso en un proceso
de feedback o retroaccin, dando lugar a la respuesta expresiva de quien percibi
tales manifestaciones. Es decir, se produce una funcin consistente en el desenca-
denamiento de emociones recprocas y/o complementarias en la otra persona. Por
ejemplo, la manifestacin de ira puede provocar en la otra persona la experiencia
y/o manifestacin de miedo, o de ira, dependiendo de las circunstancias particula-
res de ese momento.

En el plano social, lo habitual es establecer cmo las emociones ayudan a los


pequeos colectivos en las distintas y frecuentes interacciones que los miembros de
ese colectivo llevan a cabo. En este caso, el sistema sobre el que repercuten las
IXQFLRQHVGHODVHPRFLRQHVHVXQJUXSRPiVRPHQRVUHGXFLGRFRPRODIDPLOLD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 148 Manual de teoras emocionales y motivacionales - UJI
un equipo de trabajo, un club, una asociacin, etc. Estos distintos colectivos com-
SDUWHQFLHUWDVFDUDFWHUtVWLFDVWDOHVFRPRODLGHQWLGDGODVDQLGDGHVODVPHWDVORV
REMHWLYRVHWF'HQXHYRHQHVWHSODQRODUHOHYDQFLDVHORFDOL]DHQODVPDQLIHVWD-
ciones externas, tanto en el ambiente natural, como en los ambientes especialmen-
te diseados en el laboratorio o fuera de l. Una de las funciones importantes de las
HPRFLRQHVHQHOSODQRVRFLDOWLHQHTXHYHUFRQODLGHQWLFDFLyQGHODSHUWHQHQFLD
RODLGHQWLGDGGHORVGLVWLQWRVPLHPEURVTXHFRQJXUDQHVHFROHFWLYRDODYH]TXH
HQFRQWUDSDUWLGDVLUYHQWDPELpQSDUDGHOLPLWDUODVIURQWHUDVGHORSURSLRUHFKD]DQ-
GRORDMHQR'HKHFKRHQHVWDGLPHQVLyQRSODQRVHSXHGHQORFDOL]DUODVIXQFLRQHV
de cohesin social y solidaridad que tienen muchas emociones, as como la fun-
cin del agrupamiento colectivo para oponerse a determinados agentes que tratan
GHGHVHVWDELOL]DUGLFKDFRKHVLyQ

En el plano cultural, se ha intentado establecer cmo las emociones se encuentran


moldeadas por la relevancia de los factores histricos y econmicos; cmo las
HPRFLRQHV VH HQFXHQWUDQ LPSUHJQDGDV SRU ODV LQXHQFLDV VRFLDOHV \ FXOWXUDOHV
FyPR HQ Q ODV QRUPDV FXOWXUDOHV FRQGLFLRQDQ GH PDQHUD LPSRUWDQWH OD H[SH-
riencia y la expresin de las emociones. En este plano, el sistema sobre el que
repercuten las funciones de las emociones es la propia cultura, entendida esta en la
dimensin referida a grandes grupos, sociedades, pases, naciones y agrupaciones
de naciones, ya que es desde esa cultura desde la que se interpretan las distintas
manifestaciones emocionales emitidas por los miembros que forman parte de ella.
(QHOSODQRFXOWXUDOODUHOHYDQFLDVHORFDOL]DHQODLQWHUSUHWDFLyQGHODVPDQLIHVWD-
ciones externas, tanto las que se producen de manera verbal, como las que ocurren
GHIRUPDFRQGXFWXDOPRWRUDDELHUWD(QFXDQWRDODVIXQFLRQHVHVSHFtFDVGHODV
emociones en este plano cultural, se ha propuesto que juegan un papel crtico en
los procesos mediante los cuales los individuos asumen la identidad cultural. De
forma particular, se ha podido constatar cmo las emociones se encuentran inser-
WDVHQORVSURSLRVSURFHVRVGHVRFLDOL]DFLyQFRQWULEX\HQGRGHPDQHUDQRWDEOHD
que los nios aprendan las normas y los valores sociales. As, las manifestaciones
emocionales de los padres, junto con las de aquellas otras personas que ostentan
la autoridad social, son un buen ejemplo del modo mediante el que las emociones
HMHUFHQVXLQXHQFLDHQHODSUHQGL]DMHGHSDXWDVGHFRQGXFWDDMXVWDGDVDODVQRU-
mas y los valores de esa cultura.

(QGHQLWLYDGHVGHXQSXQWRGHYLVWDLQWHUSHUVRQDOSRGHPRVSODQWHDUTXHODVIXQ-
ciones de las emociones tienen que ver con la solucin de los problemas que se le
SUHVHQWDQDXQDSHUVRQD/DVHPRFLRQHVVHSURGXFHQHQODLQWHUDFFLyQTXHXQDSHU-
sona establece con su medio ambiente externo, considerando que este se encuentra
HQFRQWLQXRFDPELR3HURDGHPiVODVHPRFLRQHVFXPSOHQHOLPSRUWDQWHSDSHOGH
representar un cdigo de informacin que es compartido por los individuos que
forman parte de un grupo o sociedad, posibilitando el conocimiento de los estados
internos a travs de las distintas manifestaciones externas.

As pues, las emociones, consideradas como respuestas adaptativas, lo son porque se


encuentran implicadas en todas aquellas situaciones que suponen un peligro, ame-
QD]DHWFSDUDHORUJDQLVPRHQWHQGLGRHVWHSHOLJURRDPHQD]DFRPRXQDIRUPDGH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 149 Manual de teoras emocionales y motivacionales - UJI
SRVLEOHGHVHTXLOLEULRRGHVHVWDELOL]DFLyQ(OSHOLJURSHUFLELGRODDPHQD]DGHGHV-
equilibrio, que puede ser real o imaginaria, puede estar relacionada con la dimensin
biolgica o fsica del organismo, pero tambin puede tener vinculaciones con la di-
mensin psquica o social. En cualquiera de los casos, cuando el resultado de la valo-
UDFLyQWLHQHFRQQRWDFLRQHVVLJQLFDWLYDVSDUDXQDSHUVRQDVHSURGXFHODRFXUUHQFLD
de una emocin, con lo cual el organismo experimenta la dimensin subjetiva de
la misma,DFWLYDQGRODVFRUUHVSRQGLHQWHVUHVSXHVWDVVLROyJLFDV\H[SUHVDQGRODV
caractersticas distintivas de esa emocin.

5.5. El proceso de la emocin


Consideramos que la emocin es un proceso adaptativo en el que resulta impres-
cindible tener en cuenta la existencia de diversos componentes. Incluso el feno-
PHQyORJRPiVHQWXVLDVWDWHQGUtDTXHUHFRQRFHUTXHHOVHQWLPLHQWRTXHGHQRWDOD
experiencia de una emocin posee correlatos objetivos, tales como las respues-
WDVSVLFRVLROyJLFDVODVPDQLIHVWDFLRQHVH[SUHVLYDV\ODVFRQGXFWDVPRWRUDV/D
emocin, como proceso que es, implica dinamismo. Es un dinamismo funcional,
orientado a la adaptacin del organismo a las condiciones cambiantes del medio
DPELHQWH/DVHFXHQFLDGHOSURFHVRHPRFLRQDOVHUtDODVLJXLHQWHHVWtPXORSHUFHS-
FLyQHYDOXDFLyQYDORUDFLyQVHQWLPLHQWRUHVSXHVWDVLROyJLFDRUH[LVH[SUHVLyQ
3DOPHUR 

Ocurrencia o aparicin del estmulo. Se requiere la presencia de un estmulo que


VHDFDSD]GHGHVHQFDGHQDUHOSURFHVRGHXQDHPRFLyQ(OHVWtPXORSXHGHVHUH[-
terno o interno, y puede estar presente en el ambiente fsico del sujeto o puede no
HVWDUSUHVHQWHUHULpQGRVHHQHVWH~OWLPRFDVRDXQUHFXHUGR(VWRHVHOHVWtPXOR
puede ser actual o pasado. Por otra parte, el estmulo puede no ser real, y consistir
VRORHQXQDGLVWRUVLyQSHUFHSWLYDDOXFLQDFLyQHWFGHOVXMHWR$GHPiVHOHVWtPX-
lo puede no ser percibido conscientemente, esto es, puede ocurrir que la intensidad
o la duracin del estmulo provoquen en el sujeto una activacin que no supere el
XPEUDOGHODFRQVFLHQFLD(QHVWRVFDVRVFRPRVHxDOiEDPRVHQHOSURFHVRPRWL-
vacional, el sujeto no tiene conocimiento de haber recibido esa estimulacin, pero
dicho estmulo ha sido procesado. En cualquiera de las posibilidades, el estmulo
ha de tener capacidad para desencadenar el proceso emocional. Dicha capacidad
SXHGHVHULQQDWDRSXHGHKDEHUVLGRFRQVROLGDGDDSDUWLUGHSURFHVRVGHDSUHQGL]D-
MHORFDOL]DGRVHQODH[SHULHQFLDGHOVXMHWR+D\HVWtPXORVFRQXQDFDSDFLGDGLQKH
rente para desencadenar procesos emocionales particulares en todos los sujetos,
mientras que otros estmulos, que en principio no poseen esa capacidad, la han
adquirido a partir de la experiencia particular de un sujeto.

El estmulo es una variable imprescindible y necesaria para que se inicie el pro-


FHVRHPRFLRQDO6LQHPEDUJRQRHVXQDYDULDEOHVXFLHQWHSXHVVHUHTXLHUHOD

'HPDQHUDJHQpULFDKDEODPRVGHOSURFHVRHPRFLRQDOTXHRFXUUHGHIRUPDFRQVFLHQWHDXQTXHFRPRSRVWHULRUPHQWH
veremos en el apartado correspondiente al proceso emocional, cabe la posibilidad de que se desencadene un proceso emo-
cional sin que la persona llegue a experimentar la dimensin subjetiva de ese proceso; esto es, cabe la posibilidad de que el
proceso emocional se inicie por debajo de los umbrales de la consciencia.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 150 Manual de teoras emocionales y motivacionales - UJI
H[LVWHQFLDGHXQDHYHQWXDOSHUFHSFLyQ\GHXQDHYDOXDFLyQYDORUDFLyQTXHFRQHUD
al estmulo las connotaciones de agente potencialmente desestabilizador.

Percepcin del estmulo. Tambin es un aspecto fundamental, ya que, si no se pro-


duce la percepcin de un estmulo, el sujeto no adquiere conocimiento acerca de
la existencia de un evento o situacin con ciertas connotaciones de desequilibrio
o peligro, con lo cual el proceso no se inicia. El proceso de percepcin implica la
H[LVWHQFLDGHXQHVWtPXOR\ODGLVSRQLELOLGDGIXQFLRQDOGHUHFHSWRUHVHVSHFtFD-
mente relacionados con el estmulo en cuestin.

La percepcin puede ocurrir de dos modos: conscientemente y no conscientemente.


En la percepcin consciente el sujeto se da cuenta de la presencia de un estmulo
TXHSRUVXVFDUDFWHUtVWLFDVSDUWLFXODUHVSRVHHODVXFLHQWHVDOLHQFLDSDUDFDSWDUVX
atencin. En estos casos, la estimulacin es procesada hasta que el sujeto es capaz de
DGTXLULUWRGDODLQIRUPDFLyQRODVXFLHQWHLQIRUPDFLyQSDUDFRQRFHUODVFDUDFWHUtV-
WLFDVGHOHVWtPXORHQFXHVWLyQ(QODSHUFHSFLyQFRQVFLHQWHVHSURGXFHODLQXHQFLD
de variables cognitivas, como las creencias, los juicios, etc., que el sujeto posee
DFHUFDGHOHVWtPXORHQFXHVWLyQ7DPELpQHMHUFHQXQDLQXHQFLDQRWDEOHODSURSLD
biologa del organismo y el estado afectivo actual del sujeto en esos momentos,
pues, dependiendo de ambas variables, cabr la posibilidad de que ocurra un in-
cremento o una disminucin en la sensibilizacin del individuo hacia cierto tipo de
estmulos; es decir, se producir un incremento o una reduccin del umbral para la
percepcin de cierto tipo de estmulos. La accin integrada de estos tres tipos de
YDULDEOHVFRQJXUDXQDHVSHFLHGHOWURTXHPRGXODODSHUFHSFLyQ

Figura 1. El proceso emocional

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 151 Manual de teoras emocionales y motivacionales - UJI
(Q OD SHUFHSFLyQ QR FRQVFLHQWH HO HVWtPXOR QR SRVHH OD VXFLHQWH VDOLHQFLD HQ
LQWHQVLGDGRHQGXUDFLyQ SDUDFDSWDUODDWHQFLyQFRQVFLHQWHGHOVXMHWRSHURVtTXH
se produce un cierto procesamiento de la estimulacin. Este procesamiento tam-
SRFRDOFDQ]DORVXPEUDOHVGHODFRQVFLHQFLDGHOVXMHWRDXQTXHSXHGHGDUOXJDUD
ORVVLJXLHQWHVSDVRVGHOSURFHVRHPRFLRQDO/DSHUFHSFLyQQRFRQVFLHQWHQRVROR
ocurre cuando el estmulo es de escasa saliencia. Puede suceder tambin que la
DSDULFLyQ GH XQ HVWtPXOR HVSHFLDOPHQWH LPSRUWDQWH SDUD HO VXMHWR SURGX]FD XQD
SHUFHSFLyQUiSLGD\DXWRPiWLFDHQHVWHVLQTXHKD\DFRQVFLHQFLDGHODPLVPD(Q
HVWRVFDVRVHOSURFHVDPLHQWRGHODHVWLPXODFLyQWDPSRFRDOFDQ]DORVXPEUDOHVGH
la consciencia del sujeto, pero s que puede activar los subsiguientes pasos del pro-
ceso emocional, pues el estmulo exige una respuesta inmediata del sujeto. En la
SHUFHSFLyQQRFRQVFLHQWHWDPELpQLQX\HHOOWURDOTXHQRVDFDEDPRVGHUHIHULU
HMHUFLHQGRVXHIHFWRHQHOiPELWRGHODVSUHIHUHQFLDVGHHVHLQGLYLGXR

/DSHUFHSFLyQHVXQDYDULDEOHLPSUHVFLQGLEOH\QHFHVDULDSDUDTXHRFXUUDHOSURFH-
VRHPRFLRQDO7DPSRFRHVXQDYDULDEOHVXFLHQWHSXHVVHUHTXLHUHODH[LVWHQFLDGH
un estmulo susceptible de ser percibido, y de una evaluacin-valoracin que haga
SHQVDUDOVXMHWRRTXHKDJDGHFLGLUDORUJDQLVPRTXHGLFKRHVWtPXORHVFDSD]GH
SURGXFLUOHGHVHVWDELOL]DFLyQ

(YDOXDFLyQ\YDORUDFLyQ. Es un paso necesario en el proceso emocional. Por de-


QLFLyQLPSOLFDODH[LVWHQFLDGHXQHVWtPXOR\GHXQRVUHFHSWRUHVHVSHFLDOL]DGRV
capaces de captar dicho estmulo, dando lugar a la percepcin. Es el paso previo
DODH[SHULHQFLDGHXQDHPRFLyQ\DTXHGHSHQGLHQGRGHFXiOVHDHVWHSURFHVRGH
HYDOXDFLyQ\YDORUDFLyQHOVXMHWRH[SHULPHQWDUiXQDHPRFLyQXRWUDRQLQJXQD

Dentro del proceso emocional, el subproceso de evaluacin-valoracin puede ocu-


rrir de forma consciente y de forma no consciente. En ambas posibilidades, la
HYDOXDFLyQYDORUDFLyQVHUHHUHDODLQWHUSUHWDFLyQFRPSOHWDRORPiVFRPSOHWD
SRVLEOH HYDOXDFLyQ \DODHVWLPDFLyQGHODUHSHUFXVLyQSHUVRQDO YDORUDFLyQ GHO
estmulo.

3RUORTXHUHVSHFWDDODRFXUUHQFLDFRQVFLHQWHWLHQHFRQQRWDFLRQHVKRPHRVWiWLFDV
El sujeto lleva a cabo una secuencia de pasos conducentes al descubrimiento de to-
das las peculiaridades del estmulo, de las connotaciones situacionales que posee,
de la implicacin subjetiva del sujeto en esa situacin, de las repercusiones que
el estmulo puede tener sobre la integridad, equilibrio y bienestar personales, de
las posibilidades de solucin sobre la base de la experiencia y conocimientos del
VXMHWRHWF(Q~OWLPDLQVWDQFLDODFRPELQDFLyQGHWRGDVHVWDVYDULDEOHVOOHYDUiDOD
YDORUDFLyQTXHHOVXMHWRUHDOL]DGHOHVWtPXORRVLWXDFLyQ/DYDORUDFLyQVHUHDOL]D
HQSULPHUOXJDUHQWpUPLQRVGHEHQHFLRRSHUMXLFLRSDUDHOVXMHWRHQVHJXQGR
OXJDUHQWpUPLQRVGHHVSHFLFLGDGGHOEHQHFLRRSHUMXLFLRHQWHUFHUOXJDUHQ
trminos de probabilidad subjetiva de controlar la situacin, bien para no perder la
HVWDELOLGDGELHQSDUDUHFXSHUDUODHQHOPHQRUWLHPSRSRVLEOH/DVYDULDEOHVFRJQL-
WLYDVTXHLQXtDQHQHOPRPHQWRGHODSHUFHSFLyQWDPELpQLQX\HQGHIRUPDDSUH-
FLDEOHHQODHYDOXDFLyQYDORUDFLyQKDFLHQGRTXHVHSURGX]FDXQVHVJRSDUWLFXODU
HQHOPRGRGHOOHYDUDFDERHODQiOLVLVGHOHVWtPXOR\ODVUHSHUFXVLRQHVGHOPLVPR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 152 Manual de teoras emocionales y motivacionales - UJI
sobre la integridad del sujeto. Del mismo modo, tambin las variables biolgicas
\HOHVWDGRDIHFWLYRDFWXDOHMHUFHQXQDLQXHQFLDQRWDEOHVREUHHOVXESURFHVRGH
HYDOXDFLyQYDORUDFLyQLQFUHPHQWDQGRRUHGXFLHQGRODXLGH]GHSURFHVDPLHQWR
de los estmulos. En cualquier caso, toda la estimulacin que llega al individuo,
VHDHVWHFRQVFLHQWHRQRGHODPLVPDUHVXOWDUiafectivamente impregnada por el
afecto actual de dicho individuo. Como consecuencia de la evaluacin-valoracin
FRQVFLHQWH VH SURGXFH OD H[SHULHQFLD VXEMHWLYD GH OD HPRFLyQ VHQWLPLHQWR  VH
SURGXFHXQDUHVSXHVWDVLROyJLFDFRQJUXHQWHFRQODHPRFLyQTXHHOVXMHWRH[SHUL-
menta, y se puede producir, por una parte, una posible expresin emocional, y, por
otra, una suerte de orexis, bajo la forma de deseos y tendencias de accin, que es
la causa inmediata de una eventual conducta posterior.

Por lo que respecta a la ocurrencia no consciente, esto es, cuando el subproceso


GHHYDOXDFLyQYDORUDFLyQQRDOFDQ]DHOXPEUDOGHODFRQVFLHQFLDWDPELpQWLHQH
FRQQRWDFLRQHV KRPHRVWiWLFDV DXQTXH HQ HVWH FDVR FRQ FDUiFWHU DXWRPiWLFR (Q
esta situacin, el organismo reacciona de forma defensiva ante un estmulo que es
UiSLGDPHQWHFRQVLGHUDGRFRPRXQDSRVLELOLGDGGHGHVHVWDELOL]DFLyQ3RGUtDDUJXPHQ-
tarse que, en estas circunstancias, lo verdaderamente relevante son las connotaciones
JHQpWLFDVLQQDWDVLQVWLQWLYDV/DUHVSXHVWDGHORUJDQLVPRFRQFDUDFWHUtVWLFDV-
siolgicas, e incluso conductuales motoras, asociadas a la emocin concreta que
VHHVWiGHVHQFDGHQDQGRHQHVRVPRPHQWRVWLHQHFRPRREMHWLYRUHGXFLUODSUREDEL-
lidad de un dao o desequilibrio, reaccionando cuanto antes para superar la situacin,
\DTXHXQDGHPRUDHQODUHVSXHVWDSRULQVLJQLFDQWHTXHVHDHOWLHPSRGHGLFKD
demora, puede llegar a ser crucial en la supervivencia de un organismo. No obs-
tante, estando, en general, de acuerdo con este planteamiento, nos gustara sugerir
RWUDSRVLELOLGDG3RGUtDRFXUULUWDPELpQTXHHVDUHVSXHVWDVLROyJLFDTXHRIUHFHHO
organismo ante una situacin en la que la percepcin y la valoracin ocurren por
debajo de los umbrales de la consciencia tuviese connotaciones no emocionales.
En este caso, el organismo responde de un modo indiferenciado, siendo la respues-
WDVLROyJLFDODSULPHUDTXHVHSURGXFHSRUTXHRQWRJHQpWLFD\ORJHQpWLFDPHQWH
HVODPiVEiVLFD\SULPLWLYDHQVLWXDFLRQHVGHHPHUJHQFLD(QHVWDSRVLELOLGDGQR
FRQVFLHQWHGHHYDOXDFLyQYDORUDFLyQQRVHSURGXFHXQDQiOLVLVHLQWHUSUHWDFLyQQRV
GHODVFDUDFWHUtVWLFDVGHOHVWtPXORQLVHSURGXFHXQDQiOLVLVSDUWLFXODUL]DGRGHODUHSHU-
FXVLyQGHOHVWtPXORVREUHHOVXMHWR/RYHUGDGHUDPHQWHLPSRUWDQWHHQHVWDIRUPDGH
HYDOXDFLyQYDORUDFLyQHVHODMXVWHGHOHVWtPXORDODFDWHJRUtDGHDPHQD]DQWHRQR
DPHQD]DQWH/DVGRVSRVLEOHVFRQFOXVLRQHVVRQQRRVt6LODFRQFOXVLyQHV
QRQRVHSURGXFHODUHVSXHVWDVLROyJLFD6LODFRQFOXVLyQHVVtVHSURGXFH
una respuesta indiferenciada y global del organismo como un todo, siendo las
PDQLIHVWDFLRQHVVLROyJLFDVH[WHUQDV FRQGXFWDPRWRUDJHVWRVH[SUHVLRQHV DVt
FRPRODVPDQLIHVWDFLRQHVVLROyJLFDVLQWHUQDV DFWLYDFLyQGHORVVLVWHPDVVLPSi-
WLFRDGUHQRPHGXODU\DGHQRKLSRVDULRDGUHQRFRUWLFDO ODFRQVWDWDFLyQHPStULFD
de esa respuesta o reaccin primaria de defensa. Dicha respuesta, que puede ser
PiVRPHQRVGLIXVDKDFHTXHHOVXMHWRSHUFLEDODRFXUUHQFLDGHFLHUWRVFDPELRVHQ
su organismo, con lo cual emprende un nuevo proceso de evaluacin-valoracin,

/H'RX[ D HVTXLHQPHMRUKDSHUODGRHVWHWLSRGHUHVSXHVWDUiSLGDHLQPHGLDWDDGDSWDWLYD\IXQFLRQDO


SURSRQLHQGROD\DFOiVLFDYtDFRUWDRYtDUiSLGDHQODUHVSXHVWDHPRFLRQDOORFXDOHQWUHRWUDVFRVDVKDGDGROXJDUD
TXHVHGHHQGDXQDFLHUWDLQGHSHQGHQFLDHQWUHODUHVSXHVWDVLROyJLFDHPRFLRQDO\ODFRQVFLHQFLDGHODHPRFLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 153 Manual de teoras emocionales y motivacionales - UJI
DKRUDGHIRUPDFRQVFLHQWHFRQVLGHUDQGRODSURSLDUHVSXHVWDVLROyJLFD\WUDWDQ-
GRGHORFDOL]DUHOSRVLEOHHVWtPXORTXHODSURYRFy6LVHORFDOL]DGLFKRHVWtPXOR
HQHVHPRPHQWRVHWLHQHQHQFXHQWDORVPLVPRVSDUiPHWURVUHIHULGRVDOKDEODUGHO
VXESURFHVRGHHYDOXDFLyQYDORUDFLyQFRQVFLHQWH(OUHVXOWDGRGHQXHYRVHUiHOVHQ-
WLPLHQWRGHXQDHPRFLyQODUHVSXHVWDVLROyJLFDUHODFLRQDGDFRQHVDHPRFLyQ\ORV
eventuales deseos y tendencias de accin.

Sin embargo, cabe la posibilidad de que el estmulo que, de forma no consciente,


SURYRFyODVUHVSXHVWDVVLROyJLFDVQRVHDORFDOL]DGR SRUTXHHOLQGLYLGXRQRVHUi
FDSD]GHUHFRUGDUORQLVHUiFDSD]GHYROYHUORDSHUFLELU (QHVWHFDVRSXHGHQ
ocurrir dos cosas. Por una parte, es posible que, en ausencia de un estmulo que d
colorHPRFLRQDODOHVWDGRGHHVHLQGLYLGXRHQHVHPRPHQWRHVWHVRORVHDFDSD]
GHH[SHULPHQWDUXQPDOHVWDURELHQHVWDUPiVRPHQRVLQWHQVRVXQHVWDGRDIHF-
WLYRGLIXVR1ROOHJDDH[SHULPHQWDUHOVHQWLPLHQWRFRQFUHWR\HVSHFtFRGHXQD
HPRFLyQHQSDUWLFXODUSRUTXHORVFDPELRVVLROyJLFRVHQVtPLVPRVQRSRVHHQ
XQDFXDOLGDGHPRFLRQDOHVSHFtFDKD\FDPELRVVLROyJLFRVFRPXQHVDGLYHUVDV
HPRFLRQHV3RURWUDSDUWHHVSRVLEOHTXHORVFDPELRVVLROyJLFRV\FRUSRUDOHV
HQJHQHUDOTXHHVWiH[SHULPHQWDQGRHOVXMHWRVHDQWDQLQWHQVRVTXHOOHJXHQDSUR-
YRFDUXQDHPRFLyQSDUWLFXODU/RTXHRFXUUHHQHVWDVHJXQGDSRVLELOLGDGFRQVLVWH
en atribuir a los cambios corporales una causa relacionada con un desequilibrio
o disfuncin organsmica de cierto calado. El sujeto evala y valora los cambios
corporales y concluye que son la manifestacin de que algo no va bien en su or-
JDQLVPR 'HSHQGLHQGR GHO WLSR H LQWHQVLGDG GH ORV FDPELRV VLROyJLFRV SXHGH
SURGXFLUVHODRFXUUHQFLDGHXQDHPRFLyQXRWUD/DVHPRFLRQHVGHWULVWH]D\PLHGR
pueden producirse con frecuencia segn este esquema.

Esto es lo que, entre otras cosas, permite defender en la actualidad que el dolor no
es una emocin. El dolor solo es una manifestacin fsica de que existe algo que
no funciona, alguna lesin o rotura de tejido, etc. Ahora bien, el dolor puede ser el
desencadenante de una emocin en el momento en el que es evaluado y valorado,
\VHDWULEX\HXQDFDXVDDVXRFXUUHQFLD(OGRORUSXHGHVLJQLFDUDOJ~QGHVDMXVWH
si este desajuste es muy importante, las consecuencias pueden ser importantes
WDPELpQGHSHQGLHQGRGHFXiQLPSRUWDQWHVVHDQGLFKDVFRQVHFXHQFLDVDVtFRPR
GHODFHUWH]DRLQFHUWLGXPEUHTXHJHQHUHQHQHOLQGLYLGXRHVWHSRGUiH[SHULPHQWDU
una emocin.

/DHYDOXDFLyQYDORUDFLyQWDPELpQHVXQDYDULDEOHLPSUHVFLQGLEOH\QHFHVDULD1R
HVXQDYDULDEOHVXFLHQWHSDUDTXHRFXUUDHOSURFHVRHPRFLRQDOSXHVHODQiOLVLVGH
las caractersticas del estmulo y la subsiguiente estimacin de las repercusiones
personales derivadas del mismo, que son el aspecto clave del proceso emocional,
QHFHVLWDQGHORVFDPELRVVLROyJLFRVORVFXDOHVVRQODHYLGHQFLDGHTXHRFXUUH

6RPRVFRQVFLHQWHVGHORFRQWURYHUWLGDTXHSXHGHUHVXOWDUHVWDVXJHUHQFLDPXFKRPiVFRQRFLHQGRORVDUJXPHQWRVGH
/H'RX[HQORVTXHVHSURSRQHTXHHVDSULPHUDUHVSXHVWDVLROyJLFDUHFRUGHPRVODFRUUHVSRQGLHQWHDODYtDUiSLGD\D
HVXQDPDQLIHVWDFLyQGHODHPRFLyQFRQFUHWDHQORVWUDEDMRVGH/H'RX[GHODHPRFLyQGHPLHGR3HURWHQHPRVQXHVWUDV
GXGDVSXHVFRPR\DKHPRVFRPHQWDGRDQWHULRUPHQWHSXHGHRFXUULUTXHSRUXQDSDUWHHOKHFKRGHTXHDSDUH]FDXQD
PDQLIHVWDFLyQ R SHUWXUEDFLyQ VLROyJLFD \ FRQGXFWXDOPRWRUD FDUDFWHUtVWLFD GH OD HPRFLyQ GH PLHGR QR VLJQLTXH TXH
necesariamente existe esa emocin, y, por otra parte, esas mismas manifestaciones y perturbaciones pueden ocurrir cuando
ODSHUVRQDVHHQIUHQWDDXQHVWtPXORTXHHQDEVROXWRVLJQLFDSHOLJURDOJXQRSDUDVXLQWHJULGDG\DTXHVHSXHGHWUDWDUGHOD
WtSLFDUHVSXHVWDGHGHIHQVDTXHVHSURGXFHFDGDYH]TXHXQLQGLYLGXRVHHQFXHQWUDDQWHDOJRLQHVSHUDGR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 154 Manual de teoras emocionales y motivacionales - UJI
XQDHPRFLyQ(VWRHVODHYDOXDFLyQYDORUDFLyQMXQWRDORVFDPELRVVLROyJLFRV
VRQODFRQGLFLyQVXFLHQWHGHOSURFHVRHPRFLRQDO

([SHULHQFLDHPRFLRQDO VHQWLPLHQWR . Es la toma de conciencia de la ocurrencia


de una emocin. Aunque podra argumentarse, como en su momento defendi
-DPHV  TXHODWRPDGHFRQFLHQFLDRH[SHULHQFLDVXEMHWLYDHVOD
variable clave para la ocurrencia de una emocin, hay aspectos relacionados con
HO HVWtPXOR OD SHUFHSFLyQ OD HYDOXDFLyQYDORUDFLyQ OD UHVSXHVWD VLROyJLFD OD
respuesta motora-expresiva y las tendencias de accin que tambin forman parte
del proceso emocional. Si bien parece lgico defender que el sentimiento es el
punto fundamental para que el sujeto sepaTXHHVWiH[SHULPHQWDQGRXQDHPRFLyQ
el concepto de emocin no se agota con el sentimiento. Esto es, puede estar ocu-
rriendo un proceso emocional aunque el sujeto no sea consciente del mismo. En
estos casos, el sujeto puede llegar a experimentar un cierto malestar, inquietud o
DFWLYDFLyQSHURVLQVHUFDSD]GHORFDOL]DUODFXDOLGDGHPRFLRQDOGHHVRVFDPELRV
o alteraciones. Solo la evaluacin-valoracin de los mismos, junto con la conside-
racin de las variables situacionales y contextuales, y las experiencias previas del
VXMHWRSRGUiQOOHYDUDODH[SHULHQFLDVXEMHWLYDFXDOLWDWLYDPHQWHHVSHFtFDGHXQD
emocin.

/D H[SHULHQFLD VXEMHWLYD R VHQWLPLHQWR SHUPLWH DO VXMHWR SRQHU XQ UyWXOR R XQD
cualidad a la emocin que experimenta. Es difcil, si no imposible, llegar a la ex-
periencia subjetiva de una emocin si no existe un proceso previo de evaluacin-va-
loracin consciente. En estos casos, el sujeto experimenta la emocin directamente
derivada de la evaluacin-valoracin. En el caso de que el estmulo, la percepcin
y la evaluacin-valoracin no alcancen el umbral de la consciencia del sujeto, este
SHUFLEH OD UHVSXHVWD VLROyJLFD SURGXFLGD SRU OD VHFXHQFLD DQWHULRU FRQ OR FXDO
OOHYDDFDERODHYDOXDFLyQYDORUDFLyQFRQVFLHQWHGHGLFKDVPDQLIHVWDFLRQHVVLR-
OyJLFDVWDOFRPRKHPRVVHxDODGRDQWHULRUPHQWH\HQHOFDVRGHTXHVHDFDSD]
GH ORFDOL]DU HO HVWtPXOR TXH KD SURGXFLGR GLFKRV FDPELRV VLROyJLFRV WHUPLQD
SRUH[SHULPHQWDUVXEMHWLYDPHQWHODHPRFLyQFRUUHVSRQGLHQWH4XHGDSDWHQWHTXH
siempre es necesaria una evaluacin-valoracin consciente para que el sujeto ex-
perimente subjetivamente una emocin.

/DH[SHULHQFLDVXEMHWLYDHVXQDYDULDEOHQHFHVDULDHLPSUHVFLQGLEOHSDUDTXHHO
sujeto sepa o tome conciencia de que experimenta una emocin. Sin embargo, no
es necesaria ni imprescindible para que ocurra el proceso emocional.

/D UHVSXHVWD VLROyJLFD. Siempre tiene como antecedente una evaluacin-valo-


racin. Como esta puede ser consciente o no consciente, la distincin terica que
podemos establecer entre ambos tipos de respuesta consiste en que, en la respuesta
VLROyJLFDUHVXOWDQWHGHODHYDOXDFLyQFRQVFLHQWHHORUJDQLVPRRIUHFHODUHDFFLyQ
HVSHFtFDFRQFRUGDQWHFRQODHPRFLyQVXEMHWLYDPHQWHH[SHULPHQWDGDPLHQWUDV
TXHHQODUHDFFLyQVLROyJLFDUHVXOWDQWHGHODHYDOXDFLyQYDORUDFLyQQRFRQVFLHQWH
ODUHVSXHVWDVLROyJLFDSXHGHVHUHVSHFtFDGHODHPRFLyQTXHVHDFDEDGHGHVHQ-
cadenar de forma ajena al conocimiento consciente del individuo, o puede tratarse
solo de una reaccin que, al menos en principio, tendra que ser considerada como

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 155 Manual de teoras emocionales y motivacionales - UJI
una respuesta indiferenciada, con connotaciones de defensa general o de evitacin.
(VWR HV FRPR DFDEDPRV GH VHxDODU OD RFXUUHQFLD GH XQD UHVSXHVWD VLROyJLFD
LQFOXVRWDPELpQGHXQDUHVSXHVWDPRWRUDVLQTXHVHSURGX]FDODH[SHULHQFLDVXE-
jetiva o sentimiento de una emocin, denota la existencia de una disociacin del
VLVWHPDGHUHVSXHVWDHPRFLRQDODOHVWLORGHORTXH\DSURSXVLHUD/DFH\  
(VDUHVSXHVWDVLROyJLFDHV\DXQDUHVSXHVWDHPRFLRQDOSXHVVHHVWiSURGXFLHQGR
una disociacin en el sistema de respuesta. Creemos que, independientemente de
OD FRQVLGHUDFLyQ WHyULFD TXH SRVHDQ ODV UHVSXHVWDV VLROyJLFDV GHULYDGDV GH ODV
dos formas de ocurrencia del proceso de evaluacin-valoracin, cuando se trata
de respuestas emocionales, la distincin emprica observable entre ellas es difcil de
establecer, ya que en ambas se produce la preparacin del organismo para enfren-
WDUVHDXQDVLWXDFLyQGHDPHQD]D,QFOXVRHQHOFDVRGHODHYDOXDFLyQYDORUDFLyQ
no consciente, cuando la respuesta es no emocional y simplemente se trata de
XQD UHVSXHVWD VLROyJLFD UHODFLRQDGD FRQ OD HYLWDFLyQ DXQTXH QR H[LVWD SHOLJUR
SDUDODLQWHJULGDGGHORUJDQLVPRSRGHPRVVXJHULUTXHGLFKDUHVSXHVWDVLROyJLFD
TXHVHSURGXFHGHIRUPDFXDVLDXWRPiWLFDWUDVODSHUFHSFLyQGHOHVWtPXOR\TXH
podra tener esas connotaciones de respuesta de defensa, tambin posee conno-
WDFLRQHVDIHFWLYDVEiVLFDVEDMRODIRUPDSULPLWLYDGHDSUR[LPDFLyQRHYLWDFLyQ
$GHPiVHQDPEDVIRUPDVGHUHVSXHVWDVLROyJLFDVHSURGXFHODDFWLYDFLyQGHGRV
GHORVSULQFLSDOHVVLVWHPDVGHGHIHQVDGHORUJDQLVPRDVDEHUHOVLVWHPDVLPSiWLFR
DGUHQRPHGXODU\HOVLVWHPDDGHQRKLSRVDULRDGUHQRFRUWLFDO$OJXQRVDQiOLVLVPiV
HVSHFtFRVKDQSHUPLWLGRQRREVWDQWHORFDOL]DUFLHUWDVSHFXOLDULGDGHVDVRFLDGDV
a emociones particulares. As, en la emocin de miedo se produce un importante
incremento en la secrecin de epinefrina, y en la emocin de ira el incremento
LPSRUWDQWHHVGHQRUHSLQHIULQD +HQU\ 

&RPRKHPRVFRPHQWDGRDQWHULRUPHQWHODUHVSXHVWDVLROyJLFD FDPELRVVLROy-
JLFRV MXQWRFRQODHYDOXDFLyQYDORUDFLyQVRQODFRQGLFLyQQHFHVDULD\VXFLHQWH
GHXQSURFHVRHPRFLRQDO1LODHYDOXDFLyQYDORUDFLyQVRODQLORVFDPELRVVLR-
OyJLFRVVRORVSXHGHQVHUFRQVLGHUDGRVFRPRODFRQGLFLyQVXFLHQWHHQXQSURFHVR
emocional.

La orexis+DFHUHIHUHQFLDDODVWHQGHQFLDVGHDFFLyQHOGHVHRORVLPSXOVRV(Q
el proceso emocional que proponemos, la orexis permitira entender cmo la eva-
luacin-valoracin da lugar a las conductas intencionales. Puede dar lugar a la
aparicin de autnticas conductas completas, y puede ocasionar la manifestacin
de actitudes y conductas de intencin, las cuales poseen connotaciones de antece-
soras de la propia conducta intencional. Eventualmente tambin, cabe la posibili-
dad de incluir entre las conductas intencionales la expresin emocional controlada
FRQWUROGHODH[SUHVLyQ \ODDXVHQFLDGHH[SUHVLyQHPRFLRQDO UHSUHVLyQHPRFLR-
QDO FRPRFRQGXFWDVLQVWUXPHQWDOHVGLULJLGDVDODREWHQFLyQGHREMHWLYRVSDUWL-
culares. Esta es la caracterstica que permite plantear el papel motivador que jue-
gan las emociones. En sentido estricto, se podra sealar que, en algunas emociones,
las caractersticas motivadoras, entendiendo por tales los deseos, los apetitos, las
tendencias de accin, no son tan evidentes. As, por ejemplo, tras la evaluacin-
valoracin de un estmulo como peligroso para la integridad de un sujeto, este
H[SHULPHQWDVXEMHWLYDPHQWHPLHGR\FDVLGHPRGRDXWRPiWLFRVHSURGXFHXQDWHQ-

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 156 Manual de teoras emocionales y motivacionales - UJI
GHQFLDGHDFFLyQGLULJLGDDHYLWDUHVHHVWtPXORELHQKX\HQGRELHQHQIUHQWiQGRVH
DpO(QFDPELRHQRWUDVHPRFLRQHVFRPRODWULVWH]DSDUHFHQRH[LVWLUHVDFODUD
UHODFLyQPRWLYDFLRQDOSXHVSXHGHQRREVHUYDUVHFRQGXFWDPDQLHVWDDOJXQD6LQ
embargo, la conducta abierta y observable es solo una forma de constatar la exis-
tencia de motivacin. Esto es, si bien podemos asegurar que la manifestacin de
una conducta abierta y observable denota la existencia de motivacin, no podemos
asegurar que la ausencia de una conducta abierta y observable denote la ausencia
GHPRWLYDFLyQ(QHOFDVRGHODHPRFLyQFRPHQWDGDODWULVWH]DWDPELpQFDEH
la posibilidad de argumentar que existe motivacin, ya que la propia expresin
GHODHPRFLyQGHWULVWH]DHVXQDIRUPDPRWLYDGDGHSHWLFLyQGHD\XGD\DXQTXH
FRPRLQGLFD/\RQV   ODFRQGXFWDPRWLYDGDSXHGHVHU HQWHQGLGDFRPRXQ
PHFDQLVPRSDUDVROXFLRQDUXQDVLWXDFLyQ \HQHOFDVRGHODWULVWH]DODVLWXDFLyQ
VXHOHSHUWHQHFHUDOSDVDGR\QDGDVHSXHGHKDFHU WDPELpQFDEHODSRVLELOLGDGGH
entender la conducta motivada como un mecanismo para solucionar una situacin
presente y futura: la aceptacin de la realidad por parte del sujeto.

En cualquiera de las posibilidades, la caracterstica orctica no es una variable


QHFHVDULDQLVXFLHQWHSDUDTXHRFXUUDHOSURFHVRHPRFLRQDO

La expresin emocional. Puede ocurrir de distintas formas. Existe, en primer lu-


JDU OD SRVLELOLGDG GH TXH VH SURGX]FD XQD H[SUHVLyQ DXWRPiWLFD LQVWLQWLYD VLQ
TXHPHGLHQLQJ~QWLSRGHFRQWUROYROXQWDULRVREUHODPLVPD6HUtDODFDQDOL]DFLyQ
impulsiva de la energa acumulada tras la experiencia subjetiva de una emocin.
(QHVWDIRUPDGHH[SUHVLyQQRH[LVWHQLQJ~QWLSRGHLQWHQFLRQDOLGDG\VHUHHUH
a las manifestaciones observables que se encuentran indefectiblemente asociadas a
ODH[SHULHQFLDGHXQDHPRFLyQ/RVVLJQRVPiVYLVLEOHVVHORFDOL]DQHQODH[SUHVLyQ
facial, en los movimientos corporales y en la produccin de gritos y manifestaciones
verbales, con el denominador comn de la espontaneidad y la impulsividad. Esto
HVODH[WHULRUL]DFLyQHPRFLRQDOLQFRQWURODGDWLHQHFRPRDQWHFHGHQWHLQPHGLDWROD
experiencia subjetiva de una emocin, o, lo que es lo mismo: el sentimiento.

En segundo lugar, cabe la posibilidad de ejercer alguna forma de control volun-


tario sobre la manifestacin externa de una emocin. Es decir, si bien el organis-
PRSXHGHUHDFFLRQDUGHIRUPDDXWRPiWLFDHLQVWLQWLYDPDQLIHVWDQGRODH[SUHVLyQ
emocional caracterstica de la emocin que experimenta, tambin puede ocurrir
que el sujeto decida suprimir voluntariamente la expresin de dicha emocin.9 Esta
posibilidad admite dos modalidades: el control absoluto sobre la expresin exterior
tambin denomionado represin\HOFRQWUROUD]RQDGRGHODPLVPD3RUORTXH
respecta a la represin, se aprecia que el sujeto suprime o inhibe cualquier manifes-
tacin observable que denote la existencia de una emocin. Se suprime por sistema.
Se puede llegar a plantear la existencia de una disposicin biolgica, e incluso de un
DSUHQGL]DMHIpUUHDPHQWHFRQVROLGDGR(QDPERVFDVRVHOUHVXOWDGRHVODYROXQWDG
de no expresar ninguna manifestacin emocional. Por lo que respecta al control
UD]RQDGR GH OD H[SUHVLyQ H[WHUQD LPSOLFD XQ DQiOLVLV GH OD IRUPD DSURSLDGD GH
expresar la emocin, sin que ello conlleve consecuencias negativas. De este modo

2GHPRGRFRQWUDSXHVWRH[SUHVDUGHIRUPDQJLGDODRFXUUHQFLDGHXQDHPRFLyQFRQODQDOLGDGGHFRQVHJXLUDOJ~Q
REMHWLYR(VXQDIRUPDPDQLSXODWLYDGHXWLOL]DUODLQWHOLJHQFLDHPRFLRQDO

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 157 Manual de teoras emocionales y motivacionales - UJI
VH UHGXFHODSUHVLyQTXHJHQHUDODH[SHULHQFLDGHXQDHPRFLyQXWLOL]DQGRSDUD
ello procedimientos personal y socialmente aceptados. En esta posibilidad rela-
cionada con el control voluntario de la expresin emocional, cualquiera que sea la
PRGDOLGDGXWLOL]DGDSDUDFRQWURODUODH[SUHVLyQH[WHUQDGHXQDHPRFLyQDXQTXHHO
antecedente inmediato tambin es la experiencia subjetiva de la emocin, la exis-
WHQFLDGHXQFRQWUROYROXQWDULRVREUHODH[SUHVLyQLPSOLFDODLQXHQFLDGHODHYD-
OXDFLyQYDORUDFLyQ3RUORWDQWRVHUtDPiVDSURSLDGRSODQWHDUTXHHODQWHFHGHQWH
LQPHGLDWRGHHVWDVGRVIRUPDVGHH[SUHVLyQHPRFLRQDOVHUHHUHDODLQWHUDFFLyQ
del sentimiento y la evaluacin-valoracin. En esta interaccin, se observa una
imposicin de la voluntad sobre la impulsividad instintiva, a diferencia de lo que
ocurre en la expresin incontrolada, donde la impulsividad instintiva no permite
el ejercicio de ninguna forma de control voluntario. Es evidente que en estas dos
formas de control voluntario de la expresin emocional tambin existe una cierta
implicacin de la dimensin orctica, pues el sujeto puede llevar a cabo dicho
control como una forma de conducta intencional dirigida a la obtencin de ciertos
REMHWLYRV 7DQWR HQ OD UHSUHVLyQ HPRFLRQDO FRPR HQ HO FRQWURO GH OD H[SUHVLyQ
HPRFLRQDOVHDSUHFLDFyPRORVIDFWRUHVVRFLDOHVFXOWXUDOHV\GHDSUHQGL]DMHHMHU-
FHQVXLQXHQFLDVREUHORVIDFWRUHVELROyJLFRV+DEUtDTXHVHxDODUDOUHVSHFWRTXH
HQWUHORVIDFWRUHVLQQDWRV LQVWLQWRV \ORVIDFWRUHVDSUHQGLGRV KiELWRV VHSURGXFH
una relacin muy particular. Concretamente, si bien el sujeto posee una capacidad
LQQDWDSDUDH[SHULPHQWDU\H[SUHVDUHPRFLRQHVORVIDFWRUHVGHDSUHQGL]DMHSXH-
den determinar, entre otras cosas, ante qu estmulos se desencadena una emocin,
\EDMRTXpFRQGLFLRQHV\FLUFXQVWDQFLDVVHSXHGHH[SUHVDU(QHIHFWRDGHPiVGH
ciertos estmulos con caractersticas innatas para desencadenar una emocin, hay
RWURVHVWtPXORVRVLWXDFLRQHVTXHSRUDVRFLDFLyQ SRUDSUHQGL]DMH TXHGDQWHP-
SRUDORGHQLWLYDPHQWHUHODFLRQDGRVFRQHOGHVHQFDGHQDPLHQWRGHXQDHPRFLyQ
'HOPLVPRPRGRKD\VLWXDFLRQHVHQODVTXHWDPELpQSRUDVRFLDFLyQRDSUHQGL]D-
je, no es funcional ni adaptativo expresar una emocin.

/DH[SUHVLyQHPRFLRQDOQRHVXQDYDULDEOHQHFHVDULDQLVXFLHQWHSDUDTXHRFXUUD
el proceso emocional.

/DFRQGXFWDLQWHQFLRQDO &RPRFRPHQWiEDPRVHQHOSXQWRGHGLFDGRDODRUH[LV
cabe la posibilidad de llevar a cabo una conducta intencional, con propsitos y
direccin. Es decir, hablamos de conducta motivada, pues se encuentran presentes
ODVGRVFDUDFWHUtVWLFDVHVHQFLDOHVTXHODGHQHQDFWLYDFLyQ\GLUHFFLyQ&DEHOD
SRVLELOLGDGGHTXHH[LVWDPRWLYDFLyQ\RFXUUDXQDFRQGXFWDPDQLHVWD7DPELpQ
cabe la posibilidad de que exista motivacin y, en cambio, no ocurra una conducta
PDQLHVWDDXQTXHHOVXMHWRSXHGHHVWDUOOHYDQGRDFDERRWUDVFRQGXFWDVQRREVHU-
vables. Incluso, cabe la posibilidad de que exista motivacin y no ocurra ningn
WLSRGHFRQGXFWDQLPDQLHVWDQLHQFXELHUWDELHQSRUTXHHOVXMHWRQRVDEHFyPR
actuar, bien porque no puede actuar.

/DFRQGXFWDLQWHQFLRQDOWDPSRFRHVXQDYDULDEOHQHFHVDULDQLVXFLHQWHSDUDTXH
ocurra el proceso emocional.

En suma, la emocin posee connotaciones procesales. Esto es, existe una secuen-
cia de cambios que se van produciendo desde que aparece un estmulo. En un mo-

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 158 Manual de teoras emocionales y motivacionales - UJI
mento determinado de ese proceso se puede producir la experiencia subjetiva o la
toma de conciencia de una emocin el sentimiento, pero antes de ese momento
y despus del mismo hay variables fundamentales que tambin forman parte del
proceso emocional, y, por supuesto, el proceso emocional no se agota con el sen-
WLPLHQWRHOSURFHVRHPRFLRQDOHVXQFRQFHSWRPiVDPSOLRTXHHOVHQWLPLHQWR\
este forma parte de aquel.

1XHVWUDFRQFHSFLyQGHOSURFHVRHPRFLRQDODSXQWDDODRFXUUHQFLDQHFHVDULD\VX-
ciente de dos variables para que se pueda hablar de emocin. Si bien por s misma
cada una de ellas es necesaria, solo la combinacin de ambas proporciona la su-
FLHQFLDHPRFLRQDO(VWDVYDULDEOHVVRQSRUXQDSDUWHODHYDOXDFLyQYDORUDFLyQ
GHOHVWtPXOR TXHLQFOX\HODSURSLDH[LVWHQFLDGHXQHVWtPXOR\ODSHUFHSFLyQGHO
PLVPRYDULDEOHVDPEDVQHFHVDULDVDXQTXHQRVXFLHQWHV \SRURWUDSDUWHODV
UHVSXHVWDVRFDPELRVVLROyJLFRV

1XHVWUDYLVLyQGHODHPRFLyQ
Con estos presupuestos, nuestra visin de la emocin se fundamenta en la rele-
YDQFLDGHORVFRPSRQHQWHVLPSOLFDGRVHQHOSURFHVR/DRFXUUHQFLDGHFDPELRV
LQWHUGHSHQGLHQWHV\VLQFURQL]DGRVHQWDOHVFRPSRQHQWHVWLHQHTXHVHUFRQVLGHUDGD
FRPRODFRQGLFLyQQHFHVDULDSDUDODGHQLFLyQGHHPRFLyQ'HHVWHPRGRQXHVWUD
FRQFHSFLyQGHHPRFLyQHVODVLJXLHQWH/DVHPRFLRQHVVRQSURFHVRVHSLVyGLFRV
que, elicitados por la presencia de algn estmulo o situacin interna o externa, que
KDVLGRHYDOXDGD\YDORUDGDFRPRSRWHQFLDOPHQWHFDSD]GHSURGXFLUXQGHVHTXLOL-
brio en el organismo, dan lugar a una serie de cambios o respuestas en los planos
VXEMHWLYRFRJQLWLYRVLROyJLFR\PRWRUH[SUHVLYRFDPELRVTXHHVWiQtQWLPDPHQ-
te relacionados con el mantenimiento del equilibrio, esto es: con la adaptacin
GH XQ RUJDQLVPR D ODV FRQGLFLRQHV HVSHFtFDV GHO PHGLR DPELHQWH 4XHUHPRV
HQIDWL]DUHOWpUPLQRepisdicos porque, aunque en ocasiones se llega a decir que
cualquier organismo es siempre una entidad emocional, predomina de forma profusa
ODFRQVLGHUDFLyQGHODHPRFLyQHQWpUPLQRVIiVLFRVHVWRHVGHVFDUJDVPiVRPHQRV
intensas producidas en un momento puntual por la presencia de un estmulo con-
creto. Decir que un organismo es una entidad emocional puede ser correcto si se
argumenta que: a WRGRRUJDQLVPRWLHQHODFDSDFLGDGSDUDH[SHULPHQWDU\H[SUHVDU
emociones, o b WRGRRUJDQLVPRVHHQFXHQWUDVLHPSUHHQXQGHWHUPLQDGRHVWDGR
afectivo. En la primera de las premisas se contempla la emocin como proceso
DIHFWLYREiVLFRFRQFRQQRWDFLRQHVWHPSRUDOPHQWHEUHYHV\IiVLFDVHQODVHJXQGD
premisa no se hace referencia a la emocin, sino a otra dimensin afectiva el hu-
mor, o estado afectivo actual de ese organismo, por lo que, en este caso, se alude
DXQDGLPHQVLyQDIHFWLYDWyQLFDPiVHVWDEOH\GXUDGHUDSHURPHQRVLQWHQVDTXH
la emocin. El humor o estado afectivo actual podra ser considerado como el fon-
GRVREUHHOTXHVHSURGXFLUiHOdisparo de una emocin.

(QHVWHPDUFRGHUHIHUHQFLDHVWLPDPRVTXHLGHQWLFDUODVHPRFLRQHVFRQHOVHQ-
timiento emocional solo permite el estudio parcial del proceso emocional. Parece
PiVSURGXFWLYRHVWXGLDUHOSURFHVRHPRFLRQDOGHVGHXQDSHUVSHFWLYDPiVHOHPHQWDO

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 159 Manual de teoras emocionales y motivacionales - UJI
\EiVLFDDTXHOODTXHWLHQHTXHYHUFRQORTXHHVFRP~Q\FRPSDUWLGRSRUP~OWLSOHV
HVSHFLHV /R TXH WUDWDPRV GH GHFLU HV TXH HO VHQWLPLHQWR HPRFLRQDO DXQTXH HV
imprescindible para tomar conciencia de que ocurre una emocin, no es necesario
para que podamos hablar de ocurrencia de un proceso emocional.

Bibliografa
ADOLPHS, R. y A. R. DAMASIO   1HXURELRORJ\ RI HPRWLRQ DW D V\VWHPV
OHYHOHQ-&%RURG HG 7KH1HXURSV\FKRORJ\RI(PRWLRQ SS 
2[IRUG8QLYHUVLW\3UHVV2[IRUG
ADOLPHS, R.; H. DAMASIO; D. TRANEL y A. R. DAMASIO  &RUWLFDOV\VWHPV
for the recognition of emotion in facial expressions, Journal of Neuroscience,

BERNARD, C.  /HoRQVGH3K\VLRORJLH([SpULPHQWDOH$SSOLTXpHDOD0pGLFLQH
)DLWHVDX&ROOHJHGH)UDQFH9RO. Baillire, Pars.
BUSS, D. M.; M. G. HASELTON; T. K. SHACKELFORD; A. L. BLESKE y J. C. WAKEFIELD
 $GDSWDWLRQVH[DSWDWLRQVDQGVSDQGUHOV$PHULFDQ3V\FKRORJLVW

CANNON, W. B  7KHHPHUJHQF\IXQFWLRQRIWKHDGUHQDOPHGXOODLQSDLQ
and the major emotions, $PHULFDQ-RXUQDORI3K\VLRORJ\
   %RGLO\ &KDQJHV LQ 3DLQ +XQJHU )HDU DQG 5DJH +DUSHU DQG 5RZ
1XHYD<RUN
   6WUHVVHV DQG VWUDLQV RI KRPHRVWDVLV American Journal of Medical
Science
CARLSON, J. G. y E. HATFIELD  3V\FKRORJ\RI(PRWLRQ+ROW5LQHKDUWDQG
:LQVWRQ2UODQGR)ORULGD
CARSTENSEN, L. L.; J. M. GOTTMAN y R. W. LEVENSON  (PRWLRQDOEHKDYLRU
in long-term marriage, 3V\FKRORJ\DQG$JLQJ
DAMASIO, A. R  'HVFDUWHVHUURU(PRWLRQV5HDVRQDQGWKH+XPDQ%UDLQ
$YRQ%RRNV1XHYD<RUN
  7RZDUGDQHXURELRORJ\RIHPRWLRQDQGIHHOLQJ2SHUDWLRQDOFRQFHSWV
and hypotheses, The Neuroscientist
  (PRWLRQLQWKHSHUVSHFWLYHRIDQLQWHJUDWHGQHUYRXVV\VWHPBrain
Research Reviews
DARWIN, C. R.  The Expression of the Emotions in Man and Animals.
University of Chicago Press, Chicago.
DESCARTES, R  3DVLRQHVGHO$OPD0HGLWDFLRQHV0HWDItVLFDV -XDQ
*LO)HUQiQGH]WUDGXFWRU 2UELV0DGULG
DEWEY, J.   7KH WKHRU\ RI HPRWLRQ ,, 7KH VLJQLFDQFH RI HPRWLRQV
3V\FKRORJLFDO5HYLHZ
EKMAN, P.  Telling Lies%HUNOH\%RRNV1XHYD<RUN
 D $QDUJXPHQWIRUEDVLFHPRWLRQVCognition and Emotion  


F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 160 Manual de teoras emocionales y motivacionales - UJI
 E  )DFLDO H[SUHVVLRQ RI HPRWLRQ 1HZ QGLQJV QHZ TXHVWLRQV
3V\FKRORJLFDO6FLHQFH
 D )DFLDOH[SUHVVLRQVHQ7'DOJOHLVK\03RZHU HGV Handbook of
Cognition and Emotion SS :LOH\&KLFKHVWHU
E %DVLFHPRWLRQVHQ7'DOJOHLVK\03RZHU HGV Handbook of
Cognition and Emotion SS :LOH\&KLFKHVWHU
FREDRICKSON, B. L. y R. W. LEVENSON  3RVLWLYHHPRWLRQVVSHHGUHFRYHU\
from the cardiovascular sequelae of negative emotions, Cognition and
Emotion
GAINOTTI, G.   )HDWXUHV RI HPRWLRQDO EHKDYLRU UHOHYDQW WR QHXURELRORJ\
DQGWKHRULHVRIHPRWLRQHQ**DLQRWWL\&&DOWDJLURQH HGV Emotions and
the Dual Brain SS 6SULQJHU9HUODJ%HUOtQ
  1HXURSV\FKRORJLFDOWKHRULHVRIHPRWLRQHQ-&%RURG HG The
1HXURSV\FKRORJ\RI(PRWLRQ SS 2[IRUG8QLYHUVLW\3UHVV2[IRUG
HEBB, D. O  The Organization of Behavior:LOH\1XHYD<RUN
HENRY, J. P.   1HXURHQGRFULQH SDWWHUQV RI HPRWLRQDO UHVSRQVHV HQ
53OXWFKLN\+.HOOHUPDQ HGV (PRWLRQ7KHRU\5HVHDUFKDQG([SHULHQFH
9RO%LRORJLFDO)RXQGDWLRQVRI(PRWLRQ SS $FDGHPLF3UHVV1XHYD
<RUN
IZARD, C. E.  ,QQDWHDQGXQLYHUVDOIDFLDOH[SUHVVLRQVHYLGHQFHIURPWKH
developmental and cross-cultural research, 3V\FKRORJLFDO%XOOHWLQ

JAMES, W  :KDWLVDQHPRWLRQ"HQ(*DYLULD WUDG Estudios de
Psicologa
JAMES, W  3ULQFLSOHVRI3V\FKRORJ\+ROW1XHYD<RUN
KELTNER, D. y J. HAIDT   6RFLDO IXQFWLRQV RI HPRWLRQV DW IRXU OHYHOV RI
analysis, Cognition and Emotion  
KELTNER, D. y J. J. GROSS  )XQFWLRQDODFFRXQWVRIHPRWLRQVCognition
and Emotion  
KINSBOURNE, M   $ PRGHO RI DGDSWLYH EHKDYLRU UHODWHG WR FHUHEUDO
SDUWLFLSDWLRQ LQ HPRWLRQDO FRQWURO HQ * *DLQRWWL \ & &DOWDJLURQH HGV 
Emotions and the Dual Brain SS 6SULQJHU9HUODJ%HUOtQ
LACEY, J. I.  6RPDWLFUHVSRQVHSDWWHUQLQJDQGVWUHVV6RPHUHYLVLRQVRI
DFWLYDWLRQWKHRU\HQ0+$SSOH\\57UXPEXOO HGV 3V\FKRORJLFDO6WUHVV
,VVXHVLQ5HVHDUFK SS $SSOHWRQ&HQWXU\&URIWV1XHYD<RUN
LEDOUX, J. E.   7KH (PRWLRQDO %UDLQ WKH 0\VWHULRXV 8QGHUSLQQLQJV RI
Emotional Life6LPRQDQG6FKXVWHU1XHYD<RUN
 D &RJQLWLYHHPRWLRQDOLQWHUDFWLRQV/LVWHQWRWKHEUDLQHQ5'/DQH
\/1DGHO HGV Cognitive Neuroscience of Emotion SS 2[IRUG
8QLYHUVLW\3UHVV1XHYD<RUN
 E (PRWLRQFLUFXLWVLQWKHEUDLQAnnual Review of Neuroscience

LEVENSON, R. W.  7KHLQWUDSHUVRQDOIXQFWLRQVRIHPRWLRQCognition and
Emotion  
LEVENSON, R.W.; L. L. CARTENSON; W. V. FRIESEN y P. EKMAN  (PRWLRQ
physiology, and expression in old age, 3V\FKRORJ\DQG$JLQJ
LYONS, W.  Emocin. Anthropos, Barcelona.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 161 Manual de teoras emocionales y motivacionales - UJI
ORTONY, A. y W. TURNER   :KDWV EDVLF DERXW EDVLF HPRWLRQV"
3V\FKRORJLFDO5HYLHZ
PALMERO, F  $SUR[LPDFLyQELROyJLFDDOHVWXGLRGHODHPRFLyQAnales
de Psicologa
  /DHPRFLyQHQODDFWXDOLGDG5HOHYDQFLDGHODDGDSWDFLyQPsicologa
,EHURDPHULFDQD  
 VRPHWLGRDUHYLVLyQ (PRWLRQCognition and Emotion.
PALMERO, F. y E. G. FERNNDEZ-ABASCAL  /RVSURFHVRVHPRFLRQDOHVHQ
)3DOPHUR\(*)HUQiQGH]$EDVFDO HGV (PRFLRQHV\$GDSWDFLyQ SS
 $ULHO%DUFHORQD
PLUTCHIK, R  The Emotions8QLYHUVLW\3UHVVRI$PHULFD1XHYD<RUN
POWER, M. J. y DALGLEISH, T.   Cognition and Emotion: From Order to
Disorder3V\FKRORJ\3UHVV+RYH
ROSS, E. D  5LJKWKHPLVSKUHVUROHLQODQJXDJHDIIHFWLYHEHKDYLRUDQG
emotion, Trends in Neuroscience
RUSSELL, J. A   ,V WKHUH XQLYHUVDO UHFRJQLWLRQ RI HPRWLRQ IURP IDFLDO
H[SUHVVLRQ"$UHYLHZRIFURVVFXOWXUDOVWXGLHV3V\FKRORJLFDO%XOOHWLQ

SACKHEIM, H. A. y R. C. GUR  /DWHUDODV\PPHWU\LQLQWHQVLW\RIHPRWLRQDO
expression, 1HXURSV\FKRORJLD
SACKHEIM, H. A.; M. S. GREENBERG; A. L. WEIMAN; R. C. GUR; J. P. HUNGERBUHLER,
y N. GESCHWIND  +HPLVSKHULFDV\PPHWU\LQWKHH[SUHVVLRQRISRVLWLYH
and negative emotions, $UFKLYHVRI1HXURORJ\
STEIN, N. L. y T. TRABASSO  7KHRUJDQL]DWLRQ RI HPRWLRQDOH[SHULHQFH
&UHDWLQJ OLQNV DPRQJ HPRWLRQ WKLQNLQJ ODQJXDJH DQG LQWHQWLRQDO DFWLRQ
Cognition and Emotion
TUCKER, J. S. y H. S. FRIEDMAN   (PRWLRQ SHUVRQDOLW\ DQG KHDOWK HQ
&0DJDL\6+0FIDGGHQ HGV +DQGERRNRI(PRWLRQ$GXOWGHYHORSPHQW
and Aging SS 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 162 Manual de teoras emocionales y motivacionales - UJI
7HRUtDVELROyJLFDVHQHPRFLyQ
,QWURGXFFLyQ
(QHOiPELWRGHOHVWXGLRGHODHPRFLyQWDPELpQODWUDGLFLyQELROyJLFDVHLQLFLDFRQ
Darwin, quien consider que las emociones han desempeado un papel esencial
HQODDGDSWDFLyQGHORUJDQLVPRDVXHQWRUQRDORODUJRGHODORJpQHVLV %LVTXHUUD
 6LELHQFDEHGHVWDFDURWURFODURDQWHFHGHQWHTXHLJXDOPHQWHKDPDUFDGR
HOGHVDUUROOR\HYROXFLyQGHODVDSUR[LPDFLRQHVELROyJLFDVHQGLFKRiPELWRHOGHODV
formulaciones cartesianas, en las que ya se consideraba la gran importancia de las va-
ULDEOHVELROyJLFDV 3DOPHUR 

En efecto, fue la obra de Darwin: The Expression of the Emotions in Man and Ani-
mals  ODTXHPDUFyHOLQLFLRGHODVSRVWHULRUHVLQYHVWLJDFLRQHVFHQWUDGDVHQ
los aspectos evolucionistas, representando sus aportaciones el fundamento de lo
que posteriormente seran las formulaciones biolgicas y expresivas. Por tanto, se
SXHGHFRQVLGHUDUTXHODDUJXPHQWDFLyQGH'DUZLQUHSUHVHQWDHORULJHQGHSUiFWLFD-
mente todas las teoras biolgicas sobre la emocin. En esencia, Darwin, basando
biolgicamente sus premisas, establece que los movimientos corporales y las ex-
presiones faciales cumplen un papel de comunicacin entre los miembros de una
HVSHFLHWUDQVPLWLHQGRLQIRUPDFLyQDFHUFDGHOHVWDGRHPRFLRQDOGHORUJDQLVPR/DV
emociones, y su expresin, son innatas, aunque se admite la posibilidad de que los
IDFWRUHVGHDSUHQGL]DMHSXHGDQHMHUFHUDOJ~QWLSRGHLQXHQFLDVREUHODH[SUHVLyQ
3UHFLVDPHQWHHVWDSRVLEOHLQXHQFLDGHORVIDFWRUHVGHDSUHQGL]DMHSHUPLWHTXHODV
emociones evolucionen a travs del tiempo para aumentar la probabilidad de que el
sujeto y la especie se adapten a las caractersticas cambiantes del ambiente externo.

Segn la propuesta de Darwin, la expresin de las emociones se encuentra modula-


da por tres principios: a principio de los hbitos asociados con la utilidad segn
el cual el modo en que los organismos expresan las emociones ha tenido un valor
adaptativo en el pasado, sea este relativo al sujeto, sea relativo a la especie. Segn
Darwin, las expresiones emocionales fueron originalmente aprendidas y, a causa
de su utilidad, se convierten en innatas, transmitindose a las subsiguientes gene-
UDFLRQHV(VGHFLUVHSURGXFHXQDHYROXFLyQGHVGHORVKiELWRVDSUHQGLGRVKDVWD
los rasgos heredados; b principio de anttesis segn el cual se argumenta que
la expresin de emociones opuestas implica tambin tipos opuestos de conducta.
$GHPiVFXDQGRXQVXMHWRVLHQWHXQHVWDGRGLUHFWDPHQWHRSXHVWRDOTXHUHTXLHUHOD
situacin, experimenta una tendencia involuntaria a expresar conductualmente ese
sentimiento, aunque no tenga un claro valor adaptativo para s mismo; c princi-
pio de la accin directa del sistema nervioso excitado segn el cual, debido a que
FRQORVRWURVGRVSULQFLSLRVQRVHSXHGHQFDWHJRUL]DUWRGDVODVHPRFLRQHV'DUZLQ
apunta que algunas expresiones emocionales aparecen nicamente porque se pro-
ducen cambios en la actividad del sistema nervioso.

(QUHVXPHQHOSODQWHDPLHQWRJHQHUDOGH'DUZLQHQIDWL]DODLGHDGHTXHODVHPRFLR-
nes y su expresin han tenido valor adaptativo en el pasado, es decir, si se mantienen

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 163 Manual de teoras emocionales y motivacionales - UJI
vigentes en la actualidad es porque sirven para comunicar el estado interno de un
sujeto a otro.

/RVVHJXLGRUHVPiVGLUHFWRVGHORVSODQWHDPLHQWRVHYROXFLRQLVWDVGH'DUZLQKDQ
sido los etlogos, quienes han recuperado sus tesis y han contribuido a su auge en
ORV~OWLPRVDxRV 3DOPHUR (QHOiPELWRGHODHPRFLyQODetologa se ha cen-
trado fundamentalmente en el estudio de los movimientos expresivos de los organis-
mos. Sin embargo, los etlogos no consideran la emocin como algo separado de la
motivacin, por el contrario, consideran ambos procesos como dos denominacio-
QHVSDUDUHIHULUVHDOPLVPRFRQFHSWRODDFXPXODFLyQGHHQHUJtDHVSHFtFDSDUDOD
accin. Entre los planteamientos etolgicos, cabra destacar: los movimientos de
LQWHQFLyQ\ORVHVWtPXORVQRYHUEDOHV/RVmovimientos de intencinVHUHHUHQD
los patrones de conducta que acompaan a la expresin emocional; son movimien-
WRVTXHDYLVDQGHRDQWHFHGHQDODDSDULFLyQGHXQDHPRFLyQ/RVestmulos no
verbalesVHUHHUHQDODVH[SUHVLRQHVIDFLDOHVORVJHVWRV\JULWRVTXHDFRPSDxDQ
a la conducta emocional.

$VtHQUHODFLyQDOHVWXGLRGHODVHPRFLRQHVHOSODQWHDPLHQWRHWROyJLFRHQIDWL]DOD
particular dimensin social de tales procesos. Es necesario descubrir cmo, desde
HOQDFLPLHQWRODVHPRFLRQHVMXHJDQXQSDSHOEiVLFRHQODGLQiPLFDJUXSDOWDQWR
en los seres humanos como en las especies inferiores. El desarrollo natural de cada
LQGLYLGXRXQLGRDODVLQXHQFLDVVRFLDOHVFXOWXUDOHVDPELHQWDOHVHQJHQHUDOYDQ
GLVHxDQGRHOSHUOHPRFLRQDOH[SUHVLYRTXHFDUDFWHUL]DUiDHVHLQGLYLGXRHOUHVWR
GHVXYLGD(VHVWHXQSHUOORVXFLHQWHPHQWHDFHSWDGRHQHOJUXSRSDUDSHUPLWLU
TXHGLFKRLQGLYLGXRQRSURGX]FDIULFFLRQHVHQODVLQWHUDFFLRQHVTXHOOHYDUiDFDER
3RUHVDUD]yQORLPSRUWDQWHHQHVWHWLSRGHFRQVLGHUDFLRQHVHVHOSDSHOH[SUHVLYR\
comunicativo de la emocin, el cual se relaciona con las interacciones personales,
DVtFRPRFRQODRUJDQL]DFLyQGHODSURSLDFRQGXFWD

&RQWRGRVHSXHGHGHFLUTXHHQHOiPELWRGHODSVLFRORJtDGHODHPRFLyQVHKD
FRQVROLGDGRHQQXHVWURVGtDVXQDWUDGLFLyQHYROXFLRQLVWDODFXDOHQIDWL]DODIXQ-
FLyQDGDSWDWLYDGHORVIHQyPHQRVHPRFLRQDOHV 5RVHOOy\5HYHUW 

7HRUtDVVLROyJLFDVHLQVWLQWLYLVWDV
(QWUHHVWDVDSUR[LPDFLRQHVFRQFODUDVLQXHQFLDVGHODVDSRUWDFLRQHVHYROXFLR-
QLVWDV\GHODVUDtFHVORVyFDVPHUHFHQVHUUHVHxDGDVODVGH0F'RXJDOO\-DPHV
as como las crticas de Cannon en relacin a esta ltima.

McDougall  SRQHGHUHOLHYHODFDSDFLGDGTXHWLHQHXQRUJDQLVPRSDUD


DFHUFDUVHDODVPHWDVEHQHFLRVDVORTXHUHSUHVHQWDXQDVSHFWRLPSRUWDQWHHQSVL-
FRORJtD\DTXHWRGDVODVFRQGXFWDVVHHQFXHQWUDQUHJLGDVSRUXQSULQFLSLREiVLFR
DSUR[LPDUVHKDFLDORTXHSURGXFHSODFHU\HYLWDUORTXHSURGXFHGRORU 3DOPHUR
 6LQHPEDUJRHVWRVGRVVHQWLPLHQWRVVHJ~QODWHUPLQRORJtDGH0F'RX-
JDOOQRVRQVXFLHQWHVSDUDHQWHQGHUHOIXQFLRQDPLHQWRGHOVHUKXPDQRTXHGHEH
ser considerado como un organismo cognitivo y con expectativas. Cuando expusimos

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 164 Manual de teoras emocionales y motivacionales - UJI
la evolucin terica de la psicologa de la motivacin, ya hicimos referencia a la
LPSRUWDQFLDTXHWLHQHQSDUD0F'RXJDOOORVLQVWLQWRVORVFXDOHVSRVLELOLWDQWRGRV
ORVSHQVDPLHQWRV\DFFLRQHV'HKHFKR0F'RXJDOOSURSRQtDTXHWRGDFRQGXFWDHV
LQVWLQWLYD/RVLQVWLQWRVWDPELpQWLHQHQXQFRPSRQHQWHDIHFWLYRTXHVHUHHMDHQ
cambios viscerales y corporales. En esta argumentacin, la percepcin producira
la emocin.

6LELHQODFRQFHSFLyQGH0F'RXJDOOKDSDVDGRGHVDSHUFLELGDVLVWHPiWLFDPHQWH
HOHVWXGLRGHODVFRJQLFLRQHVSURVSHFWLYDV\VXUHODFLyQFRQODHPRFLyQHVXQiP-
ELWRLPSUHVFLQGLEOHSDUDHQWHQGHUODHPRFLyQ\ODPRWLYDFLyQHQVXVHQWLGRPiV
amplio. En efecto, la representacin de una meta, as como la dimensin afectiva
DVRFLDGDDODHYHQWXDOFRQVHFXFLyQGHODPLVPD DPEDVYDULDEOHVFRQVLGHUDGDVHQ
IRUPDGHH[SHFWDWLYDV VHHQFXHQWUDQHQODEDVHH[SOLFDWLYDGHFXDOTXLHUFRQGXFWD

$Vt0F'RXJDOOSRQHGHPDQLHVWRTXHODH[SHULHQFLDGHODHPRFLyQWLHQHOXJDU
FXDQGRXQLQVWLQWRHVDFWLYDGR/DQDOLGDGGHORVLQVWLQWRVHVFRQVHJXLUODDGDSWD-
cin del sujeto a su medio ambiente. A travs de la evolucin, las metas del hom-
EUHKDQUHVXOWDGRPiVHVSHFtFDVSRUWDQWRODVFRQGXFWDVRULHQWDGDVDHVDVPHWDV
GHYLHQHQPiVHVSHFLDOL]DGDV(OUHVXOWDGRVHJ~Q0F'RXJDOOHVXQPiVSUHFLVR
ajuste corporal, de tal suerte que cada uno de estos bien diferenciados ajustes pro-
GXFHXQDHPRFLyQSULPDULD&XDQGRGRVRPiVGHHVWDVUHDFFLRQHVFRUSRUDOHVSUL-
marias coinciden en el tiempo se produce una emocin secundaria. En este punto,
0F'RXJDOO LQWHQWD GLIHUHQFLDU HQWUH HPRFLRQHV \ VHQWLPLHQWRV &RQFUHWDPHQWH
ODVHPRFLRQHVKDQDSDUHFLGRDQWHVHQHOGHVDUUROORORJHQpWLFRPLHQWUDVTXHORV
sentimientos, que son el resultado del funcionamiento cognitivo, son una peculia-
ridad del ser humano.

Por su parte, James ha marcado un hito en la historia de la psicologa de la emo-


FLyQ+DVWDIHFKDHQODTXH-DPHVSXEOLFDVXFHOHEpUULPRWUDEDMR4XpHV
una emocin?, la consideracin del sentido comn haca pensar que la percepcin
de un estmulo provocaba una emocin, y esta ocasionaba la aparicin de cambios
FRUSRUDOHV-DPHVVHSUHJXQWDTXpRFXUUHDQWHVODH[SHULHQFLDGHODHPRFLyQROD
DFWLYDFLyQVLROyJLFD"(QHVWHPDUFRWHyULFRODIRUPXODFLyQGH-DPHV  
\GH/DQJH  LQWURGXFHXQDLPSRUWDQWHPRGLFDFLyQUHVSHFWRDODFRQ-
FHSFLyQTXHVHWHQtDKDVWDHQWRQFHV&RQFUHWDPHQWHSDUD-DPHV\/DQJHODHPR-
cin no se deriva directamente de la percepcin de un estmulo, sino que este
ocasiona unos cambios corporales, cuya percepcin por parte del sujeto da lugar
a la emocin. En este sentido, es importante destacar que, para James, las reac-
ciones viscerales y las reacciones corporales motoras son igualmente importantes
\FHQWUDOHVSDUDORVHVWDGRVHPRFLRQDOHVVLQHPEDUJRSDUD/DQJHHOpQIDVLVVH
debe poner en los cambios vasculares, fundamentalmente en la presin sangunea.
Es decir, el inicial proceso conformado por tres momentos segn un determi-
QDGRRUGHQ HVWtPXORHPRFLyQFDPELRVFRUSRUDOHV VHFRQYLHUWHHQXQSURFHVR
GLIHUHQWH HQ HO TXH ORV PRPHQWRV VH LQYLHUWHQ HVWtPXORFDPELRV FRUSRUDOHV
HPRFLyQ HQHVWHFDVRORVFDPELRVFRUSRUDOHVHQJHQHUDOVRQORVTXHGDQOXJDUD
la experiencia de la emocin. As pues, en esta argumentacin, denominada gen-
ricamente teora de James-Lange, el principal punto se sita en el hecho de que el

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 165 Manual de teoras emocionales y motivacionales - UJI
feedback aferente desde las vsceras y msculos esquelticos produce la emocin,
UD]yQHVWDSRUODTXHODIRUPXODFLyQGH-DPHV\/DQJHWDPELpQUHFLEHHOQRPEUH
de teora perifrica de la emocin, aunque tambin ha sido denominada teora
del feedback visceral, porque son las aferencias viscerales las que dan lugar a la
experiencia de la emocin. Como argumenta el propio James, la emocin es la
SHUFHSFLyQ GH OD DFWLYDFLyQ VLROyJLFD FDPELRV FRUSRUDOHV  (V GHFLU DOJXQRV
HYHQWRVGHODPELHQWHSURGXFHQXQSDWUyQHVSHFtFRGHFDPELRVFRUSRUDOHVHVWH
HVLGHQWLFDGRSRUHOFHUHEURFRPRSHUWHQHFLHQWHDXQDHPRFLyQSDUWLFXODU\WUDV
ello, se produce la experiencia de dicha emocin.

Como ejemplo de la gran repercusin que ha tenido y sigue teniendo la teora de


la emocin de James, a este tipo de argumento se le ha denominado teora de la
identidad de la emocin %HFN SXHVHQpOVHSURSRQHODH[LVWHQFLDGHXQD
UHODFLyQHVSHFtFDHQWUHODH[SHULHQFLDGHXQDHPRFLyQFRQFUHWD\ODDFWLYDFLyQGH
XQRVFDPELRVVLROyJLFRVSDUWLFXODUHV&RPRKHPRVSRGLGRDSUHFLDUDORODUJRGHODV
distintas manifestaciones tericas desde James hasta la actualidad, este es uno de
ORVDUJXPHQWRVPiVDWUDFWLYRVGHODWHRUtDGH-DPHV\DTXHVHHQFXHQWUDLPSOtFLWD
ODLGHDGHHVSHFLFLGDGSVLFRVLROyJLFDDVRFLDGDDFDGDHPRFLyQ

No obstante, y a pesar de su relevancia, en la argumentacin de James existen


dos aspectos que no llegaron a ser aclarados por el autor en sus formulaciones
FOiVLFDV3RUXQODGR-DPHVQRH[SOLFDTXpHVORTXHRFXUUHFXDQGRVHSHUFLEH
el estmulo para que el organismo reaccione del modo que lo hace y no de otro;
es un paso intermedio indispensable para entender la propia respuesta corporal,
ya que en ese momento tiene lugar un proceso de evaluacin y de valoracin que,
FXDQGRHOHVWtPXORWLHQHVLJQLFDFLyQSHUVRQDOGDOXJDUDODVUHVSXHVWDVSDUWLFXODUHV
TXH RFXUUHQ< SRU RWUR ODGR -DPHV WDPSRFR DFODUD TXp HV OR TXH VXFHGH FXDQ-
GRVHSURGXFHODSHUFHSFLyQGHORVFDPELRVFRUSRUDOHVTXHHVWiQRFXUULHQGRQR
explica el proceso de evaluacin que tiene lugar en ese momento preciso, y que
SHUPLWHTXHODSHUVRQDLGHQWLTXHHVRVFDPELRVFRUSRUDOHVFRQFUHWRV\GHFLGDTXHVH
corresponden o pertenecen a una emocin particular. Aunque la persona no sea cons-
ciente de la ocurrencia de esos procesos de evaluacin y de valoracin, es evidente
que se producen, pues de ellos dependen, en primer lugar, el patrn de respuesta que
PDQLHVWDODSHUVRQD\HQVHJXQGROXJDUODH[SHULHQFLDGHODHPRFLyQ(QHVWH
PDUFRGHUHIHUHQFLDTXHUHPRVHQIDWL]DUODHOHJDQFLD\PRGHVWLDGH-DPHVFXDQ-
GRFRQVFLHQWHGHVXHTXLYRFDFLyQUHFWLFDVXSURSXHVWDRULJLQDO&UHHPRVTXH
es pertinente recordarlo porque, cuando se habla de la teora de las emociones de
-DPHVVLVWHPiWLFDPHQWHVHKDFHUHIHUHQFLDDVXFRQRFLGRDUWtFXOR4XpHVXQD
emocinSXEOLFDGRHQ0LQGHQSDUDLQPHGLDWDPHQWHGHVSXpVFRPHQWDU
que donde desarrolla exhaustivamente su teora de la emocin es en los Principios
de PsicologaHGLWDGRHQ6LQHPEDUJR VRQSRFRVTXLHQHVVHUHHUHQDOWUD-
EDMRGH-DPHV  HQHOTXHUHFRQRFHVXHUURUDOIRUPXODUODWHRUtDDGPLWHOD
LPSRUWDQFLDGHODYDORUDFLyQ\HVWDEOHFHTXHORVFDPELRVVLROyJLFRV\FRUSRUDOHV
VRQ SURGXFLGRV SRU OD VLJQLFDFLyQ SHUVRQDO TXH SRVHH HO HVWtPXOR R VLWXDFLyQ
SDUDHOELHQHVWDUGHORUJDQLVPR(QFXDOTXLHUFDVRPiVDOOiGHORVHUURUHVHQOD
IRUPXODFLyQHOUHWRTXHSURSXVR-DPHVVLJXHVLHQGRXQREMHWLYRDDOFDQ]DU'H
hecho, como quiera que la argumentacin de James se centra en la diferenciacin

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 166 Manual de teoras emocionales y motivacionales - UJI
emocional a partir del feedbackSHULIpULFRGHORVFDPELRVFRUSRUDOHV\VLROyJL-
FRVODSRVLEOHLGHQWLFDFLyQGHODVHPRFLRQHVDSDUWLUGHVXSHUOSVLFRVLROyJLFR
o, lo que es lo mismo, la correspondencia entre una emocin concreta y un patrn
SVLFRVLROyJLFRSDUWLFXODUHVDOJRPX\DWUDFWLYRSDUDORVLQYHVWLJDGRUHV

$GHPiVGHWRGRORH[SXHVWRVHKDGHVHxDODUTXHODIRUPXODFLyQGH-DPHVSRVHH
el valor de ser la primera teora psicolgica formulada sobre la emocin. Aunque
KDEtDKDELGRPXFKDVDSRUWDFLRQHVHQHOFDPSRGHODHPRFLyQVLQLUPiVOHMRVORV
propios maestros de James, entre ellos Descartes, con James se pone la primera
piedra en la construccin de la psicologa de la emocin. Se puede plantear que
James aporta la primera teora en la cual se asume la existencia de emociones con-
cretas, las cuales poseen una base claramente instintiva, y pueden ser separadas y
diferenciadas de ciertos sentimientos. As, los estmulos que proceden de colores
y sonidos producen sentimientos no emocionales, distribuyndose a lo largo de un
continuo o dimensin placentera-displacentera(VWRVDVSHFWRVKDQLQXLGRFRQ-
siderablemente en las posteriores teoras y argumentos propuestos.

7DPELpQFDEHGHVWDFDUTXHKDQDSDUHFLGRWRGDXQDVHULHGHWUDGLFLRQHVWHyULFDV
que deben mucho a la propuesta de James, ya que esta integra hasta cuatro niveles
explicativos diferentes, a cada uno de los cuales se adscribe alguna de las tradi-
FLRQHVPiVVyOLGDVHQHOHVWXGLRGHODHPRFLyQDVDEHUXQQLYHOVLROyJLFRTXH
podemos situar en el origen de la tradicin neurobiolgica; un nivel conductual-
expresivo, en el que se basan, al menos en parte, los modelos de la expresin facial
GHODVHPRFLRQHVEiVLFDVXQQLYHOLGHDFLRQDOHQHOTXHVHLQVSLUDODWUDGLFLyQFRJ-
QLWLYLVWDOLJDGDDODSVLFRVLROyJLFDHQODPHGLGDHQTXHDPEDVVRQHSLVWHPROyJL-
FDPHQWHIXQFLRQDOLVWDVXQQLYHOSHUFHSWLYRLQWHUPHGLRFRQHOTXHHQOD]DQWHRUtDV
FRPRODGH/HYHQWKDOTXHIRUPXODXQPRGHORSHUFHSWLYRPRWRUGHODHPRFLyQ
5RVHOOy\5HYHUW 

Igualmente, relacionada con su impacto y su novedad, la teora de James tiene


tambin en su haber la gran actividad crtica que suscit entre diversos investiga-
dores, quienes argumentaron posiciones contrarias a las formuladas por el autor.
(QWUHODVFUtWLFDVPiVPLQXFLRVDPHQWHFRQRFLGDVVHHQFXHQWUDQODVTXHIRUPXOy
Cannon(QFLHUWRPRGRVHSRGUtDDUPDUTXHODWHRUtDGHODHPRFLyQGH&DQQRQ
VXUJHFRPRUHVXOWDGRGHODVFUtWLFDVTXHHVWHUHDOL]DDODWHRUtDGHODHPRFLyQGH
-DPHV 3DOPHUR /DIXQGDPHQWDFLyQGHODFUtWLFDGH&DQQRQVHFHQWUDHQOD
formulacin que haba propuesto James al equiparar la emocin con los cambios
corporales. De ah se sigue que: a  GLVWLQWDV HPRFLRQHV GHEHQ LU DFRPSDxDGDV
de diferentes estados corporales; b  ODV HPRFLRQHV SXHGHQ VHU PDQLSXODGDV FRQ
drogas que tienen efectos corporales particulares. As, el autor establece cinco
DUJXPHQWRVTXHFXHVWLRQDQODVDUPDFLRQHVGH-DPHV ORVFDPELRVFRUSRUDOHVTXH
segn James, proporcionan el feedback al cerebro para originar la emocin pueden ser
HOLPLQDGRVFRPSOHWDPHQWHVLQSHUWXUEDUODVHPRFLRQHVGHXQRUJDQLVPR ORV
FDPELRVFRUSRUDOHVTXHVHSURGXFHQHQORVHVWDGRVHPRFLRQDOHVQRVRQHVSHFtFRV
de una emocin, ya que algunos cambios corporales son comunes a varias emocio-
QHV ORVyUJDQRVLQWHUQRVTXHVXSXHVWDPHQWHSURSRUFLRQDQHOfeedback al cere-
bro para la experiencia emocional, no son estructuras muy sensitivas; en concreto,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 167 Manual de teoras emocionales y motivacionales - UJI
HOQ~PHURGHEUDVQHUYLRVDVTXHSURFHGHGHORVyUJDQRVLQWHUQRV\VHGLULJHDOFH-
UHEURHIHUHQFLDVGHORVyUJDQRVLQWHUQRVKDFLDHOFHUHEURHVWiHQXQDSURSRUFLyQ
GHUHVSHFWRDOQ~PHURGHEUDVQHUYLRVDVTXHSURFHGHGHOFHUHEUR\VHGLULJH
DORVyUJDQRVLQWHUQRVDIHUHQFLDVGHORVyUJDQRVLQWHUQRVGHVGHHOFHUHEUR ORV
cambios que ocurren en los rganos internos son demasiado lentos para producir la
emocin; muchas veces, la experiencia de la emocin es inmediata, mientras que
el feedback desde los rganos internos hasta el cerebro puede tardar varios segun-
dos; por lo tanto, la emocin ocurre antes de que culmine el circuito de feedback;
 ODPDQLSXODFLyQH[SHULPHQWDOGHORUJDQLVPRSDUDSURGXFLUFDPELRVFRUSRUDOHV
no produce una verdadera emocin. Estos argumentos ponen de relieve que los
SDWURQHVSVLFRVLROyJLFRVDVRFLDGRVFRQODVHPRFLRQHVQRVRQORVXFLHQWHPHQWH
HVSHFtFRVFRPRSDUDSHUPLWLUODGLIHUHQFLDFLyQHQWUHODVHPRFLRQHV

(Q JHQHUDO &DQQRQ GHHQGH TXH ODV HPRFLRQHV WLHQHQ OD IXQFLyQ GH SUHSDUDU DO
organismo ante situaciones de emergencia, por lo que los cambios corporales y las
emociones se producen al mismo tiempo; mientras que, para James los cambios cor-
porales anteceden a la emocin. As pues, para Cannon lo verdaderamente importan-
te en la ocurrencia de la emocin no se encuentra fuera del sistema nervioso central,
por lo que, frecuentemente, su planteamiento tambin ha sido denominado teora
neural central de la emocin, aunque tambin ha recibido otras denominaciones
FRPRWHRUtDWDOiPLFDGHODVHPRFLRQHVRODWHRUtDFHQWUDOGHODVHPRFLRQHVODWHRUtD
GHODHPHUJHQFLDRODWHRUtDGHQHXURVLROyJLFDGHODHPRFLyQ

/DLGHDSULQFLSDOTXHVXE\DFHDODWHRUtDGH&DQQRQ%DUGHVTXHODHPRFLyQVH
SURGXFHFRPRFRQVHFXHQFLDGHODDFWLYDFLyQGHOWiODPR/DVQHXURQDVWDOiPLFDV
se encargan, por una parte, de la activacin de los msculos y las vsceras, y por
otra, de facilitar feedbackLQIRUPDWLYRDODFRUWH]D&RPRFRQVHFXHQFLDORVFDP-
ELRVFRUSRUDOHV\ODH[SHULHQFLDHPRFLRQDORFXUUHQVLPXOWiQHDPHQWH'HVGHHVWD
ySWLFDHOWiODPRVHFRQVLGHUDODHVWUXFWXUDVXEFRUWLFDOFRQWURODGRUDGHODVHPRFLR-
nes, por lo que tambin se le conoce como la teora central de las emociones. En
HVWHVHQWLGRHOWiODPRVHUtDHOVXVWUDWRELROyJLFRGHODH[SHULHQFLDHPRFLRQDO\HO
KLSRWiODPRHOVXVWUDWRELROyJLFRGHOFRPSRUWDPLHQWRHPRFLRQDO

Por otra parte, para Cannon no exista una correspondencia entre un tipo de emo-
FLyQ\XQRVFDPELRVFRUSRUDOHVFRQFUHWRVVLQRTXHODHPRFLyQVHFDUDFWHUL]DSRU
la activacin general del organismo; es decir, propone la activacin de un siste-
ma general de defensa que preparara al organismo para enfrentarse a situaciones
aversivas mediante las conductas de lucha o huida. De ah el nombre de teora de
ODHPHUJHQFLDFX\DLGHDHVTXHHORUJDQLVPRHVWiSURJUDPDGRSDUDORJUDUPDQWH-
ner un nivel ptimo de adaptacin, que se encuentra perturbado por la ocurrencia
de las emociones. Estas sealan un estado de emergencia, ante las cuales el orga-
nismo intenta recuperar su nivel ptimo de adaptacin.

(Q~OWLPDLQVWDQFLDVHSXHGHGHFLUTXHXQDGHODVDSRUWDFLRQHVPiVUHOHYDQWHVHV
ODH[LVWHQFLDGHFHQWURVHVSHFtFRVHQHOVLVWHPDQHUYLRVRFHQWUDOTXHVHHQFDUJD-
ran de la experiencia emocional, lo que propici el desarrollo de la investigacin
neurolgica en el estudio de la emocin.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 168 Manual de teoras emocionales y motivacionales - UJI
7HRUtDVGHODDFWLYDFLyQ

Desde este tipo de planteamientos, se intentan explicar las emociones a partir de
los mecanismos de activacin del organismo. Como sealamos anteriormente, en
el apartado correspondiente a la evolucin de los planteamientos en psicologa de
la motivacin, en estos acercamientos se hace difcil establecer diferencias entre
los trminos activacin, motivacin y emocin3RUHVDUD]yQDXQTXHHQJHQH-
ral nos remitimos a lo expuesto en dicho epgrafe, nos detendremos en las apor-
WDFLRQHV FRQFUHWDV GH DOJXQRV DXWRUHV FRPR 'XII\   /LQGVOH\ 6FKUHLQHU
.QRZOHV\0DJRXQ  /LQGVOH\  \/DFH\  SRUVXWUDVFHQGHQFLD
en el estudio de las emociones.

'XII\   SODQWHD TXH OD HPRFLyQ FRQVLVWH HQ OD PRYLOL]DFLyQ GH HQHUJtD HQ
un organismo para que este lleve a cabo una actividad intensa. Esto es: la mo-
YLOL]DFLyQ GH HQHUJtD es la emocin. Este planteamiento es bastante parecido al
TXH GHHQGH &DQQRQ FXDQGR HVWH VH UHHUH D OD teora de la emergencia en la
emocin en trminos de preparacin del organismo para ofrecer una respuesta de
OXFKDRKXLGD$VtHOVLVWHPDTXHSURSRQH'XII\HVFRPSOHWDPHQWHKRPHRVWiWLFR
Debido a los cambios constantes que se producen en el ambiente al que se enfrenta
el sujeto, este tambin experimenta constantes cambios en su nivel de activacin,
para lograr adaptarse de la mejor forma posible a las demandas impuestas por el
DPELHQWH/DIXQGDPHQWDFLyQGHOSODQWHDPLHQWRGH'XII\VHEDVDHQXQDSUHPLVD
IXQGDPHQWDOODFRQGXFWDSXHGHVHUGHVFULWDHQWpUPLQRVGHORVSDUiPHWURVGHdi-
reccin aproximacin o evitacin y de intensidad UiSLGDROHQWDYLJRURVDR
tenue de la misma.

(ODUJXPHQWRLQLFLDOIXHPDQWHQLGRSRVWHULRUPHQWHSRUODDXWRUD 'XII\ SUR-


poniendo que la descripcin de cualquier conducta en un momento dado se debe
H[SOLFDU PHGLDQWH GRV DVSHFWRV EiVLFRV activacin, entendida como sinnimo de
intensidad, y direccin, entendida como sinnimo de la dimensin aproximacin-
HYLWDFLyQ7DQWRODDFWLYDFLyQFRPRODGLUHFFLyQGHODFRQGXFWDSXHGHQVHUDSOLFDGDV
perfectamente a cualquier forma de manifestacin conductual, sea esta abierta y
PDQLHVWDRHQFXELHUWD/RVGRVFRQFHSWRVLQWHUDFW~DQHQWUHVtDXQTXHSXHGHQVHU
PHGLGRV GH IRUPD LQGHSHQGLHQWH 'H ORV GRV FRPSRQHQWHV HVHQFLDOHV DFWLYDFLyQ
\GLUHFFLyQ 'XII\SODQWHDTXHODDFWLYDFLyQHVHOPiVLPSRUWDQWH\DTXHHVXQD
GLPHQVLyQTXHVXE\DFHDWRGDVODVFRQGXFWDVVHDQHVWDVPDQLHVWDVRQR(QDPERV
FDVRVODDFWLYDFLyQHVXQDIXQFLyQGLUHFWDGHODDFWLYDFLyQVLPSiWLFDSXGLpQGRVH
PHGLUDWUDYpVGHYDULRVtQGLFHVSVLFRVLROyJLFRVFRPRODIUHFXHQFLDFDUGLDFDOD
FRQGXFWDQFLD FXWiQHD OD WHQVLyQ PXVFXODU HWF (VWH KHFKR OOHYD DO DXWRU D SODQ-
tear la existencia de un problema con algunos conceptos psicolgicos, tales como
la emocin. As, la emocin presupone las dimensiones de activacin y direccin de la
FRQGXFWDFXDQGRVRORFRQODDFWLYDFLyQVHUtDVXFLHQWHSDUDH[SOLFDUODVFRQGXFWDV
emocionales. Por tanto, la emocin debera ser suprimida del espectro psicolgico y
VXVWLWXLGDSRUODDFWLYDFLyQ/DSULPHUDUD]yQSDUDVXJHULUODVXSUHVLyQGHOWpUPLQR
emocinHVTXHJHQHUDOPHQWHVHXWLOL]DSDUDUHIHULUVHDOH[WUHPRGHXQFRQWLQXRGH
FRQGXFWD7RGDFRQGXFWDHVPRWLYDGDVLQODPRWLYDFLyQQRKD\DFWLYLGDGORTXHVH
denomina emocin representa un extremo del continuo motivacin.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 169 Manual de teoras emocionales y motivacionales - UJI
Por su parte, /LQGVOH\ tambin puede ser considerado como uno de los autores
pioneros en el estudio de la activacin HQSVLFRORJtD/LQGVOH\FRQVXteora de
la activacin en las emociones  IXHTXLHQSULPHURLQWHQWDHVWDEOHFHUXQD
correspondencia entre el continuo en los fenmenos psicolgicos y el continuo en
HOUHJLVWURGHODDFWLYLGDGHOHFWURHQFHIDORJUiFD&RQFUHWDPHQWHSHQVDEDTXHORV
HVWDGRVSVLFROyJLFRVFDUDFWHUL]DGRVSRUODPi[LPDYLJLOLDODPi[LPDH[FLWDFLyQ
ODPi[LPDYLJLODQFLDRDOHUWDODPi[LPDHPRFLyQVHFRUUHVSRQGtDQFRQORVULWPRV
HOHFWURHQFHIDORJUiFRVFDUDFWHUL]DGRVSRUODPD\RUIUHFXHQFLDRFLFORVSRUVHJXQ-
do. De hecho, el ritmo beta y el ritmo alfa, que son los de mayor frecuencia, seran
los caractersticos de la fase de vigilia, mientras que los ritmos theta y delta, que
son los de menor frecuencia, seran los caractersticos de la fase de sueo. A partir
GHO LQXMR GH OD LQIRUPDFLyQ VRPiWLFD VHQVRULDO \ YLVFHUDO VREUH OD IRUPDFLyQ
reticular se podran explicar todos los niveles conductuales, desde el sueo hasta
la vigilia, desde la vigilia relajada hasta la activacin en la solucin de problemas,
GHVGHODPRGHUDFLyQDIHFWLYDKDVWDODH[FLWDFLyQHPRFLRQDO$VtVHJ~Q/LQGVOH\
ODWHRUtDGHODDFWLYDFLyQVHEDVDHQORVVLJXLHQWHVSUHVXSXHVWRV HQHOHVWDGRGH
emocin, el electroencefalograma muestra la respuesta caracterstica de alerta: es
GHFLUEDMRYROWDMH\DOWDIUHFXHQFLD VHSXHGHLQGXFLUODUHDFFLyQGHDOHUWDPLHQWR
FRQODHVWLPXODFLyQGHOVLVWHPDUHWLFXODUGHOPHVHQFpIDOR\GHOGLHQFpIDOR OD
GHVWUXFFLyQGHHVWDViUHDVLPSLGHODUHDFFLyQGHDOHUWD   GHVSXpV GH SURGXFLU
dicha destruccin, la imagen del comportamiento que resulta es incompatible
con la excitacin emocional o con el alertamiento; es decir, hay una preponde-
UDQFLDGHODDSDWtD\ODVRPQROHQFLD\ ORVPHFDQLVPRVPRWRUHVGHODH[SUHVLyQ
emocional, o bien son idnticos, o bien se sobreponen a los de la activacin del
electroencefalograma.

5HVSHFWRDODVFDUDFWHUtVWLFDVGHHVWDDFWLYDFLyQHQODIRUPDFLyQUHWLFXODU/LQGVOH\
ODVUHVXPHGHOVLJXLHQWHPRGR a GHVGHXQSXQWRGHYLVWDHOHFWURFRUWLFDOVHRE-
serva, no solo el despertarHQODFRUWH]DGHODQLPDODQHVWHVLDGRVLQRWDPELpQXQD
UHDFFLyQFRUWLFDOJHQHUDOL]DGDH[WUHPDGDPHQWHLQWHQVDVLPLODUDODSURYRFDGDSRU
XQDGHVFDUJDHPRFLRQDOHVWHVLVWHPDHVGLVWLQWRDOVLVWHPDHVSHFtFRTXHYDDORV
Q~FOHRVWDOiPLFRVHVSHFtFRV b GHVGHHOSXQWRGHYLVWDFRQGXFWXDOVHREVHU-
YDQHIHFWRVIDFLOLWDGRUHVHLQKLELGRUHVGHSHQGLHQGRGHOiUHDHVWLPXODGDDVtFRPR
GLVWLQWRVVLJQRVGHPLHGR\RFyOHUD\ c GHVGHHOSXQWRGHYLVWDGHODVUHVSXHVWDV
DXWRQyPLFDV\YLVFHUDOHVVHREVHUYDQHIHFWRVGHDFWLYDFLyQVLPSiWLFDWDOHVFRPR
dilatacin pupilar, incremento en la tasa de respiracin, incremento en la presin
VDQJXtQHDHLQKLELFLyQGHODDFWLYLGDGJiVWULFRLQWHVWLQDO

'H HVWD PDQHUD HQ OD WHRUtD GH /LQGVOH\ HO WpUPLQR activacin es sinnimo de
GHVLQFURQL]DFLyQHOHFWURFRUWLFDOSXGLHQGRHQFRQWUDUODPtQLPDDFWLYDFLyQHQODV
VLWXDFLRQHVGHDXVHQFLDRPtQLPDHPRFLyQ\ODPi[LPDDFWLYDFLyQHQODVVLWXD-
FLRQHVGHPi[LPDH[FLWDFLyQHPRFLRQDO(VWDLGHDHUDSHUIHFWDPHQWHFRPSDWLEOH
con el descubrimiento de las propiedades activadoras de la formacin reticular, ya
que las lesiones producidas sobre esta estructura eliminaban los signos de desin-
FURQL]DFLyQRORTXHHVORPLVPRORVVLJQRVGHDFWLYDFLyQ,JXDOPHQWHVHSXGR
UDWLFDU\FRQVWDWDUTXHFXDQGRVHHVWLPXODEDODIRUPDFLyQUHWLFXODUVHSURGX-
ca un incremento en la activacin del sujeto. Sin embargo, esta formulacin,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 170 Manual de teoras emocionales y motivacionales - UJI
aparentemente impecable, dejaba fuera una variable fundamental: el rendimiento,
entendido como adaptacin, capacidad de respuesta, ajuste. En efecto, la pionera
IRUPXODFLyQGH/LQGVOH\FKRFDEDFRQODHYLGHQFLDHPStULFD\DTXHHQDOJXQRV
WUDEDMRV )XVWHU VHSRGtDDSUHFLDUTXHVLELHQORVLQFUHPHQWRVUHGXFLGRVHQ
la estimulacin de la formacin reticular permitan obtener un incremento en el
rendimiento de los sujetos experimentales, cuando la intensidad de la estimulacin
LEDPiVDOOiGHXQHYHQWXDOSXQWR WHyULFD\JHQpULFDPHQWHGHQRPLQDGRpunto p-
timo de activacin HOUHQGLPLHQWRQRDXPHQWDEDLQFOXVRFRPHQ]DEDDGLVPLQXLU
/OHJDEDXQPRPHQWRHQHOFRQWLQXRGHODDFWLYDFLyQHQHOTXHVHURPStDODWHQGHQ-
cia paralela entre activacin y rendimiento, ya que, aunque la activacin siguiera
VXELHQGRHOUHQGLPLHQWRFRPHQ]DEDDGHVFHQGHU&RPRHVOyJLFRWDOHVKDOOD]JRV
QRHUDQFRPSDWLEOHVFRQHODUJXPHQWRGHIHQGLGRSRU/LQGVOH\3DUDVROYHQWDUHVWD
GLFXOWDG/LQGVOH\SODQWHDTXHH[LVWHXQDLQWHUFRPXQLFDFLyQHQWUHFRUWH]DFHUHEUDO
y formacin reticular. De este modo, la formacin reticular debe funcionar como un
JUDQKRPHRVWDWRGHDFWLYDFLyQ\DTXHGHVGHODFRUWH]DGHVFHQGHUtDQSUR\HFFLRQHV
que controlaran el funcionamiento de la formacin reticular, posibilitando, as, que
ODDFWLYDFLyQVHPDQWXYLHUDHQORVOtPLWHVDSURSLDGRVTXHHVHQGHQLWLYDORTXHXQ
RUJDQLVPRQHFHVLWDSDUDIXQFLRQDUDGHFXDGDPHQWH\UHQGLUDOPi[LPR

Por su parte, /DFH\   SODQWHD XQ DUJXPHQWR FHQWUDGR HQ OD GLFXOWDG TXH
tienen las teoras de la activacin para explicar la integracin de diversos sistemas
GHORUJDQLVPRHQXQHVTXHPDXQLWDULR/DFH\SURSRQHORTXHVHGHQRPLQDteora
de la disociacin de sistemasTXHSHUPLWHGHIRUPDPiVFRKHUHQWHH[SOLFDUORV
GLYHUVRVUHVXOWDGRVTXHVHKDQREWHQLGRFXDQGRVHLQWHQWDEDYHULFDUHPStULFD-
mente la teora de la activacin desde la perspectiva del antedicho proceso unita-
ULR6HJ~QHOPRGHORGH/DFH\JHQHUDOPHQWHDFHSWDGRHQODDFWXDOLGDGVHHVWD-
blece que la activacin puede manifestarse mediante tres posibilidades de respuesta
HOHFWURFRUWLFDOVLROyJLFDDXWRQyPLFD\PRWRUD QRVLHQGRQHFHVDULDODH[LVWHQFLD
de correlacin entre ellas. Por lo tanto, la activacin es multidimensional. El triple
VLVWHPDGHUHVSXHVWDHVXQRGHORVSDUDGLJPDVH[SHULPHQWDOHVTXHPiVVHKDXWLOL-
]DGRHQSVLFRVLRORJtDGHODHPRFLyQFRQUPiQGRVHGHIRUPDVLVWHPiWLFDTXHOD
SURSXHVWDGH/DFH\HVFRUUHFWDHQWUHRWUDVUD]RQHVSRUTXHHORUJDQLVPRWLHQGHD
ODKRPHRVWDVLV\DODSDUVLPRQLD 3DOPHUR 

3RU RWUR ODGR /DFH\ WDPELpQ SODQWHD OR TXH VH GHQRPLQD HVSHFLFLGDG GH OD
respuesta autnoma, para referirse al hecho de que, dentro de un mismo sistema,
VHSXHGHREVHUYDUXQDGLVRFLDFLyQGHUHVSXHVWD/DDUJXPHQWDFLyQGHODHVSHFL-
FLGDGGHUHVSXHVWDDXWyQRPDVHIXQGDPHQWDHQODVVLJXLHQWHVFRQVLGHUDFLRQHV
 HOVLVWHPDQHUYLRVRDXWyQRPRUHDOPHQWHUHVSRQGHFRPRXQWRGRDOHVWUpVH[-
perimentalmente impuesto, en el sentido de que todas las estructuras inervadas
SDUHFHQ HVWDU DFWLYDGDV HQ OD GLUHFFLyQ GHO SUHGRPLQLR GHO VLVWHPD VLPSiWLFR
 VLQHPEDUJRQRHVXQDUHVSXHVWDFRPRXQWRGRHQHOVHQWLGRGHTXHWRGDVODV
estructuras autonmicamente inervadas exhiban iguales incrementos o disminu-
ciones en su funcionamiento. Se suelen observar sorprendentes diferencias intra
LQGLYLGXDOHVHQHOJUDGRHQTXHVHDFWLYDQODVGLVWLQWDVIXQFLRQHVVLROyJLFDV(V
HVWH XQ DVSHFWR TXH GHVGH VX LQLFLDO IRUPXODFLyQ SRU /DFH\ KD WUDWDGR GH VHU
YHULFDGRHPStULFDPHQWHFRQUHVXOWDGRVKHWHURJpQHRVGHELGRHVHQFLDOPHQWHD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 171 Manual de teoras emocionales y motivacionales - UJI
ODVGLFXOWDGHVPHWRGROyJLFDVTXHPXFKDVYHFHVH[LVWHQHQHVWHWLSRGHLQYHVWL-
gaciones.

(Q~OWLPDLQVWDQFLDDSDUWLUGHORVSLRQHURVWUDEDMRVGH/DFH\ /DFH\\/DFH\
 SDUHFHHYLGHQWHTXHHQSULPHUOXJDUORVLQGLYLGXRVQRPXHVWUDQFDPELRV
concordantes en todas las medidas en respuesta a una situacin emocional parti-
cular; en segundo lugar, existen notables diferencias entre los sujetos en cuanto a
los patrones de cambio que se observan; en tercer lugar, los individuos muestran
pautas comunes de repuesta en diferentes situaciones emocionales; y, por ltimo,
pero no menos importante, estas pautas de respuesta se mantienen a lo largo de
largos perodos de tiempo.

7HRUtDVQHXURELRORJLFLVWDV
A partir de los trabajos de Cannon y Bard surgen algunos planteamientos inte-
UHVDQWHVHQORVTXHVHSRQHGHPDQLHVWRODUHOHYDQFLDGHOVLVWHPDOtPELFR\GHO
KLSRWiODPRSDUDHQWHQGHUHOVXVWUDWRELROyJLFRGHODH[SHULHQFLD\GHOFRPSRUWD-
PLHQWR HPRFLRQDOHV 3DOPHUR   (QWUH ORV SODQWHDPLHQWRV PiV GHVWDFDGRV
YHUHPRVDFRQWLQXDFLyQORVGH3DSH]0DF/HDQ2OGV\0LOQHU

Papez  SODQWHDXQDWHRUtDYiOLGDSDUDODHPRFLyQVHJ~QODFXDOODVHVWUXF-


turas neurales del cerebro antiguoHVWiQXQLGDVDODFRUWH]D/DHVWUXFWXUDFLyQGH
estas conexiones recibe el nombre genrico de circuito de Papez/DIRUPXODFLyQ
GH3DSH]DFHQW~DODLGHDGHTXHHQORVYHUWHEUDGRVLQIHULRUHVH[LVWHQFRQH[LRQHV
DQDWyPLFDV\VLROyJLFDVHQWUHORVKHPLVIHULRVFHUHEUDOHV\HOWiODPRGRUVDOHKL-
SRWiODPRVLHQGRGLFKDVUHODFLRQHVPiVHODERUDGDVHQHOFHUHEURGHORVPDPtIHURV
/DHPRFLyQVHJ~Q3DSH]HVWiPHGLDGDSRUODVFRQH[LRQHVFyUWLFRKLSRWDOiPLFDV
e implica la expresin conductual y la experiencia subjetiva, aspectos estos que
SXHGHQVHUGLVRFLDGRVDOPHQRVHQHOVHUKXPDQR/DSDUWLFLSDFLyQWDOiPLFDWDP-
bin es importante en la emocin, ya que las aferencias sensoriales que llegan
KDVWDGLFKDHVWUXFWXUDVHGLIXQGHQHQWUHVGLUHFFLRQHVDODFRUWH]DFHUHEUDODORV
JDQJOLRVEDVDOHV\DOKLSRWiODPR/DUXWDKDFLDODFRUWH]DUHSUHVHQWDODcorriente
de pensamiento, la ruta hacia los ganglios basales la corriente de movimiento, y la
UXWDKDFLDHOKLSRWiODPRODcorriente de sentimiento.

Desde el punto de vista de la emocin, lo verdaderamente importante en la for-


PXODFLyQGH3DSH]WLHQHTXHYHUFRQODcorriente de sentimiento, dirigida hacia el
KLSRWiODPRGHVGHHOWiODPR$VtGHVGHHOKLSRWiODPRORVHVWtPXORVHPRFLRQDOHV
son transmitidos en dos direcciones: hacia abajo, hacia el sistema nervioso pe-
ULIpULFR\KDFLDDUULEDKDFLDODFRUWH]DFHUHEUDO$OJXQDVYHFHVODcorriente de
sentimientoVHGLULJHGLUHFWDPHQWHGHVGHHOKLSRWiODPRKDFLDHOWURQFRHQFpIDOR\
la mdula espinal, y de ah al sistema nervioso perifrico. Es decir, algunas veces,
ORV HVWtPXORVHPRFLRQDOHVSURYRFDQGLUHFWDPHQWHODFRQGXFWDHPRFLRQDO2WUDV
veces, la corriente de sentimientoVHGLULJHGHVGHHOKLSRWiODPRKDFLDODFRUWH]D
FHUHEUDO(QHVWDVRFDVLRQHVODFRUWH]DGHOFtQJXORUHFLEHODHVWLPXODFLyQHPR-
cional, cuyos efectos se traducen en percepciones, pensamientos y actitudes. Por

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 172 Manual de teoras emocionales y motivacionales - UJI
~OWLPRRWUDVYHFHVODLQIRUPDFLyQSXHGHVHUWUDQVPLWLGDGHVGHODFRUWH]DFHUHEUDO
KDVWDHOKLSRFDPSR\GHDKtDOKLSRWiODPR(VWHFLUFXLWRSHUPLWHDODFRUWH]DFHUH-
EUDOFRQJXUDUODVUHDFFLRQHVHPRFLRQDOHV

(QVXPDSDUD3DSH]ODH[SUHVLyQGHODVHPRFLRQHVLPSOLFDXQFRQWUROKLSRWD-
OiPLFR GH ORV yUJDQRV YLVFHUDOHV PLHQWUDV TXH ORV VHQWLPLHQWRV VXUJHQ GH ODV
FRQH[LRQHVGHXQFLUFXLWRTXHLQFOX\HHOKLSRWiODPRORVFXHUSRVPDPLODUHVHO
Q~FOHRDQWHULRUWDOiPLFR\ODFRUWH]DFLQJXODGD(VGHFLUODVHVWUXFWXUDVQHXURDQD-
WyPLFDVTXHFRQIRUPDQHOFLUFXLWRGH3DSH]GHFX\RIXQFLRQDPLHQWRGHSHQGHQODV
emociones, se relacionan con el llamado gran lbulo lmbico+R\FRQRFHPRVTXH
el circuito de Papez HVWiHVWUHFKDPHQWHUHODFLRQDGRFRQODH[SHULHQFLD\H[SUHVLyQ
HPRFLRQDOHV /DV HVWUXFWXUDV TXH OR FRQIRUPDQ VRQ HO KLSRFDPSR HO IyUQL[ HO
WiODPRDQWHULRUODFRUWH]DFLQJXODGD\ODDPtJGDOD

2WUR SODQWHDPLHQWR GHULYDGR GH ODV DSRUWDFLRQHV GH &DQQRQ HV HO GH MacLean
 TXLHQSURSRQHTXHHOOyEXOROtPELFR\GHWHUPLQDGDV
estructuras subcorticales relacionadas constituyen un sistema funcional: el sistema
lmbico. Este sistema ha sido denominado tambin cerebro visceral, debido a su
importante papel en la regulacin de la actividad visceral en una amplia variedad
GHHPRFLRQHV/DFRQFHSFLyQGH0DF/HDQFRQVWLWX\HXQDLPSRUWDQWHDSRUWDFLyQ
al estudio de las emociones. En ella se pone de relieve que el encfalo humano
puede ser considerado como un sistema de tres capas, o tres tipos distintos de cere-
EURVXSHUSXHVWRVXQRVREUHRWURGHWDOVXHUWHTXHFDGDXQRGHHOORVHVWiFRQIRUPDGR
por diferentes estructuras anatmicas y diferentes procesos qumicos. En la argu-
PHQWDFLyQGH0DF/HDQVHSURSRQHTXHODFDSDPiVDQWLJXD\SURIXQGDUHSUHVHQWD
QXHVWUDKHUHQFLDHQFHIiOLFDUHSWLOLDQD\DSDUHFHHQODRUJDQL]DFLyQDFWXDOGHOWURQ-
coencfalo. Esta capa del encfalo recibe el nombre de cerebro reptiliano, y es res-
SRQVDEOHGHODFRQGXFWDLQVWLQWLYDDXWRPiWLFDFRQGXFWDPXFKDVYHFHVQHFHVDULD
SDUDODVXSHUYLYHQFLDGHORUJDQLVPR UHVSLUDU &RQHOWLHPSRVHGHVDUUROOyRWUD
capa sobre el ncleo reptiliano. Esta segunda capa, denominada cerebro mamfero
antiguo, se encarga de la conservacin de la especie y del individuo, incluyendo
las estructuras neurales que median en las emociones, la alimentacin, la evitacin
\HOHVFDSHODOXFKD\ODE~VTXHGDGHSODFHU/DVHVWUXFWXUDVUHOHYDQWHVGHHVWD
capa corresponden al sistema lmbico. Con una mayor progresin de la evolucin,
DSDUHFHXQDWHUFHUD\SRUHOPRPHQWRGHQLWLYDFDSDVREUHODVGRVDQWHULRUHV
Esta tercera capa se denomina cerebro mamfero nuevo, y es responsable de las
estrategias racionales y de la capacidad verbal. Con este sistema, se puede enten-
GHUODFRPSOHMLGDGGHORVDVSHFWRVH[SHULHQFLDOHVVLROyJLFRV\FRQGXFWXDOHVGH
la emocin, aspectos que permiten considerar las emociones como procesos que
se encuentran muy relacionados con la conducta adaptativa.

/DV WUHV IRUPDV GH FHUHEUR FRQVWLWX\HQ XQ PXQGR LQWHUQR HQ HO FXDO HO FHUHEUR
UHSWLOLDQRHVWiVLHQGRFRQVWDQWHPHQWHERPEDUGHDGRSRUORVLPSXOVRVHOFHUHEUROtP-
ELFRQRVHVWiIRU]DQGRFRQWLQXDPHQWHDFRQVLGHUDUHODPELHQWHJHQHUDOVHJ~QSDWURQHV
HVWpWLFRV\HOQHRFHUHEURIXQFLRQDSDUDSHUPLWLUODVGLVFULPLQDFLRQHVPiVQDV(O
sistema lmbico en particular, o el cerebro mamfero antiguo, integra la experien-
cia emocional, mientras que la estructura implicada en la expresin emocional es,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 173 Manual de teoras emocionales y motivacionales - UJI
SUREDEOHPHQWHHOKLSRWiODPR/DVUD]RQHVTXHHVJULPH0DF/HDQVRQODVVLJXLHQ-
tes: a SRUXQDSDUWHHOVLVWHPDOtPELFRSRVHHH[WHQVDVFRQH[LRQHVVXEFRUWLFDOHV
b SRURWUDSDUWHHOVLVWHPDOtPELFRHVOD~QLFDSDUWHGHODFRUWH]DTXHWLHQHUHSUH-
sentacin visceral.

(QHVWDDUJXPHQWDFLyQGH0DF/HDQHOKLSRFDPSR\ODDPtJGDODSRVHHQXQDHVSHFLDO
UHOHYDQFLDHQHODVSHFWRVXEMHWLYRGHODHPRFLyQ$GLIHUHQFLDGH3DSH]0DF/HDQQR
LQWHQWDWUD]DUXQFLUFXLWRHVSHFtFRSDUDODVHPRFLRQHVSXHVGHHQGHTXHWRGDVODV
estructuras en el sistema lmbico parecen estar implicadas en la emocin.

(QUHODFLyQDORVWUDEDMRVGH0DF/HDQXQDGHODVDSRUWDFLRQHVPiVVXJHUHQWHV
HQ ORV ~OWLPRV DxRV HV OD SURSXHVWD SRU /DQH   KDEODQGR GH ORV GLVWLQWRV
QLYHOHVGHFRPSOHMLGDGFHUHEUDOMHUiUTXLFDPHQWHRUJDQL]DGRV$SDUWLUGHOWUDEDMR
GH/DQHHVIDFWLEOHH[SOLFDUFyPRHOSURFHVDPLHQWRGHODLQIRUPDFLyQHPRFLRQDO
puede ocurrir de forma consciente, y por debajo de los umbrales de la consciencia.
&RQFUHWDPHQWHHODXWRUSODQWHDODH[LVWHQFLDGHFLQFRFDSDVR]RQDVTXHGHVGH
ODVPiVLQIHULRUHVKDVWDODVVXSHULRUHVVHUtDQODVVLJXLHQWHVWURQFRHQFpIDORGLHQ-
FpIDORVLVWHPDOtPELFRVLVWHPDSDUDOtPELFR\FRUWH]DSUHIURQWDO7RGDVHVWDV]RQDV
o capas neuroanatmicas pueden participar en el control de la emocin. En las tres
FDSDVPiVLQIHULRUHVHOSURFHVDPLHQWRGHODHVWLPXODFLyQSHUPLWLUtDHOLQLFLRGH
respuestas emocionales sin que llegue a producirse la experiencia consciente de la
PLVPD6RORFXDQGRHVWiQLPSOLFDGDVODVGRV]RQDVVXSHULRUHV VLVWHPDSDUDOtPEL-
FR\FRUWH]DSUHIURQWDO VHSURGXFHODH[SHULHQFLDVXEMHWLYDGHODHPRFLyQ

Por ltimo, Olds \0LOQHU  SURSRQHQODLPSOLFDFLyQGLUHFWDGHOVLVWHPDOtP-


ELFR HQ ODV HPRFLRQHV VXVWUDWR JHQHUDO GH ODV HPRFLRQHV  'LFKR VLVWHPD HVWi
FRPSXHVWRSRUODVHVWUXFWXUDVVLJXLHQWHViUHDVHSWDODPtJGDODFRUWH]DGHOFtQJX-
ORHKLSRFDPSRDGLFLRQDOPHQWHWLHQHFRQH[LRQHVFRQHOKLSRWiODPR\HOQ~FOHR
DQWHULRUGHOWiODPR

3RURWURODGR\GHIRUPDDFFLGHQWDOORVDXWRUHVGHVFXEULHURQORVFHQWURVVLROy-
JLFRVLPSOLFDGRVHQHOUHIXHU]R'HHQGHQTXHHOFHUHEURWLHQHFHQWURVGHSODFHU
FHQWURVGHGRORU\FHQWURVQHXWURV/RVH[SHULPHQWRVVREUHODHVWLPXODFLyQHOpF-
WULFDHQGLYHUVDV]RQDVUHYHODQTXHHVWDDFW~DVREUHORVFLUFXLWRVTXHPHGLDQORV
UHIXHU]RVPiVKDELWXDOHV'LFKRVH[SHULPHQWRVUHYHODURQTXHHOVLVWHPDOtPELFR
presenta tres subsistemas: subsitema I relacionado con la olfaccin; subsistema II
LPSOLFDGRHQHOFRQWUROHPRFLRQDOIRUPDGRSRUHOiUHDVHSWDOODDPtJGDOD\
HOKLSRWiODPRDQWHULRUVXEVLVWHPDV,,,IXQFLRQHVQRFRQFUHWDVIRUPDGRSRUOD
FRUWH]DGHOFtQJXORHOKLSRFDPSRHOKLSRWiODPRSRVWHULRU\HOQ~FOHRDQWHULRUGHO
WiODPR'HORVWUHVVXEVLVWHPDVHOVXEVLVWHPD,,HVHOTXHHVWiLPSOLFDGRFRQODV
emociones.

7HRUtDVELRORJLFLVWDVFRQWHPSRUiQHDV
5HVSHFWRDODVDSRUWDFLRQHVPiVUHFLHQWHV\FRQPD\RUUHSHUFXVLyQGHVGHORVSODQ-
WHDPLHQWRVELRORJLFLVWDVVHSXHGHQGHVWDFDUODVGH+HQU\3ULEUDP3DQNVHSS

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 174 Manual de teoras emocionales y motivacionales - UJI
+HQU\VHFHQWUDHQHOSDSHOGHODVKRUPRQDVHQODHPRFLyQ +HQU\\6WHSKHQV
 +HQU\   (Q OtQHDV JHQHUDOHV +HQU\ DSXQWD KDFLD OD LPSOLFDFLyQ GH
ODFRUWH]DHOVLVWHPDOtPELFRORVVLVWHPDVQHXURHQGRFULQRV\HOWURFRHQFpIDORHQOD
HPRFLyQ %DViQGRVH HQ JUDQ PHGLGD HQ ODV DSRUWDFLRQHV SUHYLDV GH 0DF/HDQ
+HQU\DUPDTXHORVHVWtPXORVSVLFRVRFLDOHV\DPELHQWDOHVOOHJDQDOVXMHWRHQ
quien la experiencia pasada y los patrones de conducta genticamente determi-
QDGRVSHUODQHOPRGRPHGLDQWHHOFXDOHOVXMHWRUHDFFLRQDUi/DUHVSXHVWDDHVWDV
GRVIXHQWHV HVWtPXORVHQJHQHUDO\GHWHUPLQDQWHVGHODFRQGXFWD HVSURFHVDGDHQ
el neocrtex y en el sistema lmbico. Posteriormente, desde el sistema nervioso
central parten informaciones hacia la periferia. En este contexto, las emociones
VHHQFXHQWUDQDVRFLDGDVFRQHVSHFtFRVSDWURQHVGHUHVSXHVWDVQHXURHQGRFULQDV
y conductuales. Un aspecto importante en este planteamiento es la percepcin de
FRQWUROTXHWLHQHHOSURSLRLQGLYLGXR\DTXHODVUHVSXHVWDVFRJQLWLYDVVLROyJLFDV
y conductuales, son diferentes segn el control percibido.

Por su parte, Pribram   SURSRQH TXH ODV HVWUXFWXUDV QHXURDQDWyPLFDV LP-
plicadas en las emociones pertenecen al sistema lmbico, siendo la amgdala y
HOKLSRFDPSRODVPiVGLUHFWDPHQWHLPSOLFDGDV(ODXWRUGHVGHXQSODQWHDPLHQWR
claramente biolgico, desarrolla una teora con claras conexiones con la perspec-
tiva cognitiva del procesamiento de informacin. En este marco de referencia,
ODVHPRFLRQHVVRQFRQVLGHUDGDVFRPRSODQHVVLHQGRHVWRVDFWLYDGRVFXDQGRHO
RUJDQLVPRHVWiGHVHTXLOLEUDGR/RVSODQHVSXHGHQVHUGHaccin y pueden ser de
no accin. Cuando son de accin, equivalen a procesos motivacionales, mientras
que, cuando son de no accin, equivalen a procesos emocionales. Posteriormente,
3ULEUDP  FRQORVFRPHQWDGRVSODQWHDPLHQWRVQHXURVLROyJLFRV\FRJQLWL-
vos, pone de relieve la importancia de determinadas estructuras neuroanatmicas,
FRPRODDPtJGDODSDUDSURFHVDULQIRUPDFLyQUHOHYDQWH/DH[SUHVLyQHPRFLRQDO
HVPiVSULPLWLYD\EiVLFDTXHODFRQGXFWDUDFLRQDO

$VLPLVPRQRVJXVWDUtDGHVWDFDUXQRGHORVWUDEDMRVFOiVLFRVGHODXWRU 3ULEUDP
 HQHOTXHVHSRQHGHPDQLHVWRTXHSDUHFHHYLGHQWHTXHGHWHUPLQDGDVHPR-
ciones tienen un claro sustrato biolgico que las controla, motivando al sujeto para
UHDOL]DUXQDFRQGXFWD HVHVWHHOFDVRGHODLPSOLFDFLyQGLUHFWDGHODDPtJGDODHQ
ODHPRFLyQGHLUD\HQODHYHQWXDOPDQLIHVWDFLyQSRVWHULRUGHFRQGXFWDDJUHVLYD 
No obstante, tambin parece que otros factores, como los sociales, juegan un im-
portante papel.

Por su parte, segn Panksepp  ODFRUWH]DHMHUFHVXVSULQFLSDOHVHIHFWRVGH


IRUPDLQKLELGRUDVREUHODVWHQGHQFLDVDIHFWLYDVPiVSULPLWLYDVSXHVORVVLVWHPDV
HPRFLRQDOHVEiVLFRVSDUHFHQHVWDUFRQWURODGRVGHVGHHVWUXFWXUDVVXEFRUWLFDOHV(O
DXWRUSURSRQHODH[LVWHQFLDGHFLUFXLWRVFHUHEUDOHVHVSHFtFRVLPSOLFDGRVHQHPR-
ciones tambin concretas, que se encargan de activar las tendencias de accin de
las emociones. Por ejemplo, la emocin de miedo se asocia con la estructura septo-
KLSRFiPSLFDLPSOLFDGRHQHOVLVWHPDGHLQKLELFLyQFRQGXFWXDO

(VWDVSULPHUDVH[SOLFDFLRQHVGHOSURIHVRU3DQNVHSSIUXFWLFDQUHFLHQWHPHQWHHQ
la propuesta de una neurociencia afectiva, disciplina esta que tiene que centrarse

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 175 Manual de teoras emocionales y motivacionales - UJI
HQ HO HVWXGLR GH OD QHXURELRORJtD GH ODV HPRFLRQHV 3DOPHUR   'HVGH VX
SHUVSHFWLYD SDUHFH HVHQFLDO WHQHU GHQLFLRQHV QHXUDO \ ELROyJLFDPHQWH EDVDGDV
con las que poder explicar los distintos estudios psicolgicos sobre la emocin.
Para ello, es imprescindible aludir a la existencia de circuitos neurobiolgicos
HVSHFtFRVTXHFRQWURODQODHMHFXFLyQGHHPRFLRQHVSDUWLFXODUHV(VWRVFLUFXLWRV
QHXURELROyJLFRV EiVLFRV HVWiQ JHQpWLFDPHQWH SUHGHWHUPLQDGRV \ GLVHxDGRV SDUD
UHVSRQGHUGHIRUPDLQFRQGLFLRQDGDDORVHVWtPXORVTXHSRVHHQDOJXQDVLJQLFD-
cin importante para el organismo. El funcionamiento de estos circuitos puede
producir activacin o inhibicin de ciertas manifestaciones conductuales de los
distintos sistemas autonmicos encargados de regular y ajustar el funcionamiento
VLROyJLFRGHORUJDQLVPRDODVFDUDFWHUtVWLFDVGHODGHPDQGDSUHVHQWH/RVFLUFXL-
WRVHPRFLRQDOHVSXHGHQHMHUFHUXQDLQXHQFLDLPSRUWDQWHVREUHODVHQVLELOLGDGGH
los sistemas sensoriales, subiendo o bajando los umbrales de percepcin segn lo
H[LMDODFLUFXQVWDQFLDDODTXHVHHQIUHQWDHOVXMHWR$GHPiVORVFLUFXLWRVHPRFLR-
nales se encuentran en continua interaccin recproca con las estructuras cerebrales
implicadas en la ejecucin de procesos cognitivos de otro tipo, tales como los de
WRPDGHGHFLVLRQHVRORVGHFRQVFLHQFLD+DVWDODIHFKD3DQNVHSSKDGHVFULWRFRQ
bastante profusin de datos los circuitos de cuatro sistemas emocionales: el miedo,
ODUDELDLUDODFXULRVLGDGE~VTXHGD\HOSiQLFR 3DQNVHSS (VWRVFLUFXLWRV
emocionales fundamentales, tambin denominados sistemas de ordenacin emoti-
va o sistemas de primer orden, tienen como objetivo producir secuencias conduc-
WXDOHVELHQRUJDQL]DGDV&DGDXQRGHHVWRVFLUFXLWRVQHXUDOHVSURGXFHUHVSXHVWDV
FRQGXFWXDOHVPX\FODUDV/DHYHQWXDOLQWHUDFFLyQHQWUHHVWRVVLVWHPDVSXHGHSURGXFLU
HVWDGRVHPRWLYRVGHVHJXQGRRUGHQTXHFRQVLVWHQHQPH]FODVVXEMHWLYDV\FRQGXF-
tuales de las que se aprecian cuando se activan los sistemas de primer orden.

2WURVGRVSODQWHDPLHQWRVTXHHVWiQWHQLHQGRXQDJUDQUHSHUFXVLyQHQQXHVWURV
GtDV\TXHVHGHVDUUROODUiQPiVGHWHQLGDPHQWHHQHOVLJXLHQWHDSDUWDGRVRQORVGH
/H'RX[\'DPDVLR(QOtQHDVJHQHUDOHVSRGHPRVDGHODQWDUTXH/H'RX[WDP-
ELpQ D SDUWLU GH ORV WUDEDMRV GH &DQQRQ %DUG \ 3DSH] GHVDUUROOD VX WHRUtD GH
la emocin en la que participan el cerebro y el sistema nervioso perifrico. En
particular, el autor se centra en el relevante papel de la amgdala en la emocin.
Por su parte, DamasioHVRWURGHORVDXWRUHVFRQWHPSRUiQHRVTXHKDFHQWUDGRVX
inters en la bsqueda de las bases neurobiolgicas de los procesos emocionales
en general, y del sentimiento emocional en particular. En relacin a ello, el autor
ha destacado el importante papel del hemisferio derecho en el procesamiento de la
informacin emocional.

/DQHXURELRORJtDDFWXDO
Como ya se ha comentado, posiblemente nadie ponga en duda que el origen del
HVWXGLRGHODVHPRFLRQHVGHVGHXQDSHUVSHFWLYDELROyJLFDVHORFDOL]DHQHOWUDEDMR
de Darwin /DH[SUHVLyQGHODVHPRFLRQHVHQHOKRPEUH\HQORVDQLPDOHV  
En este trabajo, Darwin intentaba explicar el origen y el desarrollo de las princi-
pales conductas expresivas en el hombre y en otros animales inferiores. De hecho,
la consideracin de Darwin consista en entender la expresin emocional de los

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 176 Manual de teoras emocionales y motivacionales - UJI
humanos a partir del estudio de la expresin emocional en los animales de espe-
cies inferiores: nuestra conducta emocional es el resultado de nuestra propia evo-
lucin. A partir de ese momento, el inters de los investigadores se orient hacia
ODORFDOL]DFLyQ\DQiOLVLVGHODVHVWUXFWXUDVELROyJLFDVLPSOLFDGDVHQODHPRFLyQ
tanto en la dimensin expresiva, cuanto en la dimensin interpretativa. Como se
DFDEDGHUHYLVDU\H[SRQHUDQWHULRUPHQWHORVWtPLGRVLQWHQWRVUHDOL]DGRVSDUDOR-
FDOL]DUHVDUHODFLyQHQWUHVLVWHPDQHUYLRVRFHQWUDO\HPRFLRQHVDOFDQ]DQXQPR-
PHQWRGHUHOHYDQFLDFRQODVDSRUWDFLRQHVGH3DSH]  .OXYHU\%XF\  \
0DF/HDQ  HQWUHRWURV(OKLSRWiODPRODFRUWH]DFLQJXODGDODIRUPDFLyQGHO
hipocampo, y sus interconexiones conforman la estructura biolgica de las emo-
FLRQHV3RVWHULRUPHQWHDSDUWLUGHODVDSRUWDFLRQHVGH.OXYHU\%XF\VHFRPLHQ]D
a proponer el papel importante de la amgdala. Con estos descubrimientos, pareca
claro que el circuito hipottico de PapezVHJ~QODWHUPLQRORJtDGH0DF/HDQHUD
HO REMHWLYR GH ORV LQYHVWLJDGRUHV$GHPiV GH HVWDV LPSRUWDQWHV DSRUWDFLRQHV HO
estado actual del estudio neurobiolgico de la emocin se debe tambin a las apor-
WDFLRQHVGHULYDGDVGHWUHVJUDQGHVDUJXPHQWRVHOGH-DPHV\/DQJHEDVDGRHQHO
feedbackVLROyJLFRHOGH&DQQRQEDVDGRHQODUHOHYDQFLDFHQWUDOWDOiPLFD\HOGH
0DUDxyQ6FKDFKWHUEDVDGRHQODDXWRDWULEXFLyQ

En los ltimos aos estamos asistiendo a un fenmeno proliferativo en la bsque-


da de las bases neurobiolgicas de los procesos emocionales. Si bien, como se ha
VHxDODGRHOSXQWRGHSDUWLGDKDVLGRHOLPSRUWDQWHOHJDGRGHORVORFDOL]DFLRQLVWDV
FOiVLFRV FRPR 3DSH] \ 0DF/HDQ IXQGDPHQWDOPHQWH QR KD\ TXH GHMDU HQ XQ
VHJXQGRSODQRORVHVWXGLRVGHDOJXQRVDXWRUHVFRQWHPSRUiQHRVFRPR/H'RX[\
'DPDVLR$Vt\DSDUWLUGHODXJHTXHKDQWRPDGRODVRULHQWDFLRQHVELRORJLFLVWDVPiV
recientes, se puede defender que en la actualidad son estas aunque, en sentido es-
WULFWRKDEUtDTXHKDEODUGHWHRUtDVQHXURELROyJLFDVODVTXHDFDSDUDQHOPi[LPRLQ-
WHUpV\DSRUWDQUHVXOWDGRVPiVFRQWUDVWDGRV 3DOPHUR 8QRGHORVDUJXPHQWRV
que impregna los descubrimientos llevados a cabo en estos ltimos aos tiene que
ver con un hecho insoslayable: todas las acciones derivadas de la actividad del siste-
ma nervioso central contribuyen a los procesos afectivos. Pero, al mismo tiempo,
XQDGHODVSULQFLSDOHVDVXQFLRQHVQHXURSVLFROyJLFDVVHUHHUHDOKHFKRGHTXHOD
FRQGXFWD\ORVHVWDGRVGHODH[SHULHQFLDVHHQFXHQWUDQItVLFDPHQWHPHGLDWL]DGRVSRU
el cerebro. Por consiguiente, tanto la conducta emocional como el afecto tambin
se encuentran modulados por el funcionamiento cerebral, de tal suerte que cual-
quier perturbacin cerebral puede repercutir sobre la experiencia y la conducta
emocionales. En efecto, cualquier cambio en dichas actividades afecta al modo
mediante el cual expresamos nuestra propia conducta emocional, y al modo me-
GLDQWHHOTXHLQWHUSUHWDPRVODFRQGXFWDHPRFLRQDOGHORVGHPiV

En este marco de referencia, una de las premisas que hay que mantener cuando se
WUDWDGHORFDOL]DUHOVXVWUDWRELROyJLFRGHODVHPRFLRQHVWLHQHTXHYHUFRQODSURJUH-
siva diferenciacin del cerebro en el proceso de evolucin propiamente dicho. As,
GHIRUPDJUDGXDOKDKDELGRPiVH[LJHQFLDVDORUJDQLVPRORFXDOKDSHUPLWLGRTXH
las antiguas estructuras neuroanatmicas responsables de los mecanismos adapta-
WLYRVEiVLFRVYD\DQHYROXFLRQDQGRWDPELpQSDUDRIUHFHUXQDPiVDPSOLD\H[LEOH
gama de respuestas que incrementan la capacidad adaptativa de los organismos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 177 Manual de teoras emocionales y motivacionales - UJI
(QHOSODQRGHODHPRFLyQKXPDQDODVUHIHUHQFLDVQHXURDQDWyPLFDVHQIDWL]DQOD
LPSOLFDFLyQGHHVWUXFWXUDVWHOHQFHIiOLFDVWDOHVFRPRORVJDQJOLRVEDVDOHVHOVLVWH-
PDOtPELFR\ODFRUWH]DFHUHEUDO1RREVWDQWHODVDSRUWDFLRQHVGHVGHODQHXURORJtD
FOtQLFDWDPELpQVHxDODQODLPSRUWDQFLDGHDOJXQDVHVWUXFWXUDVGLHQFHIiOLFDVFRPRHO
WiODPR\HOKLSRWiODPRHLQFOXVRWURQFRHQFHIiOLFDVFRPRORVQ~FOHRVUHWLFXODUHV
de la protuberancia o puente.

'H HVWH PRGR \ WHQLHQGR HQ FXHQWD OD IRUPD HQ TXH VH HVWiQ GHVDUUROODQGR ORV
acontecimientos actuales en el estudio de la neurobiologa de la emocin, parece
imprescindible la consideracin de un planteamiento basado en el evolucionismo
QHXURDQDWyPLFR\DTXHSHUPLWHODDGRSFLyQGHSURSXHVWDVH[LEOHVTXHFRQVLGHUHQ
ODSDUWLFLSDFLyQGHHVWUXFWXUDVGLIHUHQWHV/DVLWXDFLyQDFWXDODVXPHODUHOHYDQFLDGH
HVWDVFRQVLGHUDFLRQHV\VLJXHSURIXQGL]DQGRHQVXFRQRFLPLHQWR'HKHFKRHVWi
bastante consolidada la idea de que las estructuras subcorticales son imprescindi-
EOHVSDUDHQWHQGHUWRGDVODVGLPHQVLRQHVGHODFRQGXFWDHPRFLRQDO /H'RX[ 
(VGHFLUVLHQSULPHUOXJDUODVHPRFLRQHVVRQSURFHVRVDGDSWDWLYRVEiVLFRVTXH
se encuentran presentes en el ser humano antes de que este desarrolle por completo
la estructura y funcionalidad del sistema nervioso central; si, en segundo lugar, las
emociones son mecanismos adaptativos que se encuentran presentes en muchas de
las especies inferiores, porque en su bagaje gentico se encuentra la dotacin apro-
SLDGDSDUDTXHDSDUH]FDQ\VHGHVDUUROOHQSDUHFHVHQVDWRHQWHUFHUOXJDUSURSRQHU
que la infraestructura biolgica o, de nuevo, neurobiolgica se encuentra ubicada
HQ]RQDVGHOVLVWHPDQHUYLRVRFHQWUDOTXHVRQUHODWLYDPHQWHDQWLJXDV\HVHHVHO
caso de las estructuras subcorticales. En cualquiera de los casos, admitiendo la rele-
YDQFLDGHODVHVWUXFWXUDVVXEFRUWLFDOHVHQHOiPELWRGHODHPRFLyQODDFWXDOLGDGHVWi
evidenciando que muchos trabajos recientes se orientan tambin hacia el papel que
MXHJDQRWUDVHVWUXFWXUDVQHXURELROyJLFDVGHPiVUHFLHQWHDSDULFLyQHQHOGHVDUUROOR
ORJHQpWLFRODVHVWUXFWXUDVQHRFRUWLFDOHV.

(Q ~OWLPD LQVWDQFLD HO DQiOLVLV PLQXFLRVR GH ORV GDWRV DSRUWDGRV HQ ORV WUDED-
MRVPiVUHFLHQWHVSRQHGHPDQLHVWRTXHODH[FHVLYDVLPSOLFDFLyQhemisferio
izquierdo-razn versus hemisferio derecho-emocin debe ser reconsiderada en la
actualidad, ya que existen algunos aspectos de inters que hablan de la comple-
jidad funcional de ambos hemisferios en los procesos emocionales. As, parece
bastante claro que los dos hemisferios participan en los procesos emocionales,
hecho este que no debe sorprender si pensamos en la conexin nter hemisfrica
a travs de la comisura del cuerpo calloso, o de la comisura anterior. Es preciso
HVSHFLFDUODSDUWLFLSDFLyQUHDOGHFDGDKHPLVIHULRHQODSHUFHSFLyQ\HQODH[-
presin de las emociones, pues la situacin relacionada con el papel de dichas
HVWUXFWXUDVHVUHDOPHQWHPiVFRPSOHMD'HKHFKRFRPRLQGLFDQDOJXQRVDXWRUHV
'DPDVLR*DLQRWWL ORVPRGHORVTXHVHSURSRQHQSDUDHVWXGLDUOD
neurobiologa de la emocin consideran la dicotoma subcortical-cortical, o lm-
ELFDQR OtPELFD DVt FRPR OD GLVWLQFLyQ KHPLVIHULR GHUHFKRKHPLVIHULR L]TXLHU-
do, e incluso, dentro de cada hemisferio, la ubicacin lateral-ventral, y anterior-
posterior. Al respecto, y como sntesis de este tipo de diferenciaciones, Borod
\ 0DGLJDQ   SURSRQHQ GRV IRUPDV HVHQFLDOHV GH DSUR[LPDFLyQ DO HVWXGLR
QHXURELROyJLFRGHODHPRFLyQXQDFRQFRQQRWDFLRQHVLQWHUKHPLVIpULFDVHVWiUH-

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 178 Manual de teoras emocionales y motivacionales - UJI
lacionada con la lateralidad; otra, con connotaciones intrahemisfricas, incluye
GRVQLYHOHVGHDQiOLVLVHLQYHVWLJDFLyQHOGHODFDXGDOLGDG DQWHULRUSRVWHULRU \
HOGHODYHUWLFDOLGDG QHRFRUWLFDOVXEFRUWLFDOROtPELFR 

)LQDOPHQWH FRPR FRQVWDWDFLyQ GH OD FRPSOHMLGDG TXH LPSOLFD HO HVWXGLR GH OD
neurobiologa emocional, otro aspecto que cabra considerar es la eventual par-
ticipacin de las distintas estructuras neurobiolgicas en cada uno de los dos
planos a travs de los cuales se ha estudiado preferentemente la emocin, a saber:
  HO UHIHULGR DO FRQRFLPLHQWR GH OD HPRFLyQ UHFRQRFLPLHQWR GHQRPLQDFLyQ
HYDOXDFLyQ\YDORUDFLyQ HOUHIHULGRDODH[SUHVLyQPHGLDQWHHOOHQJXDMHORV
gestos, los cambios faciales, y cualquier otro movimiento con connotaciones de
FRPXQLFDFLyQVRFLDO$PERVSODQRVSRGUtDQVHUGHQLGRVFRPRSURFHVDPLHQWR
de la estimulacin emocional y preparacin de la respuesta emocional. Este es, a
nuestro juicio, el punto crtico que en la actualidad permite el avance en el cono-
FLPLHQWRGHODVHVWUXFWXUDVQHXURELROyJLFDVLPSOLFDGDVHQODHPRFLyQ 3DOPHUR
 

3URFHVDPLHQWRGHODHVWLPXODFLyQHPRFLRQDO
(QHOFDPSRGHODQHXURELRORJtDGHODVHPRFLRQHVHQJHQHUDO\PiVFRQFUHWDPHQWH
HQHOiPELWRGHOUHFRQRFLPLHQWRHYDOXDFLyQ\YDORUDFLyQGHODHPRFLyQVRQGRVODV
HVWUXFWXUDVFHUHEUDOHVTXHPD\RUDWHQFLyQHVWiQUHFLELHQGRDFWXDOPHQWHDVDEHUOD
amgdala y los hemisferios cerebrales. Sin embargo, tal y como sealan reciente-
PHQWH4XLUyV\&DEHVWUHUR  GHEHPRVWHQHUHQFXHQWDTXHHOHVWXGLRGHORV
mecanismos cerebrales de la emocin se halla en sus primeros estadios, de tal modo
TXHPiVTXHGDUUHVSXHVWDVVHQFLOODVUHVDOWDQODFRPSOHMLGDGGHOIHQyPHQR

Respecto a la amgdala, su especial ubicacin, as como la importante conectividad
FRQRWUDVHVWUXFWXUDVFHUHEUDOHVODFRQYLHUWHQHQXQD]RQDGHHVSHFLDOUHOHYDQFLD
HPRFLRQDO/DDPtJGDODUHFLEHLQIRUPDFLyQVHQVRULDOGHWRGDVODVPRGDOLGDGHV\
HVWiHQFRQWDFWRFRQHOKLSRFDPSRHOSURVHQFpIDOREDVDO\ORVJDQJOLRVEDVDOHV
que son estructuras importantes en los procesos de memoria y de atencin, as
FRPRFRQHOKLSRWiODPRTXHHVIXQGDPHQWDOSDUDHOFRQWUROGHODKRPHRVWDVLV\OD
regulacin neuroendocrina.

/RVP~OWLSOHVWUDEDMRVHQORVTXHVHKDDERUGDGRHOHVWXGLRHLPSOLFDFLyQGHOD
amgdala en el procesamiento de la estimulacin emocional son alentadores, pre-
dominando, en trminos generales, la visin participativa activa de dicha estructura
en la emocin. As, los estudios llevados a cabo en los ltimos tiempos, mediante
el apoyo de la tecnologa basada en la imagen funcional de la actividad cerebral,
ponen de relieve que la amgdala se encuentra implicada en el procesamiento de
la estimulacin emocional expresiva; incluso, como se sugiere a partir de otra
serie de trabajos, no se descarta la posibilidad de que la amgdala se encuentre
LPSOLFDGDHQXQDIXQFLyQGHSURFHVDPLHQWRHPRFLRQDOPiVDPSOLD\JHQHUDOFRQ
connotaciones sociales.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 179 Manual de teoras emocionales y motivacionales - UJI
Si bien es muy probable que la amgdala juegue un importante papel en la adquisi-
cin de conocimiento relacionado con la emocin, estimamos que, al menos hasta
QXHVWURVGtDVHOIXQFLRQDPLHQWR\SDUWLFLSDFLyQHVSHFtFRVGHGLFKDHVWUXFWXUDQR
HVWiQGHOLPLWDGRVGHOWRGR/DH[LVWHQFLDWRGDYtDGHGDWRVFRQWURYHUWLGRVSDUHFH
indicar que, aunque la implicacin de la amgdala es muy probable, se necesita una
PD\RUHVSHFLFLGDGQHXURELROyJLFDSDUDGHOLPLWDUVXSDUWLFLSDFLyQH[DFWD

Respecto a los hemisferios cerebralesVRQ\DFOiVLFDVODVVXJHUHQFLDVUHIHULGDVD


ODLPSOLFDFLyQGHOKHPLVIHULRL]TXLHUGRHQDTXHOORVDVSHFWRVHPRFLRQDOHVTXHVH
transmiten a travs del lenguaje, o que implican la descripcin verbal de una emo-
FLyQPLHQWUDVTXHHOKHPLVIHULRGHUHFKRHVWDUtDPiVUHODFLRQDGRFRQORVDVSHFWRV
emocionales que se transmiten mediante caractersticas expresivas y gestuales.

0iVUHFLHQWHPHQWHVHKDVXJHULGRODHVSHFLDOUHOHYDQFLDGHOKHPLVIHULRGHUHFKR
para el procesamiento de la informacin con connotaciones emocionales, tanto en
el caso de seres humanos, como en el caso de animales de especies inferiores.

Aunque, la implicacin del hemisferio derecho en el procesamiento emocional es


clara, el porqu de este tipo diferencial de funcionamiento sigue suscitando dudas
\FRQWURYHUVLDV'HKHFKRDVXPLHQGRXQRGHORVSULQFLSLRVPiVDFHSWDGRVHQOD
DFWXDOLGDGHOTXHVHEDVDHQODGHWHUPLQDFLyQMHUiUTXLFDELROyJLFDDOJXQRVDXWRUHV
proponen que se podra entender la distinta implicacin de ambos hemisferios
en el procesamiento de la informacin emocional a partir de las diferentes ca-
WHJRUtDV GH HPRFLRQHV$Vt ODV IRUPDV PiV SULPLWLYDV GH HPRFLyQ TXH SRU UH-
gla general tienen valencia negativa, se encuentran especialmente vinculadas al
funcionamiento del hemisferio derecho, mientras que aquellas otras emociones
ORJHQpWLFDPHQWHPiVDYDQ]DGDV\FRQFRQQRWDFLRQHVVRFLDOHVVHHQFXHQWUDQHV-
SHFLDOPHQWHYLQFXODGDVDOIXQFLRQDPLHQWRGHOKHPLVIHULRL]TXLHUGR1RREVWDQWH
RWURVDXWRUHV *DLQRWWL&DOWDJLURQH\=RFFRORWWL FUHHQTXHPiVTXHHQODV
categoras emocionales, habra que centrarse en el nivel o grado de procesamiento
de la informacin para entender las distintas emociones, as como el papel espec-
FRTXHHQHOODVMXHJDFDGDXQRGHORVKHPLVIHULRV

8QRGHORVDXWRUHVTXHPHMRUKDSHUODGRODUHOHYDQFLDGHOhemisferio derecho en
el procesamiento de la informacin emocional ha sido Damasio, planteando su
hiptesis del marcador somtico(VWDKLSyWHVLVGHHQGHTXHHOUD]RQDPLHQWRVH
YHLQXHQFLDGRSRUVHxDOHVVHVJDGDVTXHVXUJHQGHODPDTXLQDULDQHXURQDOTXH
VXE\DFHDODVHPRFLRQHV 'XQQ'DOJOHLVK\/DZUHQFH 'DPDVLRGHHQGH
que el procesamiento de la emocin depende del procesamiento de la informacin
VRPiWLFD(VWRHVODHPRFLyQLPSOLFDXQDVDIHUHQFLDVGHVGHHOFXHUSRHLPSOLFD
tambin unas eferencias hacia el cuerpo, en ambos casos incluyendo la partici-
pacin de los aspectos endocrinos y viscerales. En este marco de referencia, el
KHPLVIHULRGHUHFKRSDUHFHHVWDUHVSHFLDOL]DGRHQODUHSUHVHQWDFLyQGHOFXHUSR\D
TXHODVOHVLRQHVHVSHFtFDVGHGLFKRKHPLVIHULRSURGXFHQXQDPD\RUSpUGLGD
de control sobre el estado general del cuerpo, que cuando las lesiones se en-
FXHQWUDQFLUFXQVFULWDVDOKHPLVIHULRL]TXLHUGR(VSUREDEOHVHxDOD'DPDVLR
que las funciones referidas a la emocin y a la representacin del cuerpo, que

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 180 Manual de teoras emocionales y motivacionales - UJI
IRUPDQSDUWHGHODPLVPDIXQFLyQKRPHRVWiWLFDRUJDQtVPLFDVHHQFXHQWUHQODWHUD-
OL]DGDVHQHOKHPLVIHULRGHUHFKR

(QOtQHDVJHQHUDOHVFRPRKDQUHFDOFDGRUHFLHQWHPHQWHDOJXQRVDXWRUHV $GROSKV
\'DPDVLR%RURG\0DGLJDQ SDUHFHEDVWDQWHFRQUPDGRHOLPSRU-
tante papel que juega el hemisferio derecho en el procesamiento de la estimulacin
emocional.

3UHSDUDFLyQGHODUHVSXHVWDHPRFLRQDO
En el plano de la manifestacin emocional en general, y de la expresin emo-
cional en particular, tambin han sido la amgdala y los hemisferios cerebrales
las estructuras neurobiolgicas que mayor atencin han recibido por parte de los
LQYHVWLJDGRUHV'HVGHKDFH\DXQRVDxRVXQRGHORVDVSHFWRVTXHPiVKDOODPDGR
la atencin en el estudio de la neurobiologa de la expresin emocional procede
GHODVDSRUWDFLRQHVGH(NPDQ  FXDQGRVHUHIHUtDDODLPSRUWDQFLDGHODV
estructuras subcorticales y de los hemisferios cerebrales para entender cmo se
produce la expresin de las emociones. En efecto, seala el autor que es necesario
GLVWLQJXLUHQWUHODH[SUHVLyQHPRFLRQDOLQYROXQWDULDRHVSRQWiQHD\ODH[SUHVLyQ
HPRFLRQDOYROXQWDULDRQJLGD&DGDXQDGHHVWDVPDQLIHVWDFLRQHVH[SUHVLYDVSD-
rece estar controlada por estructuras distintas, producindose por la activacin de
PHFDQLVPRVGLVWLQWRV&XDQGRODH[SUHVLyQVHUHHUHDHPRFLRQHVDXWpQWLFDVVRQ
ODVHVWUXFWXUDVPiVDQWLJXDV\EiVLFDV IXQGDPHQWDOPHQWHHOWURQFRHQFpIDOR\HO
VLVWHPDOtPELFR ODVTXHFRQWURODQGLFKDPDQLIHVWDFLyQFRQGXFWXDOSHURFXDQGR
ODH[SUHVLyQVHUHHUHDHPRFLRQHVQJLGDVSDUWLFLSDODFRUWH]DFHUHEUDO$GHPiV
VHJ~Q(NPDQWDPELpQVHSXHGHDSUHFLDUTXHFXDQGRODHPRFLyQHVDXWpQWLFDSD-
rece que existe una relativa simetra en la expresin facial, mientras que, cuando
ODHPRFLyQHVQJLGDQRVHDSUHFLDGLFKDVLPHWUtD

Como ya se ha indicado en el apartado anterior, tradicionalmente, y con mucha


IUHFXHQFLDVHKDDUJXPHQWDGRTXHHOKHPLVIHULRL]TXLHUGRHUDHOUHVSRQVDEOHGH
ODUD]yQHVSHFLDOL]DGRHQORVSURFHVRVGHOHQJXDMH\GHSHQVDPLHQWR\HOKH-
PLVIHULRGHUHFKRHOUHVSRQVDEOHGHODHPRFLyQHVSHFLDOL]DGRHQODLQWXLFLyQOD
emocionalidad y la percepcin espacial global. Estas caractersticas y funciones
GH ORV GRV KHPLVIHULRV TXH VLJXHQ UHHMDQGR OD FOiVLFD GLFRWRPtD WDQWDV YHFHV
esgrimida hemisferio izquierdo-racionalidad versus hemisferio derecho-emocio-
nalidad, parecen correctas, pero tambin resultan incompletas. As, por una parte,
H[LVWHQLPSRUWDQWHVDVSHFWRVGHOSHQVDPLHQWRFRKHUHQWHLQFOXVRHQHOiPELWRGH
la dimensin verbal, que reciben un considerable apoyo funcional del hemisferio
derecho, integrando la informacin de un modo que puede ser esencial para el co-
nocimiento racional y, por otra parte, tambin se puede apreciar que el hemisferio
L]TXLHUGRHVLPSRUWDQWHSDUDODHVWDELOLGDGHPRFLRQDOUHJXODQGRHLQFOXVRLQKL-
biendo, la responsividad afectiva del hemisferio derecho. El papel de la amgdala
HQODHPRFLyQWDOFRPRVHxDOiEDPRVWDPELpQHQHODSDUWDGRDQWHULRUKDUHVXO-
tado alentador, aunque con una cierta controversia todava. En los ltimos aos,
\PHUFHGDODVDSRUWDFLRQHVGHDXWRUHVFRPR/H'RX[VHKDSRGLGRDSUHFLDUXQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 181 Manual de teoras emocionales y motivacionales - UJI
LPSRUWDQWHLQFUHPHQWRHQODLQYHVWLJDFLyQGHHVWDHVWUXFWXUDSDUDSHUODUQRVROR
su implicacin en el procesamiento de la estimulacin emocional, sino incluso
WDPELpQHQODSUHSDUDFLyQGHODUHVSXHVWDHPRFLRQDO7RGDHVWDLQIRUPDFLyQSRGUtD
llevar a la consideracin de la amgdala como una estructura vital en el proceso
HPRFLRQDOHQVXFRQMXQWRSXHVSRGUtDSRVHHUIXQFLRQHVUHODFLRQDGDVFRQHODQiOL-
sis, evaluacin y valoracin de la estimulacin emocional, produciendo de forma
clara a continuacin las oportunas manifestaciones conductuales asociadas a las
GLIHUHQWHVHPRFLRQHV 3DOPHUR 

Pasemos a ver, a continuacin, el estado de la cuestin en cuanto a la participacin


de la amgdala y los hemisferios cerebrales en la preparacin de la respuesta y
manifestacin emocionales.

Respecto a la amgdala, hay que sealar que, en los ltimos aos, y gracias a las
fructferas aportaciones de autores como LeDouxHVWDHVWUXFWXUDVHHVWiUHYHODQGR
FRPRXQD]RQDIXQGDPHQWDOSDUDHQWHQGHUHOVXVWUDWRQHXURELROyJLFRGHODVHPR-
FLRQHVDOPHQRVGHODHPRFLyQGHPLHGR 'HOJDGR-RX/H'RX[3KHOSV
-RKDQVHQ7DUSOH\/H'RX[ 

/DUHOHYDQFLDGHHVWDHVWUXFWXUDHQFXDQWRDVXLPSOLFDFLyQHQHOSURFHVRHPRFLR-
nal, se ha constatado tanto en el plano del procesamiento de la estimulacin, como
en el plano de la respuesta emocional. De este modo, la amgdala se considera
como una estructura que participa activamente en el procesamiento de la infor-
PDFLyQFRQFRQQRWDFLRQHVHPRFLRQDOHV PHFDQLVPRGHHQWUDGD DVtFRPRHQOD
preparacin de las distintas manifestaciones conductuales y ajustes internos que
ocurren como consecuencia del estmulo que llega hasta el organismo y adquiere
FRQQRWDFLRQHVHPRFLRQDOHV PHFDQLVPRGHVDOLGD 

$SDUWLUGHODVLPSRUWDQWHVDSRUWDFLRQHVGH/H'RX[VH HVWiSRQLHQGRGHPDQLHVWR
que su estudio es imprescindible para conocer con mayor detalle la infraestructura
neurobiolgica de las emociones, si bien, se ha de sealar que sigue habiendo una
cierta controversia respecto al papel de la amgdala en los procesos emocionales
en general.

$VtSXHV/H'RX[FHQWUDVXLQYHVWLJDFLyQHQODDPtJGDODXQQ~FOHRVXEFRUWLFDO
TXHVHVLW~DHQHOLQWHULRUGHOOyEXORWHPSRUDOVHxDOiQGRODFRPRUHVSRQVDEOHGHO
PHFDQLVPRGHHYDOXDFLyQHPRFLRQDOGHORVHVWtPXORVYLVXDOHV/DOHVLyQGHGLFKD
HVWUXFWXUDSURGXFHXQDSpUGLGDGHODHPRFLyQGHPLHGR\GLFXOWDGHVHQODVIXQ-
ciones de otro tipo de emociones.

$JUDQGHVUDVJRVTXLHQHVGHHQGHQODLPSRUWDQFLDGHODDPtJGDODHQORVSURFHVRV
emocionales consideran la existencia de dos sistemas neurobiolgicos. Por una
SDUWHHOVLVWHPDFOiVLFRPiVODUJRTXHLQFOX\HHOWiODPRODFRUWH]DDVRFLDWLYD
HVSHFtFDDOWLSRGHHVWtPXORLPSOLFDGR\ODVGLVWLQWDVHVWUXFWXUDVVXEFRUWLFDOHV
que participaran en la respuesta del organismo, incluyendo en la misma las mani-
IHVWDFLRQHVHPRFLRQDOHVWDPELpQ(ORWURVLVWHPDSURSXHVWRHVPiVFRUWR\GLUHFWR
\DTXHHOHVWtPXORXQDYH]TXHDOFDQ]DHOWiODPRDGHPiVGHVHJXLUODUXWDUHFLpQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 182 Manual de teoras emocionales y motivacionales - UJI
FRPHQWDGDVLJXHXQDSUR\HFFLyQPiVFRUWDKDVWDODDPtJGDODODFXDOWLHQHFDSD-
FLGDGSDUDSUHSDUDUXQDUHVSXHVWDRUJDQtVPLFDLQPHGLDWDDQWHODHYHQWXDODPHQD]D
que pueda suponer el estmulo en cuestin. En esta segunda posibilidad, solo se
HQFXHQWUDQLPSOLFDGDVFLHUWDVHVWUXFWXUDVVXEFRUWLFDOHVGHODVTXHODPiVLPSRU-
WDQWHHVODDPtJGDOD'HKHFKRVHJ~Q/H'RX[ODVHPRFLRQHVVRQHOSURGXFWRGH
ODDFWLYLGDGGHHVWHVLVWHPD(OFDPLQRPiVFRUWRGHORVGRVHVHOVHJXQGRSRUOR
tanto es esta va la que permite la respuesta casi inmediata ante las seales de pe-
ligro. Pero, inmediatamente despus llega tambin hasta la amgdala el resultado
GHODQiOLVLVPiVSRUPHQRUL]DGRGHHVHHVWtPXORTXHKDWHQLGROXJDUHQODFRUWH]D
DVRFLDWLYDHVSHFtFDFRQUPDQGRVLODLQLFLDOUHVSXHVWDSUHSDUDGDSRUODDPtJGD-
ODKDVLGRFRUUHFWDRQR6LODUHVSXHVWDLQLFLDOIXHFRUUHFWDDKRUDVHUHQDHQVX
PDQLIHVWDFLyQ DMXVWiQGRVH D OD VLJQLFDFLyQ HVSHFtFD GHO HVWtPXOR \ GHO GDxR
asociado al mismo. Si, por el contrario, la respuesta inicial no fue apropiada, tra-
WiQGRVHGHXQDfalsa alarmaDXWRPiWLFDPHQWHFHVDODUHVSXHVWD\ORVPHFDQLVPRV
DXWRQyPLFRVDFWLYDGRVSDUDSURWHJHUHOHTXLOLEULRGHORUJDQLVPR+D\TXHWHQHU
HQFXHQWDTXHODPD\RUUDSLGH]HQODUHVSXHVWDGHODDPtJGDODDSDUWLUGHODLQIRU-
PDFLyQGLUHFWDTXHOHOOHJDGHVGHHOWiODPRVHSURGXFHDH[SHQVDVGHODFDOLGDGHQ
HODQiOLVLVGHGLFKDHVWLPXODFLyQ(VGHFLUODHVWLPXODFLyQOOHJDGDGLUHFWDPHQWH
GHVGHHOWiODPRHVWiPX\SRFRHODERUDGDFRQORFXDOODUHVSXHVWDGHODDPtJGDOD
WDPELpQHVEDVWDQWHLQHVSHFtFD&RPRPXFKRSRGUtDPRVSODQWHDUODSRVLELOLGDG
de que se trate de una respuesta elemental de preparacin, de defensa en general.
(Q QXHVWUD RSLQLyQ HO YDORU DGDSWDWLYR TXH SRVHH OD DSRUWDFLyQ GH /H'RX[ HV
LQQHJDEOH$XQTXHODUHVSXHVWDUiSLGDprecipitada, que produce la amgdala no
VHDFRUUHFWDHVWRHVDXQTXHODVPiVGHODVYHFHVVHWUDWHVRORGHXQDIDOVDDODUPD
es preferible ese tipo de error al que supondra no reaccionar a tiempo y sufrir
ODVFRQVHFXHQFLDVGHXQDVLWXDFLyQSHOLJURVD2ORTXHHVORPLVPRHQWpUPLQRV
HYROXFLRQLVWDVHVPiVDGDSWDWLYDODH[LVWHQFLDGHPXFKDVVLWXDFLRQHVFDWDORJDGDV
como falso positivo que de una sola catalogada como falso negativo, ya que esa
sola situacin puede llegar a ser tambin la ltima.

&RQHOQGHGHOLPLWDUFRQPD\RUH[DFWLWXGHOSDSHOTXHVHJ~Q/H'RX[MXHJD
la amgdala, es interesante resear las conexiones que esta estructura subcortical
PDQWLHQHFRQODFRUWH]DVHQVRULDO&RQFUHWDPHQWHODFRQH[LyQHQWUHODDPtJGDOD\
ODFRUWH]DHVELGLUHFFLRQDODXQTXHODVYtDVTXHFRQHFWDQODDPtJGDODFRQODFRUWH]D
VRQPiVVyOLGDV\DPSOLDVTXHODVYtDVTXHFRQHFWDQODFRUWH]DFRQODDPtJGDOD/D
HYLGHQWHDVLPHWUtDGHYtDVHQWUHODDPtJGDOD\ODFRUWH]DSHUPLWHHQWHQGHUSRUTXp
HVWDQGLItFLOGHWHQHUYROXQWDULDPHQWHXQDHPRFLyQXQDYH]TXHHVWDVHKDGHVHQFD-
GHQDGR$VtGHVGHHOWiODPRVXUJHQSUR\HFFLRQHVTXHDFWLYDQVLPXOWiQHDPHQWHOD
FRUWH]DVHQVRULDO\ODDPtJGDOD$GHPiVODDPtJGDODWDPELpQUHFLEHLQIRUPDFLyQ
GHVGH OD FRUWH]D VHQVRULDO FXDOTXLHUD TXH VHD HO WLSR GH HVWLPXODFLyQ VHQVRULDO
LPSOLFDGD3RUVXSDUWHODDPtJGDODWDPELpQHQYtDSUR\HFFLRQHVKDVWDODFRUWH]D
VHQVRULDOHQODViUHDVHQODVTXHVHOOHYDDFDERHOSURFHVDPLHQWRGHODHVWLPXOD-
cin en cuestin. A partir de estos presupuestos, hay dos aspectos de considerable
LQWHUpV3RUXQDSDUWHODDPtJGDODUHFLEHLQIRUPDFLyQGLUHFWDGHVGHHOWiODPROR
que le permite procesar y resolver una forma u otra de actuacin antes de que le
OOHJXHODLQIRUPDFLyQGHVGHODFRUWH]DVHQVRULDO3RURWUDSDUWHFRPRVXJLHUH$U-
PRQ\  FDEUtDODSRVLELOLGDGGHSHQVDUTXHODDPtJGDODWLHQHFDSDFLGDGSDUD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 183 Manual de teoras emocionales y motivacionales - UJI
LQXLUVREUHHOSURFHVDPLHQWRTXHVHHVWiOOHYDQGRDFDERHQODV]RQDVFRUWLFDOHV
LPSOLFDGDVUHJXODQGRODDFWLYLGDGGHODViUHDVTXHSUR\HFWDUiQVREUHHOODXQFLHU-
to tipo de activacin e informacin. Se podra hablar de una suerte de circuito de
DXWRUUHJXODFLyQHQWUHODFRUWH]DVHQVRULDO\ODDPtJGDODHQHOTXHHOFRQWUROVREUH
HOOWURGHLQIRUPDFLyQVHORFDOL]DUtDHQODDPtJGDOD

2WURDVSHFWRDFRQVLGHUDUHQFXDQWRDODUHOHYDQFLDGHODDPtJGDODFRQVLVWHHQVX
SRWHQFLDOFDSDFLGDGSDUDLQXLULQGLUHFWDPHQWHVREUHHOSURFHVDPLHQWRVHQVRULDO
cortical a travs de las proyecciones que enva a distintos centros implicados en la
DFWLYDFLyQGHODFRUWH]DWDOHVFRPRHOVLVWHPDFROLQpUJLFRGHOSURVHQFpIDOREDVDO
el sistema colinrgico del troncoencfalo, y el sistema noradrenrgico del locus
FHU~OHR &RPR KDQ VHxDODGR DOJXQRV DXWRUHV FDGD YH] TXH OD DPtJGDOD GHWHFWD
un peligro, promueve la activacin de dichos sistemas, activacin que tiene como
REMHWLYRLQXLUVREUHHOSURFHVDPLHQWRVHQVRULDOSRWHQFLDQGRODDWHQFLyQ(VHVWD
una funcin probable, pero no determinante, pues cuando un estmulo llega al or-
JDQLVPRVHSURGXFHQGRVIRUPDVGHDFWLYDFLyQSRUXQDSDUWHODHVSHFtFDTXHD
WUDYpVGHODIRUPDFLyQUHWLFXODUOOHJDKDVWDORVQ~FOHRVWDOiPLFRVHVSHFtFRV\VH
SUR\HFWDVREUHODFRUWH]DVHQVRULDOUHODFLRQDGDFRQHOWLSRGHHVWLPXODFLyQHQMXH-
go tal como acabamos de exponer, tambin sobre la amgdala; por otra parte,
ODLQHVSHFtFDODFXDOWDPELpQDWUDYpVGHODIRUPDFLyQUHWLFXODUDOFDQ]DORV
Q~FOHRV LQHVSHFtFRV WDOiPLFRV SUR\HFWiQGRVH D FRQWLQXDFLyQ GH XQD PDQHUD
JHQHUDO\DPSOLDVREUHJUDQSDUWHGHODFRUWH]DFHUHEUDO\SURYRFDQGRXQHVWDGR
GHDFWLYDFLyQJHQHUDOL]DGDVLHPSUHGHSHQGLHQGRGHODLQWHQVLGDG\VLJQLFDFLyQGHO
estmulo.

En la actualidad, a partir de diversas investigaciones, es bien sabido que las pro-


\HFFLRQHVTXHSURFHGHQGLUHFWDPHQWHGHVGHHOWiODPRDVtFRPRODVTXHSURFHGHQ
GHODFRUWH]DVHQVRULDOHQWUDQHQODDPtJGDODDWUDYpVGHOQ~FOHRODWHUDO'HVGHHO
ncleo lateral, la informacin llega hasta el ncleo basal, y desde ah al ncleo
central, que es considerado como el principal centro eferente desde la amgdala,
HQYLDQGRSUR\HFFLRQHVKDFLDORVGLYHUVRVVLVWHPDVWURQFRHQFHIiOLFRVLPSOLFDGRVHQ
la reactividad emocional.

8QPRGHORFRQGXFWXDOELHQGHQLGRSDUDH[SOLFDUORVSURFHVRVGHDSUHQGL]DMH\PH-
moria con connotaciones emocionales es la adquisicin de miedo mediante condi-
FLRQDPLHQWRFOiVLFRXQSURFHVRPHGLDQWHHOFXDOXQHVWtPXORUHODWLYDPHQWHQHXWUDO
puede llegar a producir respuestas de miedo, merced a su inicial asociacin con un
HVWtPXORRHYHQWRLQFRQGLFLRQDGDPHQWHFDSD]GHSURGXFLUPLHGR&RQFUHWDPHQWH
el estmulo neutral adquiere la capacidad para elicitar reacciones de defensa, anti-
cipando la, en principio probable, ocurrencia del dao. Se acepta en la actualidad
que la amgdala juega un papel determinante en la adquisicin y expresin de
UHVSXHVWDVFRQGLFLRQDGDVGHPLHGR $UPRQ\/H'RX[D (VWHPR-
GHORFRQFUHWRKDSHUPLWLGRSHUODUFRQJUDQGHWDOOHHOPHFDQLVPRQHXURELROyJLFR
cerebral de la emocin de miedo. En lneas generales, los resultados tienden a ser
EDVWDQWHFRLQFLGHQWHVHODSUHQGL]DMHGH\ODUHVSXHVWDDHVWtPXORVTXHSRVHHQXQD
VLJQLFDFLyQHQIRUPDGHSHOLJURSDUDODLQWHJULGDGGHXQRUJDQLVPRVHHQFXHQWUDQ
relacionados con la activacin de vas neurales que conducen informacin hacia la

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 184 Manual de teoras emocionales y motivacionales - UJI
DPtJGDOD&RPRKDHQIDWL]DGRUHFLHQWHPHQWH/H'RX[ E ODDPtJGDODHVXQ
componente crucial para entender cmo se adquiere, cmo se almacena y cmo
VHH[SUHVDODLQIRUPDFLyQUHODFLRQDGDFRQODPHPRULDHVSHFtFDGHODHPRFLyQGH
miedo; por lo tanto, es necesario delimitar cmo un estmulo llega hasta la amg-
dala, cmo repercute en dicha estructura y cmo se proyecta desde ella hasta otras
estructuras y centros. As pues, desde estas aproximaciones recientes, se considera
TXHODDPtJGDODGHWHUPLQDODVLJQLFDFLyQGHOHVWtPXORHQFXHVWLyQ\DFWLYDOD
respuesta emocional apropiada, as como el ajuste del medio ambiente interno del
RUJDQLVPRSDUDHQIUHQWDUVHDHVDVLWXDFLyQGHSHOLJURRDPHQD]D(QRSLQLyQGH
/H'RX[DXQTXHJUDQSDUWHGHODLQYHVWLJDFLyQVHKDUHDOL]DGRFRQUDWDVWDPELpQ
el cerebro humano funciona segn este patrn prototpico de defensa. Eviden-
temente, el hecho de encontrar la misma infraestructura neurobiolgica para la
emocin de miedo en muchas especies nos indica que el proceso de evolucin
PDQWLHQHGLFKDFDUDFWHUL]DFLyQELROyJLFDSRUTXHSRVHHIXQFLRQHVDGDSWDWLYDV(O
cerebro de todas estas especies se encuentra especialmente dotado para incremen-
tar la probabilidad de supervivencia. Aunque los eventos que producen miedo son
muy diferentes entre las distintas especies, cada una de ellas se encuentra espe-
cialmente preparada en su dotacin gentica para que se active el sistema neuro-
ELROyJLFRGHOPLHGRDQWHORVHVWtPXORVHVSHFtFRVGHWDOVXHUWHTXHVHSXHGHGHFLU
que el modo mediante el cual el cerebro se enfrenta al peligro es bastante parecido.
(VWDSRVLELOLGDGGHH[WUDSRODFLyQLQWHUHVSHFtFDVLHQGR~WLOHQWpUPLQRVJHQHUD-
les, requiere una especial prudencia cuando una de las especies implicadas es la
humana, pues la existencia de patrones de desarrollo especialmente diferenciados
puede llevar a la eventual diferencia cualitativa en la funcin de la amgdala entre
ODVGLVWLQWDVHVSHFLHV$VtHOKHFKRGHTXHJUDQSDUWHGHODLQYHVWLJDFLyQUHDOL]DGD
se haya llevado a cabo con ratas ha suscitado una cierta controversia, dando lugar
a que algunos autores cuestionen la posibilidad de extrapolar al ser humano los
UHVXOWDGRVREWHQLGRV(VWHHVXQRGHORVDVXQWRVPiVLPSRUWDQWHVTXHVHHVWiQWUD-
tando en la actualidad, ya que la dispersin de resultados que se aprecia al estudiar
ORVHIHFWRVGHODOHVLyQGHODDPtJGDODHQGLVWLQWDVHVSHFLHVGHSULPDWHVHQIDWL]DOD
PiVTXHSUREDEOHIXQFLyQGLIHUHQFLDOGHGLFKDHVWUXFWXUDHQODVGLVWLQWDVHVSHFLHV

(Q~OWLPDLQVWDQFLDHVQHFHVDULRUHVHxDUTXHODORFDOL]DFLyQGHHVWHPHFDQLVPR
neurobiolgico particular no agota por completo lo que tiene que ser lo que es
OD HPRFLyQ GH PLHGR DO PHQRV HQ HO VHU KXPDQR (O DQiOLVLV PiV HODERUDGR GHO
estmulo o evento elicitador puede dar lugar de forma concomitante a la experien-
FLDFRQVFLHQWHGHODHPRFLyQGHPLHGR(VQHFHVDULRHQIDWL]DUTXHHVDH[SHULHQFLD
FRQVFLHQWHGHPLHGRHVYLDEOHFXDQGRHOFHUHEURVHHQFXHQWUDORVXFLHQWHPHQWH
desarrollado como para que se posea consciencia de las actividades propias. Es de-
cir, se requiere un sistema conformado por las estructuras del sistema subcortical,
PiVFLHUWDVHVWUXFWXUDVFRUWLFDOHVORVVHQWLPLHQWRVVRQHOSURGXFWRGHODDFWLYLGDG
FRRUGLQDGDGHOVLVWHPDVXEFRUWLFDO\ODFRUWH]D /H'RX[ (VHYLGHQWHTXH
el ser humano posee esa capacidad, mientras que es menos claro que otras espe-
cies tambin la posean. En cualquier caso, este aspecto diferencial no es bice
para que se aborde el estudio del sistema de miedo en el cerebro, pues parece que,
ORJHQpWLFDPHQWH KDEODQGR VH WUDWD GH XQD GRWDFLyQ PX\ DQWLJXD DQWHULRU D OD
existencia de la funcin que permite al ser humano experimentar el sentimiento de

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 185 Manual de teoras emocionales y motivacionales - UJI
PLHGR3DUHFHTXHORPiVDSURSLDGRHVHOHVWXGLRGHORVVLVWHPDVQHXUDOHVTXHKDQ
evolucionado para permitir las soluciones conductuales a los distintos problemas
relacionados con la supervivencia.

A pesar de todo lo expuesto, sigue habiendo algunos aspectos que promueven una
FLHUWDFRQWURYHUVLD$VtXQRGHORVSUREOHPDVLPSOtFLWRVHQHOUD]RQDPLHQWRGH
TXLHQHVGHHQGHQODSRVLELOLGDGGHTXHODDPtJGDODVHDODHVWUXFWXUDUHVSRQVDEOH
de las emociones, es que dejan sin aclarar si el proceso emocional puede ocurrir
independientemente del procesamiento cortical, e incluso si cabe la posibilidad de
establecer una repercusin interactiva entre ambas formas de procesamiento. Como
KDVHxDODGR$UPRQ\  VHSRGUtDSHQVDUTXHHOSURFHVDPLHQWRHPRFLRQDOSXH-
de ocurrir independientemente de los mecanismos atencionales con caractersticas
de arriba hacia abajo. Incluso, teniendo en cuenta que el condicionamiento de
HVWHWLSRGHUHSXHVWDVLPSOLFDODWUDQVPLVLyQGHLQIRUPDFLyQGHVGHHOWiODPRKDV-
ta la amgdala, y que luego esta estructura enva proyecciones a las estructuras
corticales, se podra considerar la posibilidad de que dicho proceso emocional
modulase algunos aspectos del funcionamiento cognitivo relacionados con el al-
PDFHQDPLHQWRHQPHPRULDGHODH[SHULHQFLDHPRFLRQDO7DPELpQHQFXDQWRDOD
propia respuesta emocional, existen algunos trabajos en los que no queda delimi-
tado el papel de la amgdala en la preparacin de la respuesta emocional, ni en la
expresin de las emociones.

An as, la mayor parte de los resultados existentes en la actualidad apuntan hacia


su implicacin, tanto en el procesamiento de la informacin entrante como en la
SUHSDUDFLyQGHODUHVSXHVWDHPRFLRQDO/RTXHVHUtDQHFHVDULRHVSXOLUDOJXQRVDV-
SHFWRVPHWRGROyJLFRV\DTXHSRUUHJODJHQHUDOVHKDXWLOL]DGRODDEODFLyQFRPR
tcnica de lesin, con los consabidos efectos negativos que posee esta tcnica a la
hora de delimitar exactamente el tamao de la lesin que se intenta provocar.

)LQDOPHQWHTXHUHPRVVHxDODUTXHHORULJHQGHOHVWXGLRGHODDPtJGDODHQUHODFLyQ
con el procesamiento visual de estmulos emocionales se produce con la investiga-
FLyQGH.OYHU\%XF\  (VWRVDXWRUHVWUDEDMDURQFRQmacacus rhesus a los
TXHVHOHVUHDOL]yXQDDEODFLyQELODWHUDOGHOOyEXORWHPSRUDOKDOODQGRTXHGLFKD
lesin mostraba alteraciones emocionales y conductuales.

Respecto a los hemisferios cerebralesHQORV~OWLPRVDxRVVHKDQUHDOL]DGRUHYL-


siones importantes que, a grandes rasgos, tambin encuentran una relativa impli-
cacin diferencial de los hemisferios en la expresin emocional. En este orden de
FRVDVHQXQWUDEDMRSUHYLR 3DOPHUR KDFtDPRVUHIHUHQFLDDFLHUWRVDVSHFWRV
de inters, resaltando que la expresin emocional adquiere matices diferenciales
HQDPEDVSDUWHVGHODFDUD/DSDUWHGHUHFKDGHODPLVPDHVVHJ~Q:ROII  
OD ]RQD S~EOLFD SXHV UHHMD ODV HPRFLRQHV TXH HO VXMHWR TXLHUH TXH ORV GHPiV
SHUFLEDQPLHQWUDVTXHODSDUWHL]TXLHUGDGHODFDUDHVOD]RQDPiVSULYDGDHQOD
H[SUHVLyQ HPRFLRQDO 6RQ DUPDFLRQHV EDVWDQWH DFHSWDGDV HQ OD DFWXDOLGDG \D
TXHHQHOVHQWLGRGHODVDSRUWDFLRQHVGH(NPDQ  VHKDSRGLGRHVWDEOHFHUTXH
FXDQGRXQVXMHWRPDQLHVWDYROXQWDULD\QJLGDPHQWHXQDHPRFLyQODH[SUHVLyQ
GHODPLVPDHVDVLPpWULFDREVHUYiQGRVHTXHKDELWXDOPHQWHODSDUWHL]TXLHUGDGH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 186 Manual de teoras emocionales y motivacionales - UJI
la cara expresa con mayor intensidad la emocin en cuestin, mientras que, cuando
XQLQGLYLGXRPDQLHVWDHVSRQWiQHDPHQWHXQDHPRFLyQODH[SUHVLyQGHODPLVPDHV
bastante simtrica en ambas partes de la cara. Ahora bien, incluso en los casos de
expresin de emociones verdaderas, es decir, en los casos de simetra expresiva entre
DPEDVSDUWHVGHODFDUDKD\TXHWHQHUSUHFDXFLyQFRQODH[FHVLYDJHQHUDOL]DFLyQ

$VtHVWXGLRVPiVUHFLHQWHVDSRUWDQLQIRUPDFLyQUHIHULGDDODLPSOLFDFLyQGHOKH-
PLVIHULRGHUHFKRHQORVFRPSRQHQWHVDXWRPiWLFRVGHODHPRFLyQSDUWLFXODUPHQWH
HQODUHVSXHVWDH[SUHVLYD\DXWRQyPLFD *DLQRWWL%RURG6DQWVFKL\.RII
 3RUVXSDUWHHOKHPLVIHULRL]TXLHUGRSDUHFHMXJDUXQSDSHOUHOHYDQWHHQODV
IXQFLRQHVGHFRQWURO\GHPRGXODFLyQVREUHODH[SUHVLyQHPRFLRQDOHVSRQWiQHD
(QHVWHRUGHQGHFRVDVVLJXLHQGRORVWUDEDMRVGH*DLQRWWL  VHVDEHTXHORV
SDFLHQWHVFRQOHVLRQHVHQHOKHPLVIHULRL]TXLHUGRPXHVWUDQXQDPD\RUUHDFWLYLGDG
HPRFLRQDO\DTXHDOQRSURGXFLUVHHOFRQWUROPRGXODGRUWtSLFRGHOKHPLVIHULRL]-
quierdo, se incrementa la frecuencia de las manifestaciones expresivas emociona-
OHVFRQWURODGDVSRUHOKHPLVIHULRGHUHFKR$GHPiVHVWHWLSRGHSDFLHQWHVPXHVWUDQ
WDPELpQXQDPD\RUDFWLYDFLyQDXWRQyPLFDKHFKRTXHFRPRLQGLFDQ0HDGRZV\
.DSODQ  UHPDUFDSRUXQDSDUWHODDXVHQFLDGHFRQWURORPRGXODFLyQGHO
KHPLVIHULR L]TXLHUGR \ SRU RWUD OD PiV EiVLFD GH ODV SUHPLVDV OD LPSOLFDFLyQ
clara del hemisferio derecho en el control de las manifestaciones autonmicas del
organismo.

Sin embargo, an aceptando la existencia de la asimetra hemisfrica en el control


de la expresin emocional, siguen quedando algunas dudas que, al menos a nues-
WURSDUHFHUVRQUHOHYDQWHV 3DOPHUR 3RUHMHPSORTXHGDSRUUHVROYHUVLOD
DVLPHWUtDVHJHVWDHQODVSURSLDVHVWUXFWXUDVWHOHQFHIiOLFDVHVWRHVHQORVKHPLVIH-
rios, o, por el contrario, la asimetra se produce en las estructuras subcorticales y
VHUHHMDHQORVKHPLVIHULRV

3RURWURODGRWUDWDQGRGHHVSHFLFDUPiVWRGDYtDODORFDOL]DFLyQQHXURELROyJLFD
del control sobre la expresin y conducta emocionales, en algunos trabajos recien-
tes se ha puesto de relieve la importancia capital de los lbulos frontales. As, se ha
podido comprobar que las lesiones en los lbulos frontales en general tienen una
PD\RUUHSHUFXVLyQQHJDWLYDTXHODVOHVLRQHVHQODV]RQDVWHPSRUDOHV\SDULHWDOHV
sobre el control de la manifestacin emocional. Esta mayor repercusin se puedo
DSUHFLDUWDQWRHQODH[SUHVLyQHVSRQWiQHDFRPRHQODH[SUHVLyQYROXQWDULDGHOD
HPRFLyQ .ROE\7D\ORU 

En ltima instancia, como parece desprenderse de la situacin actual del tema


en este campo, la aparicin de resultados heterogneos nos lleva a ser prudentes
D OD KRUD GH HVWDEOHFHU XQD GHOLPLWDFLyQ ORFDOL]DFLRQLVWD GHPDVLDGR FHUUDGD \D
TXHDXQTXHSUHVXPLEOHPHQWHVHHVWiQLQYHVWLJDQGRODVHVWUXFWXUDVQHXURELROyJL-
cas que se encuentran implicadas en el control de la conducta emocional, el papel
H[DFWRTXHMXHJDFDGDXQDGHHOODVVLJXHVLHQGRDPELJXR/DVKLSyWHVLVTXHFRQ
PD\RUIUHFXHQFLDVHXWLOL]DQDODKRUDGHORFDOL]DUODSDUWLFLSDFLyQGHORVKHPLV-
ferios cerebrales en las emociones son las siguientes: a  HO KHPLVIHULR GHUHFKR
SRVHHXQDPDUFDGDVXSHULRULGDGVREUHHOKHPLVIHULRL]TXLHUGRHQHOSODQRGHOD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 187 Manual de teoras emocionales y motivacionales - UJI
conducta emocional en general; b ORVGRVKHPLVIHULRVSRVHHQXQDHVSHFLDOL]DFLyQ
complementaria para el control de los distintos aspectos relacionados con el afec-
WRHQSDUWLFXODUHOKHPLVIHULRL]TXLHUGRWHQGUtDXQSDSHOSUHGRPLQDQWHSDUDODV
emociones positivas, mientras que el hemisferio derecho sera predominante para
las emociones negativas; c ODH[SUHVLyQHPRFLRQDODOLJXDOTXHHOOHQJXDMHHV
una forma esencial de comunicacin el hemisferio derecho es dominante para la
expresin emocional, de una forma similar a la superioridad que posee el hemis-
IHULRL]TXLHUGRSDUDHOOHQJXDMHd HOKHPLVIHULRGHUHFKRHVGRPLQDQWHSDUDOD
percepcin de todos aquellos eventos emocionalmente relacionados, tales como
expresiones faciales, movimientos corporales, etc.

Con todo ello, se observa que el campo de investigacin es amplio, las posturas
tericas variadas, y, lgicamente, los resultados heterogneos. Estas limitaciones
impiden el consenso acerca del papel concreto que juegan los hemisferios en gene-
UDO$OJXQRVDXWRUHVFRPR/H'RX[VHxDODQTXHKD\TXHEXVFDUDOWHUQDWLYDVPH-
WRGROyJLFDVHQHOFDPSRGHODQHXURELRORJtD\HQGRKDFLDODHYHQWXDOORFDOL]DFLyQ
HVSHFtFDGHXQD]RQDFHUHEUDOFRQFUHWDLPSOLFDGDHQXQDHPRFLyQSDUWLFXODU6LQ
HPEDUJRSDUHFHPiVSUXGHQWHHYLWDUFXDOTXLHUDSUR[LPDFLyQH[FHVLYDPHQWHORFD-
OL]DFLRQLVWDHQXQiPELWRFRPRHOGHORVSURFHVRVHPRFLRQDOHVKDELGDFXHQWDGH
ODFDGDYH]PiVHYLGHQWHH[LVWHQFLDGHXQDLQWHUDFFLyQHQWUHORVSURFHVRVDIHFWLYRV
\ORVSURFHVRVFRJQLWLYRV 3DOPHUR 

([SHULHQFLDHPRFLRQDO
$QWHVGHQDOL]DUHVWHDSDUWDGRQRVJXVWDUtDUHIHULUQRVDXQRGHORVDVSHFWRVPiV
apasionantes en el campo de la psicologa en general, y de la psicologa de la emo-
cin en particular. Nos referimos al de la consciencia, que en el campo de la emocin
adquiere las connotaciones de experiencia emocional. Es muy frecuente encontrar
que, en la perspectiva basada en los componentes de la emocin, uno de sus com-
ponentes esenciales, tiene que ver con la dimensin subjetiva, genricamente de-
nominada experiencia emocional o sentimiento. Algunos autores en los ltimos
WLHPSRV /H'RX[%UDGOH\\/DQJ SURSRQHQTXHODH[SHULHQFLDHPR-
cional es simplemente un distractor que perturba el verdadero conocimiento del
SURFHVRHPRFLRQDOHOFXDOVHUHHUHDODGLPHQVLyQELROyJLFDGHODVHPRFLRQHV
vnculo que permite entender la propia evolucin a travs de sus caractersticas
FRPXQHVHQP~OWLSOHVHVSHFLHVGHODHVFDODORJHQpWLFD(QFDPELRKD\RWURV 'D-
PDVLR+HLOPDQ SDUDTXLHQHVQRVHSXHGHHQWHQGHUHOFRQRFLPLHQWR
completo de un proceso emocional sin contemplar la relevancia de la dimensin
subjetiva o experiencia emocional. Es evidente que los diferentes puntos de vista
UHHMDQ OD HQRUPH FRPSOHMLGDG TXH VLJXH UHYLVWLHQGR HO FRQFHSWR GH HPRFLyQ
SHURDGHPiVUHHMDQXQDFRQWURYHUVLDTXHVLHPSUHKDHVWDGRSUHVHQWH\HVOD
UHIHULGDDODGLFXOWDGGHKDFHUREMHWLYDXQDLQIRUPDFLyQTXHSHUWHQHFHDODVXEMH-
WLYLGDGGHFDGDSHUVRQD$OUHVSHFWRQRREVWDQWH6HDUOH  SURSRQHTXHODQD-
WXUDOH]DVXEMHWLYDGHODH[SHULHQFLDFRQVFLHQWHQRLPSLGHHOLQWHQWRGHHVWXGLDUOD
FLHQWtFDPHQWH'HHQGH6HDUOHTXHODFUHHQFLDGHTXHODH[SHULHQFLDFRQVFLHQWH
QRSXHGHVHUHVWXGLDGDFLHQWtFDPHQWHVHGHEHHQSDUWHDOIUDFDVRDODKRUDGH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 188 Manual de teoras emocionales y motivacionales - UJI
GLVWLQJXLUHQWUHHSLVWHPRORJtD HOPRGRTXHXWLOL]DPRVSDUDFRQRFHUDOJR \RQWROR-
JtD ODQDWXUDOH]DGHORTXHHVWiVLHQGRHVWXGLDGR (OKHFKRGHTXHODFRQVFLHQFLDHV
XQIHQyPHQRVXEMHWLYRHQSULPHUDSHUVRQD RQWRORJtD QRLPSLGHTXHGHVDUUROOH-
PRVXQDVHULHGHHVWUDWHJLDV\SURFHGLPLHQWRVFLHQWtFRVREMHWLYRV HSLVWHPRORJtD 
FRQHOQGHLQWHQWDUDSUR[LPDUQRVDVXFRQRFLPLHQWR\FRPSUHQVLyQ

(QHVWHPDUFRGHUHIHQHQFLD\HQWUHORVWUDEDMRVTXHDFWXDOPHQWHPHMRUSHUODQ
lo que tiene que ser el estudio de esta dimensin subjetiva, destacan los de de
Antonio Damasio(QORV~OWLPRVDxRVHODXWRUKDGHGLFDGRXQJUDQHVIXHU]RSRU
ORFDOL]DUODVEDVHVQHXURELROyJLFDVGHOVHQWLPLHQWRHPRFLRQDOHQHIHFWR'DPD-
VLR D OOHYDWLHPSRWUDWDQGRGHHVWXGLDUHOPRGR\HOOXJDUHQ
el que tienen lugar los eventos de consciencia. Segn la teora sobre la emocin
que plantea el autor, considera que este proceso parece un camino apropiado para
OOHJDUDOREMHWLYRGHODORFDOL]DFLyQ\XELFDFLyQGHODFRQVFLHQFLD3DUD'DPDVLR
la consciencia es algo enteramente privado del individuo que la posee, que ocurre
como parte de un proceso, tambin privado y personal de ese individuo, al que de-
nominamos mente. Pero, por otra parte, la consciencia y la mente se encuentran n-
WLPDPHQWHDVRFLDGDVDODVFRQGXFWDVH[WHUQDVTXHPDQLHVWDGLFKRLQGLYLGXR(VWR
es, cada individuo comparte estos tres fenmenos: mente, consciencia como par-
te de la mente y conductas observables. Por otra parte, la mente y las conductas
observables se encuentran tambin directamente asociadas con el funcionamiento
GHHVHRUJDQLVPRFRPRXQWRGRHVSHFtFDPHQWHFRQHOIXQFLRQDPLHQWRGHOFHUH-
EURGHHVHLQGLYLGXRFRQORFXDOQRVHQFRQWUDPRVFRQXQDWUtDGDEiVLFDPHQWH
cerebro y conducta observable, que ha permitido el avance del conocimiento
en los ltimos aos. En ltima instancia, la relacin esencial se produce entre el
cerebro y la mente. Ahora bien, como seala Damasio, no se puede desarrollar
una perspectiva integrada de la mente y el cerebro humanos si no consideramos el
estudio de la emocin.

$FWXDOPHQWH WDQWR OD HPRFLyQ FRPR VX H[SUHVLyQ UHSUHVHQWDQ ODV PiV GLUHFWDV
manifestaciones de primer orden para entender la biorregulacin de un organismo
complejo, sobre todo cuando este se encuentra inmerso en un ambiente con aspec-
tos tan complejos como la cultura y la sociedad. Segn Damasio, dicha regulacin
no se puede entender sin apelar al importante papel que juega la emocin, posee
las connotaciones de adaptacin y supervivencia de los organismos que han alcan-
]DGRODVPiVDOWDVFRWDVGHGHVDUUROORHQWUHORVTXHVHHQFXHQWUDFRPRHVREYLRHO
VHUKXPDQR3HURDGHPiVODHPRFLyQWDPELpQMXHJDXQSDSHOLPSRUWDQWHHQRWURV
SURFHVRVEiVLFRVGLUHFWDPHQWHUHODFLRQDGRVFRQODDGDSWDFLyQ\ODVXSHUYLYHQFLD
$Vt SRU XQD SDUWH UHSHUFXWH GH IRUPD FODUD VREUH ORV SURFHVRV GH DSUHQGL]DMH
consolidacin y recuperacin, de tal suerte que la unin entre emocin y memoria
representa un incremento exponencial de las probabilidades que tiene un orga-
QLVPRGHDGDSWDUVH\VREUHYLYLU3HURSRURWUDSDUWHWDPELpQLQX\HVREUHORV
SURFHVRVGHUD]RQDPLHQWR\GHWRPDGHGHFLVLRQHVGHVGHODVPiVVHQFLOODVKDVWD
ODVPiVFRPSOHMDV

$JUDQGHVUDVJRVODWHRUtDTXHSURSRQH'DPDVLR  VHEDVDHQORV


VLJXLHQWHVDVSHFWRV 3DOPHUR 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 189 Manual de teoras emocionales y motivacionales - UJI
/DVHPRFLRQHVVRQGHQLGDVFRPRSDWURQHVGHUHVSXHVWDVTXtPLFDV\QHXUDOHV
cuya funcin es contribuir al mantenimiento de la vida en un organismo, pro-
porcionando conductas adaptativas. Este importante papel de las emociones se
fundamenta en el hecho de que las estructuras neuroanatmicas que sirven de
base a los procesos emocionales son las mismas que se encargan de controlar y
UHJXODUORVHVWDGRVFRUSRUDOHVEiVLFRVPHGLDQWHSURFHVRVFRQFUHWRVWDOHVFRPR
la homeostasis.

/DVHPRFLRQHVHVWiQELROyJLFDPHQWHGHWHUPLQDGDVVLHQGRDVtSURFHVRVHVWHUHR-
WLSDGRV\DXWRPiWLFRV6LQHPEDUJRODFXOWXUD\ODVH[SHULHQFLDVHLQXHQFLDV
que recibe un individuo a lo largo de su desarrollo, juegan tambin un impor-
WDQWHSDSHO(VWDLQXHQFLDVHSXHGHUHHMDUWDQWRHQHOSODQRGHORVHVWtPXORV
desencadenantes de una emocin como en el plano de la expresin emocional.

'DPDVLRGLVWLQJXHHQWUHHPRFLRQHVSULPDULDVRXQLYHUVDOHVVHFXQGDULDVRVR-
FLDOHV\HPRFLRQHVGHIRQGR/DVHPRFLRQHVSULPDULDVRXQLYHUVDOHVVRQIHOL-
FLGDGWULVWH]DPLHGRLUDVRUSUHVD\DYHUVLyQDVFR/DVHPRFLRQHVVHFXQGDULDV
o sociales, tambin denominadas por Damasio otras conductasVRQYHUJHQ]D
FHORVFXOSD\RUJXOOR/DVHPRFLRQHVGHIRQGRVRQELHQHVWDUPDOHVWDUFDOPD
WHQVLyQHQHUJtDIDWLJDDQWLFLSDFLyQGHVFRQDQ]D6XSHFXOLDULGDGFRQVLVWHHQOD
QDWXUDOH]DGHORVLQGXFWRUHVTXHVXHOHQVHULQWHUQRV\HQHOIRFRGHODUHVSXHVWD
que, esencialmente, es el medio ambiente interno del organismo.

(QFXDQWRDODVHVWUXFWXUDVQHXURDQDWyPLFDVLPSOLFDGDVHQORVSURFHVRVHPR-
FLRQDOHVVHJ~QGLYHUVRVWUDEDMRV 'DPDVLR/H'RX[ KD\EDVWDQWH
DFXHUGRUHVSHFWRDTXHHOWURQFRHQFpIDORVHHQFXHQWUDLPSOLFDGRHQSUiFWLFD-
PHQWHWRGDVODVHPRFLRQHVHOKLSRWiODPR\ODFRUWH]DSUHIURQWDOYHQWURPHGLDO
SDUHFHQODVHVWUXFWXUDVTXHLQWHUYLHQHQHQODHPRFLyQGHWULVWH]DDXQTXHQR
intervienen en otras emociones, como la ira y el miedo; por su parte, la amg-
GDODHVODHVWUXFWXUDLPSOLFDGDHQODHPRFLyQGHPLHGR/DFRUWH]DFLQJXODGD
anterior tambin parece jugar un cierto papel en los procesos emocionales, con-
cretamente estara relacionada con la consciencia de la emocin. Existe una
cierta coincidencia cuando se habla del sustrato neurobiolgico de la expe-
ULHQFLDFRQVFLHQWHGHODHPRFLyQSURSRQLHQGRTXHODFRUWH]DFLQJXODGDSRGUtD
jugar un papel relevante.

/DRFXUUHQFLDGHXQSURFHVRHPRFLRQDOVHJXLUtDXQDVXFHVLyQGHHYHQWRVTXH
se inician, bien con la deteccin de un objeto o situacin mediante la percep-
cin a travs de los receptores, bien con el recuerdo de ese objeto o situacin;
en ambos casos, el resultado es la activacin de los ncleos del troncoencfa-
ORHOKLSRWiODPR\ODDPtJGDOD6HJXLGDPHQWHHVWDVHVWUXFWXUDVOLEHUDQKRU-
monas de varios tipos en la corriente sangunea, que se dirigen, por una parte,
KDFLDGLYHUVDV]RQDVGHOSURSLRFXHUSRFRQORTXHVHPRGLFDUiHOSHUOGHO
PHGLR DPELHQWH LQWHUQR \ SRU RWUD SDUWH KDFLD GLVWLQWDV ]RQDV FHUHEUDOHV
WDOHVFRPRODFRUWH]DVRPDWRVHQVRULDO\ODFRUWH]DFLQJXODGDFRQORTXHVH
PRGLFDUiODVHxDOL]DFLyQGHORVHVWDGRVFRUSRUDOHVHQHOFHUHEUR$OPLVPR
WLHPSRHVWDVHVWUXFWXUDVHQYtDQGHPRGRVLPXOWiQHRVHxDOHVHOHFWURTXtPLFDV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 190 Manual de teoras emocionales y motivacionales - UJI
PHGLDQWHQHXURWUDQVPLVRUHVSRUXQDSDUWHKDFLDODVJOiQGXODVDGUHQDOHVTXH
OLEHUDUiQKRUPRQDVFRQUHSHUFXVLyQSRVWHULRUHQHOFHUHEUR\SRURWUDSDUWH
KDFLDRWUDVUHJLRQHVFHUHEUDOHVWDOHVFRPRODFRUWH]DHOWiODPR\ORVJDQJOLRV
EDVDOHVFRQORFXDOVHPRGLFDUiHOHVWDGRFRJQLWLYRGDQGROXJDUDODHYHQWXDO
manifestacin de conductas emocionales, as como a una particular forma de
procesar la informacin.

En la teora de Damasio cobra especial relevancia la relacin entre sentimiento y


emocin, siendo necesario distinguir entre ambas variables. Son dos trminos que,
FRPRKHPRVUHVHxDGRHQYDULDVRFDVLRQHVDQWHULRUPHQWHKDQVLGRXWLOL]DGRVGH
IRUPD7DPELpQ'DPDVLRVHxDODTXHDXQTXHVHHQFXHQWUDQtQWLPDPHQWHDVRFLD-
GRVQRVRQODPLVPDFRVD&RQFUHWDPHQWHODHPRFLyQVHUHHUHDXQDVHULHGH
UHVSXHVWDVTXHGHVHQFDGHQDGDVGHVGH]RQDVFRQFUHWDVGHOFHUHEURWLHQHQOXJDU
HQRWUDV]RQDVGHOFHUHEURDVtFRPRHQRWUDVSDUWHVGLYHUVDVGHOUHVWRGHOFXHU-
SR(OUHVXOWDGRQDOGHWDOHVUHVSXHVWDVHVXQestado emocional, que podra ser
GHQLGRFRPRHOFRQMXQWRGHORVGLIHUHQWHVFDPELRVFRUSRUDOHVTXHH[SHULPHQWD
HO LQGLYLGXR HQ FXHVWLyQ 3RU VX SDUWH HO VHQWLPLHQWR VH UHHUH DO UHVXOWDGR GHO
estado emocional, que, en palabras de Damasio, hace referencia a un complejo
estado mental. Este estado mental incluye, por una parte, la representacin de
ORVFDPELRVTXHHVWiQRFXUULHQGRHQHOSURSLRFXHUSR\TXHVRQUHSUHVHQWDGRV
en las correspondientes estructuras del sistema nervioso central, y, por otra parte,
diversas alteraciones en el procesamiento cognitivo, que son el resultado de las
respuestas cerebro-cerebro. Es decir, primero ocurre la emocin, cuyos resultados
son de dos tipos: por una parte, hacia afuera, en forma de diversas conductas, fun-
GDPHQWDOPHQWHHQIRUPDGHH[SUHVLRQHVPiVRPHQRVGHQLGDVTXHVLUYHQSDUD
FRPXQLFDUDORVGHPiVQXHVWURHVWDGRLQWHUQRSRURWUDSDUWHKDFLDDGHQWURHQ
forma de experiencia subjetiva del estado emocional o sentimiento, que afecta a la
GLQiPLFDGHOSHQVDPLHQWRHQFXUVR\FRQVLJXLHQWHPHQWHDODVGLVWLQWDVDFWLYLGD-
des cognitivas y conductas varias del futuro inmediato. Dicho con otras palabras:
el sentimiento de la emocin es la experiencia mental y privada de la emocin,
mientras que la emocin es un conjunto de manifestaciones, algunas de las cuales
son perfectamente observables.

7DQWRODHPRFLyQFRPRHOVHQWLPLHQWRVRQVXVFHSWLEOHVGHLQYHVWLJDFLyQDXQTXH
ODHPRFLyQUHVXOWDEDVWDQWHPiVDVHTXLEOHTXHHOVHQWLPLHQWR\DTXHHOHVWtPXOR
SXHGHVHUIiFLOPHQWHLGHQWLFDEOHSXGLHQGRDSUHFLDUWDPELpQTXHPXFKDVGHODV
PDQLIHVWDFLRQHV R UHVSXHVWDV VRQ H[WHUQDV FRQ OR TXH HV PXFKR PiV YLDEOH OD
medida de las mismas.

(QXQWUDEDMRSRVWHULRU 'DPDVLR HODXWRUVHxDODPiVHVSHFtFDPHQWHHO


proceso seguido desde que un estmulo desencadena un proceso emocional hasta
que un individuo toma conciencia del sentimiento producido por dicha emocin.
As, el primer paso tiene que ver con un estado de emocin, que puede ser desenca-
denado y ejecutado de forma no consciente; el segundo paso tiene que ver con un
estado de sentimiento, que puede ser representado no conscientemente; el tercer
SDVRVHUHHUHDun estado de sentimiento hecho consciente, que ocurre cuando un
RUJDQLVPRFRQRFHTXHHVWiH[SHULPHQWDQGRXQDHPRFLyQ\XQVHQWLPLHQWR(VWH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 191 Manual de teoras emocionales y motivacionales - UJI
PDWL]GLVFXWLEOHRQRHVLPSRUWDQWHHQODWHRUtDGH'DPDVLRTXLHQ~OWLPDPHQWH
'DPDVLR VHxDODTXHFRQHOVXVWUDWRQHXUDOGHODHPRFLyQHVVXFLHQWHSDUD
que ocurra un proceso emocional y el sentimiento asociado al mismo, entendiendo
en este caso que el sentimiento hace referencia a una imagen mental. El proceso
VHUtDGHOVLJXLHQWHPRGR  LQGXFFLyQGHXQDHPRFLyQ  RFXUUHQFLDGHFDPELRV
HQHOFXHUSR\HQHOFHUHEUR  SDWURQHVQHXUDOHVTXHUHSUHVHQWDQORVFDPELRVHQ
HORUJDQLVPR  VHQVDFLyQRFRQYHUVLyQGHOSDWUyQQHXUDOHQODIRUPDGHLPiJH-
QHV VHQWLPLHQWR   VHQWLPLHQWRGHOVHQWLPLHQWRRFRQRFLPLHQWRGHOVHQWLPLHQ-
to, que forma parte del proceso de consciencia.

$SDUWLUGHODH[SRVLFLyQTXH'DPDVLRYDUHDOL]DQGRGHODUHODFLyQHQWUHHPRFLyQ
cerebro y consciencia, parece que los acontecimientos tengan que producirse de
XQPRGRFRQFUHWR9HDPRV(QSULPHUOXJDUFXDQGRVHSURGXFHXQHVWtPXORH[-
WHUQRRLQWHUQRODFRUWH]DVHQVRULDOPDSHDGLFKRREMHWRRVLWXDFLyQRORKDFH
el hipocampo si se trata del recuerdo de un objeto o situacin, producindose al
mismo tiempo la activacin de las estructuras neuroanatmicas que se encuentran
relacionadas con la emocin en opinin de Damasio, fundamentalmente, el tron-
FRHQFpIDORHOKLSRWiODPR\ODDPtJGDOD(QVHJXQGROXJDUODDFWLYDFLyQGHHVWDV
estructuras produce tres efectos: ocasiona importantes reacciones autonmicas en
HOFXHUSRGHVHQFDGHQDHOHQYtRGHPHQVDMHVQHXUDOHVDRWUDV]RQDVGHOFHUHEUR
MXQWRFRQODFRUWH]DVRPDWRVHQVRULDOSURGXFHHOPDSHRRUHSUHVHQWDFLyQGHODV
UHDFFLRQHVVRPiWLFDVTXHGLFKDVHVWUXFWXUDVKDQSURGXFLGR MXQWRFRQODViUHDVVR-
matosensoriales, constituyen lo que Damasio denomina el proto-self <QDOPHQ-
WHFRQODSDUWLFLSDFLyQGHODFRUWH]DFLQJXODGDDQWHULRUHOWiODPR\TXL]iWDPELpQ
los colculos superiores, se produce el mapeo del objeto junto con el siempre cam-
biante mapa del organismo. Este fenmeno concreto constituye lo que Damasio
denomina centro de la consciencia.

$VtSXHVODVHVWUXFWXUDVEiVLFDV WURQFRHQFpIDORKLSRWiODPR\DPtJGDOD SDUHFHQ


VHUQHFHVDULDV\VXFLHQWHVSDUDODRFXUUHQFLDGHODHPRFLyQSHURQRVRQVXFLHQ-
tes para la consciencia de la emocin.

Para concluir con este autor, a nuestro modo de ver, la explicacin de las emocio-
QHVTXHRIUHFH'DPDVLRHVLQFRQIXQGLEOHPHQWHQRFRJQLWLYLVWDSXHVVHUHHUHDO
SURFHVRHPRFLRQDOHQWpUPLQRVGHXQFRQMXQWRGHUHVSXHVWDVFHUHEUDOHVVRPiWLFDV
\FRQGXFWXDOHVTXHRFXUUHQWUDVODSHUFHSFLyQRHOUHFXHUGRGHXQREMHWR 3DOPH-
UR 3RUHVDUD]yQFRPRLQGLFD0RVFD  WUDVDSUR[LPDGDPHQWHWUHLQWD
aos de investigacin en psicologa cognitiva, la teora de Damasio se encuentra
EDVWDQWHSUy[LPDDORVFOiVLFRVDUJXPHQWRVGH-DPHV/DGLIHUHQFLDHQWUHDPERV
SODQWHDPLHQWRVVHVLW~DHQHOJUDGRGHFRQRFLPLHQWRTXHDPERVDXWRUHV -DPHV
\'DPDVLR SRVHHQDFHUFDGHODUHODFLyQHQWUHSURFHVRVHPRFLRQDOHV\FHUHEUR
siendo el de este mucho mayor que el de aquel. As, un problema importante en la
argumentacin de Damasio tiene que ver con la ausencia de una explicacin clara
del modo mediante el cual un sujeto, en un estado de activacin autonmica, con
FRQWUDFFLRQHVYLVFHUDOHVLQFUHPHQWRVHQVXIUHFXHQFLDFDUGLDFDHWFHVFDSD]GH
encontrar una explicacin a su estado o situacin, sin la informacin derivada de la
QDWXUDOH]DGHOHVWtPXOR(VGHFLUVLQVDEHUVLODLQIRUPDFLyQTXHVHHVWiSURFHVDQGR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 192 Manual de teoras emocionales y motivacionales - UJI
de ese estmulo es relevante para el bienestar del sujeto. Esta laguna en la argu-
PHQWDFLyQGH'DPDVLRHVPiVHYLGHQWHFXDQGRHODXWRUVHUHHUHDODVHPRFLRQHV
VHFXQGDULDVRVRFLDOHVHQHVWHVHQWLGRWDO\FRPRVXEUD\D0RVFD  QRVH
HQWLHQGHFyPRHVSRVLEOHVHQWLURUJXOORYHUJHQ]DRFXOSDVLQWHQHUHQPHQWHOD
representacin valorativa, no solo del objeto, sino tambin, y esto es lo importante,
de las situaciones complejas que dan lugar a tales emociones.

&RQFOXVLRQHV
A partir de los tres grandes ejes en torno a los que se acumula la mayor parte de la
investigacin neurobiolgica actual que acabamos de ver, a saber: el del procesa-
miento de la estimulacin emocional, el de la preparacin de la respuesta emocio-
nal, y el de la experiencia subjetiva o sentimiento emocional, consideramos que
la dimensin neurobiolgica es imprescindible a la hora de conocer y comprender
ORVSURFHVRVHPRFLRQDOHV 3DOPHUR 'HKHFKRDFWXDOPHQWHODRULHQWDFLyQ
centrada en la neurociencia cognitiva aporta soluciones importantes para entender
los procesos de la motivacin y la emocin, ya que combina argumentos e hipte-
sis procedentes de las aproximaciones neurobiolgica y cognitivista.

Sin embargo, ha habido, cierta reticencia a este tipo de planteamientos, mostrando


dicha disconformidad mediante la defensa de una neurociencia afectiva, la cual
WHQGUtDFRPRREMHWLYRHOHVWXGLRGHODQHXURELRORJtDGHOD(PRFLyQ0HGLDQWHOD
XWLOL]DFLyQGHODVPRGHUQDVWpFQLFDVGHQHXURLPDJHQXQDGHODVPHWDVLPSRUWDQ-
tes en este tipo de aproximacin tiene que ver con la diseccin de la emocin en
VXVRSHUDFLRQHVPHQWDOHVPiVHOHPHQWDOHVORFDOL]DQGRHOVXVWUDWRQHXURELROyJL-
co implicado en cada una de ellas. Si bien, la cuestin importante sera dilucidar
si con tales formulaciones se aporta algo al conocimiento del funcionamiento
general del ser humano. De hecho, la designacin de la emocin como algo ubi-
FDGR IXHUD GH OD QHXURFLHQFLD FRJQLWLYD SXHGH VLJQLFDU OD FRQVLGHUDFLyQ GHOD
emocin como algo opuesto a la cognicin; es decir, puede dar la impresin de que se
UHWRUQDDXQDQWDJRQLVPRHQWUHHPRFLyQ\FRJQLFLyQ3RGUtDVLJQLFDUODYXHOWD
a un dualismo cartesiano que creamos haber superado; de hecho, la tendencia
TXHKDGRPLQDGRHQSVLFRORJtDFRPRFRQVHFXHQFLDGHODLQXHQFLDSODWRQLVWD
ha sido la consideracin por separado de la emocin. Sin embargo, la estrategia
opuesta, la que parece que se va imponiendo de forma progresiva en nuestros
das, es la de la sntesis, en virtud de la cual se intenta la consideracin de las
variables implicadas motivacin, emocin y cognicin de una forma conjunta
y combinada: interactiva.

$O UHVSHFWR DOJXQRV DXWRUHV PiV UHFLHQWHPHQWH 5DPRV 3LTXHUDV 0DUWtQH] \


2EOLWDV WDPELpQVXJLHUHQKDEODUGHDFWLYDFLyQVLROyJLFD\GHVHQVDFLRQHV
fsicas, por un lado, y de cogniciones, por otro. Esto es, entendiendo la emocin
como el resultado de una interpretacin, la unin o conjuncin de dos tipos de
LQIRUPDFLyQODGHXQHVWDGRItVLFR\XQDFRJQLFLyQ LGHDRSHQVDPLHQWR HQXQD
VLWXDFLyQ FRQFUHWD /RV PLVPRV DXWRUHV VHxDODQ HQ FRQVRQDQFLD FRQ 'XQFDQ \

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 193 Manual de teoras emocionales y motivacionales - UJI
%DUUHW  TXHODHPRFLyQHVXQWLSRGHFRJQLFLyQXQFRQRFLPLHQWRTXHQRV
SHUPLWH HODERUDU OD DFFLyQ DFFLRQHV TXH LUiQ HQFDPLQDGDV D PDQWHQHU QXHVWUR
bienestar, a contribuir por tanto a nuestra felicidad.

(QGHQLWLYDUHVSHFWRDODDSRUWDFLyQGHORVDUJXPHQWRVQHXURELROyJLFRVSDUHFH
clara la implicacin de la amgdala y de los hemisferios cerebrales. Cada una de
ODVHVWUXFWXUDVLPSOLFDGDVMXHJDXQSDSHOGHQLGRHQORVSURFHVRVHPRFLRQDOHV
\DXQTXHODSRVWXUDPiVSUXGHQWHSRGUtDKDFHUQRVSHQVDUHQXQIXQFLRQDPLHQWR
FRQMXQWRGHOVLVWHPDQHUYLRVRFHQWUDOHQWHQGLGRHVWHFRPRXQWRGRRUJDQL]DGR
QRVSDUHFHSHUWLQHQWHVXJHULUDOJXQRVFRPHQWDULRVHVSHFtFRVSDUDFDGDXQDGHODV
dos estructuras reseadas.

As pues, por una parte, en cuanto a la participacin de la amgdala en la emocin,


WDOFRPRLQGLFDQGLYHUVRVDXWRUHV /H'RX[+LUVFKHOG\*HOPDQ
'DPDVLR SDUHFHEDVWDQWHFRQUPDGRVXSDSHOHQHOSURFHVDPLHQWRGHODLQ-
formacin emocional. Este hecho reviste una trascendencia especial, pues, como
LQGLFD *DLQRWWL   SRGUtD SHQVDUVH TXH OD DPtJGDOD WLHQH XQD FRQWULEXFLyQ
VHOHFWLYDUHODFLRQDGDFRQODYDORUDFLyQ appraisal FRQORFXDOVHDFODUDXQSRFR
PiVHOSDSHOSUHFLVRGHODDPtJGDODHQHOVHUKXPDQR/DDPtJGDODSRGUtDVHULP-
portante en la emocin, ejerciendo un papel integrador del procesamiento cogni-
WLYR\GHODVLJQLFDFLyQHPRFLRQDOSXGLHQGRSUHSDUDUODVUHVSXHVWDVLQPHGLDWDV
apropiadas a la situacin. Es decir, la visin de la amgdala como una estructura
HVSHFtFDPHQWHLPSOLFDGDHQORVSURFHVRVHPRFLRQDOHVSRGUtDVHUUHFRQVLGHUDGD
planteando que, al menos en el ser humano, dicha estructura posee funciones emo-
FLRQDOHV\FRJQLWLYDVFRQORFXDOVHHQIDWL]DGHQXHYRODFODUDLQWHUDFFLyQHQWUH
procesos afectivos y procesos cognitivos.

<SRURWUDSDUWHHQFXDQWRDODSDUWLFLSDFLyQHVSHFtFDGHORVKHPLVIHULRVFHUH-
brales en las emociones, parece claro que cada uno de ellos cumple una funcin
FRQFUHWDHQODLQWHUSUHWDFLyQ\HQODH[SUHVLyQGHODVPLVPDV/RVFRQRFLPLHQWRV
TXHDFWXDOPHQWHVHSRVHHQSHUPLWHQGHIHQGHUODH[LVWHQFLDGHXQDFLHUWDODWHUDOL]D-
FLyQKHPLVIpULFDSDUDHQWHQGHUHOFRQWUROHPRFLRQDO/DODWHUDOL]DFLyQHPRFLRQDO
UHIHULGDDOKHPLVIHULRGHUHFKRSRGUtDVHUPiVHYLGHQWHHQHOiPELWRGHODH[SUH-
sin emocional, adquiriendo por lo tanto connotaciones de comunicacin social.
6LQ HPEDUJR SDUHFH QHFHVDULR FRQVLGHUDU PiV PLQXFLRVDPHQWH GLFKD SDUWLFLSD-
FLyQGHOLPLWDQGRODUHOHYDQFLDHVWULFWDGHODVGLVWLQWDV]RQDVLQWUDKHPLVIpULFDV
DVtFRPRHOSDSHOTXHMXHJDQFLHUWDVHVWUXFWXUDVVXEFRUWLFDOHVWDQWRGLHQFHIiOLFDV
FRPRWURQFRHQFHIiOLFDV6LWHQHPRVHQFXHQWDHVWDVDSUHFLDFLRQHVVHUtDSHUWLQHQWH
DPSOLDUODHVWULFWDDODYH]TXHFOiVLFDGLIHUHQFLDFLyQIXQFLRQDOGHFDGDKHPLVIH-
rio en las distintas caractersticas que conforman los procesos emocionales, inclu-
\HQGRWDPELpQODVIXQFLRQHVGLIHUHQFLDOHVGHODV]RQDVDQWHULRUHV\SRVWHULRUHVGH
cada hemisferio en las emociones, pues la simple perspectiva de la lateralidad no
SDUHFHVXFLHQWHSDUDHQWHQGHUODVFRPSOHMDVLQWHUDFFLRQHVTXHVHSURGXFHQHQWUH
GLFKDV]RQDV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 194 Manual de teoras emocionales y motivacionales - UJI
Bibliografa
ADOLPHS, R. y A. R. DAMASIO (2000): Neurobiology of emotion at a systems
OHYHOHQ-&%RURG HG 7KH1HXURSV\FKRORJ\RI(PRWLRQ SS 
2[IRUG8QLYHUVLW\3UHVV2[IRUG
ARMONY, J. L. (1998): 5HDVRQ RI SDVVLRQ 7RZDUGV D QHXUDO WKHRU\ RI IHDU
processing and its interaction with cognition, Dissertation-Abstracts-
,QWHUQDWLRQDO6HFWLRQ%7KH6FLHQFHVDQG(QJLQHHULQJ % 
BECK, R. C.  0RWLYDWLRQ7KHRULHVDQG3ULQFLSOHV)RXUWK(GLWLRQ. Prentice-
+DOO(QJOHZRRG&OLIIV1XHYD-HUVH\
BISQUERRA, R. (2009): 7HRUtDV GH ODV HPRFLRQHV HQ Psicopedagoga de las
emociones&DS SS 6tQWHVLV
BOROD, J. C. y N. K. MADIGAN (2000): Neuropsychology of emotion and emotional
GLVRUGHUV $Q RYHUYLHZ DQG UHVHDUFK GLUHFWLRQV HQ - & %RURG HG  The
1HXURSV\FKRORJ\RI(PRWLRQ SS 2[IRUG8QLYHUVLW\3UHVV2[IRUG
BOROD, J. C.; C. SANTSCHI y E. KOFF   1HXURSV\FKRORJLFDO DVSHFWV RI
facial asymmetry during emotional expression: A review of the normal adult
literature, 1HXURSV\FKRORJ\5HYLHZ 
BRADLEY, M. M. y P. J. LANG (2000): 0HDVXULQJ HPRWLRQ %HKDYLRU IHHOLQJ
DQGSK\VLRORJ\HQ5'/DQH\/1DGHO HGV Cognitive Neuroscience of
Emotion SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
DAMASIO, A. R. (1989 a): 7LPHORFNHGPXOWLUHJLRQDOUHWURDFWLYDWLRQDV\VWHPVOHYHO
proposal for the neural substrates of recall and recognition, Cognition
(1994). 'HVFDUWHV HUURU (PRWLRQV 5HDVRQ DQG WKH +XPDQ %UDLQ Avon
%RRNV1XHYD<RUN
(1995): 7RZDUGDQHXURELRORJ\RIHPRWLRQDQGIHHOLQJ2SHUDWLRQDOFRQFHSWV
and hypotheses, The Neuroscientist 
(1999): 7KH )HHOLQJ RI ZKDW +DSSHQV %RG\ DQG (PRWLRQ LQ WKH 0DNLQJ RI
Consciousness+DUFRXUW1XHYD<RUN
(2000): $VHFRQGFKDQFHIRUHPRWLRQHQ5'/DQH\/1DGHO HGV Cognitive
Neuroscience of Emotion SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
DARWIN, C. R. (1872-1965): The Expression of the Emotions in Man and Animals.
University of Chicago Press, Chicago.
DEBIEC, J. y J. E. LEDOUX  )HDUVDQGWKHEUDLQ6RFLDO5HVHDUFK  

DELGADO M. R.; R. L. JOU; J. E. LEDOUX y E. A. PHELPS  $YRLGLQJQHJDWLYH
RXWFRPHV WUDFNLQJ WKH PHFKDQLVPV RI DYRLGDQFH OHDUQLQJ LQ KXPDQV GXULQJ
fear conditioning, )URQWLHUVLQEHKDYLRUDOQHXURVFLHQFH
DUFFY, E. (1972): $FWLYDWLRQ HQ 1 6 *UHHQHOG \ 5 $ 6WHUQEDFK
HGV  +DQGERRN RI 3V\FKRSK\VLRORJ\ SS   +ROW 5LQHKDUW DQG
:LQVWRQ1XHYD<RUN
DUNN, B. D.; T. DALGLEISH & A. LAWRENCE (2006): 7KH VRPDWLF PDUNHU
hypothesis: A critical evaluation, 1HXURVFLHQFHDQG%LREHKDYLRXUDO5HYLHZV
  

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 195 Manual de teoras emocionales y motivacionales - UJI
DUNCAN, S. y L. F. BARRET (2007): Affect is a form of cognition: A neurobiological
analysis, &RJQLWLRQ (PRWLRQ
EKMAN, P. (1985): Telling Lies%HUNOH\%RRNV1XHYD<RUN
FELDMAN, L.; E. BLISS-MOREAU; S. L. DUNCAN; S. L. RAUCH e I. WRIGHT, I.  
7KHDP\JGDODDQGWKHH[SHULHQFHRIDIIHFWSocial Cognitive and Affective
1HXURVFLHQFH
FUSTER, J. M.   (IIHFWV RI VWLPXODWLRQ RI EUDLQ VWHP RQ WDFKLVWRVFRSLF
perception, Science
GAINOTTI, G.; C. CALTAGIRONE y P. ZOCCOLOTTI   /HIWULJKW DQG FRUWLFDO
subcortical dichotomies in the neuropsychological study of human
emotions, Cognition and Emotion, 
GAINOTTI, G.  /DWHUDOL]DWLRQRIEUDLQPHFKDQLVPVXQGHUO\LQJDXWRPDWLF
DQG FRQWUROOHG IRUPV RI VSDWLDO RULHQWLQJ RI DWWHQWLRQ  Neuroscience and
Biobehavioral Reviews  
  1HXURSV\FKRORJ\ RI HPRWLRQV HQ * 'HQHV / *LDQIUDQFR \ FROV
HGV +DQGERRNRI&OLQLFDODQG([SHULPHQWDO1HXURSV\FKRORJ\ SS 
3V\FKRORJ\3UHVVDQG(UOEDXP+RYH,QJODWHUUD
 1HXURSV\FKRORJLFDOWKHRULHVRIHPRWLRQHQ-&%RURG HG The
1HXURSV\FKRORJ\RI(PRWLRQ SS 2[IRUG8QLYHUVLW\3UHVV2[IRUG
HEILMAN, K. M. (  (PRWLRQDO H[SHULHQFH $ QHXURORJLFDO PRGHO HQ
5'/DQH\/1DGHO HGV Cognitive Neuroscience of Emotion SS 
2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
HENRY, J. P. (1986): Neuroendocrine patterns of emotional responses, en:
53OXWFKLN +.HOOHUPDQ (GV (PRWLRQ7KHRU\5HVHDUFKDQG([SHULHQFH
9RO%LRORJLFDO)RXQGDWLRQVRI(PRWLRQ SS $FDGHPLF3UHVV1XHYD
<RUN
HENRY, J. P. y P. M. STEPHENS  6WUHVV+HDOWKDQGWKH6RFLDO(QYLURQPHQW
A Sociobiologic Approach to Medicine6SULQJHU9HUODJ1XHYD<RUN
HIRSCHFIELD L. y S. GELMAN   0DSSLQJ WKH 0LQG 'RPDLQ 6SHFLFLW\ LQ
&RJQLWLRQDQG&XOWXUH Cambridge University Press, Cambridge.
JAMES, W.  :KDWLVDQHPRWLRQ"HQ(*DYLULD WUDGXFW Estudios
de Psicologa
JOHANSEN J. P.; J. W. TARPLEY; J. E. LEDOUX y H. T. BLAIR  1HXUDOVXEVWUDWHV
for expectation-modulated fear learning in the amygdala and periaqueductal
gray,1DWXUH1HXURVFLHQFH   
KLUVER, H. y P. C. BUCY (1937): Psychic blindness and other symptoms
IROORZLQJELODWHUDOWHPSRUDOOREHFWRP\LQUKHVXVPRQNH\VAmerican Journal
RI3K\VLRORJ\
(1939): 3UHOLPLQDU\DQDO\VLVRIWKHWHPSRUDOOREHVLQPRQNH\VArchives of
1HXURORJ\DQG3V\FKLDWU\ 
KOLB, B. y L. TAYLOR (2000): )DFLDO H[SUHVVLRQ HPRWLRQ DQG KHPLVSKHULF
RUJDQL]DWLRQ HQ 5 ' /DQH \ / 1DGHO HGV  Cognitive Neuroscience of
Emotion SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
LACEY, J. I. (1967): Somatic response patterning and stress: Some revisions of
DFWLYDWLRQWKHRU\HQ0+$SSOH\\57UXPEXOO HGV 3V\FKRORJLFDO6WUHVV
,VVXHVLQ5HVHDUFK SS $SSOHWRQ&HQWXU\ &URIWV1XHYD<RUN

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 196 Manual de teoras emocionales y motivacionales - UJI
LACEY, J. I. y B. C. LACEY (1958): 7KHUHODWLRQVKLSRIUHVWLQJDXWRQRPLFDFWLYLW\
to motor impulsivity, 5HV3XEO$VV1HUY0HQW'LV
LANE, R. D. (2000): Neural correlates of conscious emotional experience, en
5'/DQH\/1DGHO HGV Cognitive Neuroscience of Emotion SS 
2[IRUG8QLYHUVLW\3UHV1XHYD<RUN
LANGE, C. G. (1885-1922): The Emotions:LOOLDPVDQG:LONLQV%DOWLPRUH
LINDSLEY, D. B. (1951): (PRWLRQ HQ 6 6 6WHYHQV HG  Handbook of
([SHULPHQWDO3V\FKRORJ\ SS :LOH\1XHYD<RUN
LINDSLEY, D. B.; L. H. SCHREINER; W. B. KNOWLES y H. W. MAGOUN (1950):
Behavioral and EEG changes following chronic brainstem lesions in the
cat, (OHFWURHQFHSKDORJUDSK\DQG&OLQLFDO1HXURSK\VLRORJ\
LEDOUX, J. E. (1996): 7KH (PRWLRQDO %UDLQ WKH 0\VWHULRXV 8QGHUSLQQLQJV RI
Emotional Life6LPRQDQG6FKXVWHU1XHYD<RUN
LEDOUX, J. E. y E. A. PHELPS   (PRWLRQDO QHWZRUNV LQ WKH EUDLQ HQ
0 /HZLV \ - 0 +DYLODQG-RQHV (GV  Handbook of Emotions  (G 
*XLOIRUG1XHYD<RUN
LEDOUX, J. E. (2000 a):&RJQLWLYHHPRWLRQDOLQWHUDFWLRQV/LVWHQWRWKHEUDLQ
HQ5'/DQH\/1DGHO HGV Cognitive Neuroscience of Emotion SS
 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
E (PRWLRQFLUFXLWVLQWKHEUDLQAnnual Review of Neuroscience

MEADOWS, M. E. y R. F. KAPLAN (1994): Dissociation of autonomic and
subjective responses to emotional slides in right hemisphere damaged
patients, 1HXURSV\FKRORJLD
MACLEAN, P. D. (1949): Psychosomatic disease and thHYLVFHUDOEUDLQ5ecent
GHYHORSPHQWV EHDULQJ RQ WKH 3DSH] WKHRU\ RI HPRWLRQ 3V\FKRVRPDWLF
Medicine 
MACLEAN, P. D. (1958): 7KHOLPELFV\VWHPZLWKUHVSHFWWRVHOISUHVHUYDWLRQDQG
preservation of the species, Journal of Nervous and Mental Diseases
(1969): 7KH K\SRWKDODPXV DQG HPRWLRQDO EHKDYLRU HQ : +D\PDNHU
HG 7KH+\SRWKDODPXV7KRPDV6SULQJHOG,OOLQRLV
(1970): 7KHWULXQHEUDLQHPRWLRQDQGVFLHQWLFELDVHQ)6FKPLGW HG The
1HXURVFLHQFHV 6HFRQG 6WXG\ 3URJUDP SS   5RFNHIHOOHU 8QLYHUVLW\
3UHVV1XHYD<RUN
MCDOUGALL, W. (1908/1950): $Q,QWURGXFWLRQWR6RFLDO3V\FKRORJ\HGLFLyQ.
0HWKXHQ/RQGUHV
MOSCA, A.  $5HYLHZ(VVD\RQ$QWRQLR'DPDVLRV7KH)HHOLQJRI:KDW
+DSSHQV%RG\DQG(PRWLRQLQWKH0DNLQJRI&RQVFLRXVQHVV3V\FKH,   
2FWREHU  (Q KWWSSV\FKHFVPRQDVKHGXDXYSV\FKHPRVFD
html.
OLDS, J. y P. MILNER (1954): Positive reinforcement produced by electrical
stimulation of septal area and others regions of rat brain, Journal of
&RPSDUDWLYHDQG3K\VLRORJLFDO3V\FKRORJ\
PALMERO, F. (1996): Aproximacin biolgica al estudio de la emocin, Anales
de Psicologa
   /D HPRFLyQ GHVGH HO PRGHOR ELROyJLFR Revista Electrnica de
0RWLYDFLyQ\(PRFLyQ9,  

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 197 Manual de teoras emocionales y motivacionales - UJI
PANKSEPP, J. (1991): $IIHFWLYH QHXURVFLHQFH$ FRQFHSWXDO IUDPHZRUN IRU WKH
QHXURELRORJLFDO VWXG\ RI HPRWLRQV HQ .7 6WURQJPDQ HG  ,QWHUQDWLRQDO
Review of Studies on Emotion SS -RKQ:LOH\DQG6RQV1XHYD<RUN
PANKSEPP, J. (1998): Affective Neuroscience: The Foundations of Human and
Animal Emotions2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
PAPEZ, J. W. (1937): A proposed mechanism of emotion, $UFKLYHVRI1HXURORJ\
DQG3V\FKLDWU\
PHELPS, E. (2006): (PRWLRQDQG&RJQLWLRQ,QVLJKWVIURP6WXGLHVRIWKH+XPDQ
Amygdala, $QQXDO5HYLHZRI3V\FKRORJ\
PRIBRAM, K. H.  6HOIFRQVFLRXVQHVVDQGLQWHQWLRQDOLW\HQ*(6FKZDUW]
\'6KDSLUR HGV &RQVFLRXVQHVVDQG6HOIUHJXODWLRQ$GYDQFHVLQ5HVHDUFK
YRO SS 3OHQXP3UHVV1XHYD<RUN
  )DPLOLDULW\ DQG QRYHOW\ 7KH FRQWULEXWLRQV RI WKH OLPELF IRUEUDLQ
WR YDOXDWLRQ DQG WKH SURFHVVLQJ RI UHOHYDQFH HQ ' 6 /HYLQH \ 6 - /HYHQ
HGV 0RWLYDWLRQ(PRWLRQDQG*RDO'LUHFWLRQLQ1HXUDO1HWZRUNV SS 
/DZUHQFH(UOEDXP$VVRFLDWHV+LOOVGDOH1XHYD-HUVH\
  1HXUREHKDYLRUDO VFLHQFH QHXURSV\FKRORJ\ DQG WKH SKLORVRSK\
RI PLQG HQ : 2'RQRKXH \ 5 ) .LWFKHQHU HGV  7KH 3KLORVRSK\ RI
3V\FKRORJ\ SS 6DJH3XEOLFDWLRQV,QF7KRXVDQG2DNV&
QUIRS, P. y R. CABESTRERO (2008): 7HRUtDV QHXURVLROyJLFDV GH OD HPRFLyQ
en )XQFLRQHVDFWLYDGRUDVSULQFLSLRVEiVLFRVGHODPRWLYDFLyQ\ODHPRFLyQ
SS (GLWRULDO8QLYHUVLWDULD5DPyQ$UHFHV0DGULG
RAMOS, V.; J. A. PIQUERAS; A. E. MARTNEZ y L. A. OBLITAS  (PRFLyQ\
&RJQLFLyQ ,PSOLFDFLRQHV SDUD HO 7UDWDPLHQWR 7HUDSLD SVLFROyJLFD   

ROSELL, J. y X. REVERT   0RGHORV WHyULFRV HQ HO HVWXGLR FLHQWtFR GH
OD HPRFLyQ HQ 3DOPHUR \ 0DUWtQH]6iQFKH] (G  0RWLYDFLyQ \ (PRFLyQ
SS 0F*UDZ+LOO0DGULG
SNCHEZ-NAVARRO, J. P. y F. ROMN   $PtJGDOD FRUWH]D SUHIURQWDO \
HVSHFLDOL]DFLyQKHPLVIpULFDHQODH[SHULHQFLD\H[SUHVLyQHPRFLRQDOAnales
GH3VLFRORJtD  
SEARLE, J. R.  +RZWRVWXG\FRQVFLRXVQHVVVFLHQWLFDOO\Brain Research
Reviews
WOLFF, W.  7KHH[SHULPHQWDOVWXG\RIIRUPVRIH[SUHVVLRQCharacter
DQG3HUVRQDOLW\

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 198 Manual de teoras emocionales y motivacionales - UJI
7HRUtDVFRQGXFWXDOHVHQHPRFLyQ
,QWURGXFFLyQ
(QHVWHDSDUWDGRGHVFULELUHPRVSRUXQDSDUWHODVDSRUWDFLRQHVUHDOL]DGDVVREUHHO
SURFHVRHPRFLRQDOGHVGHHOFDPSRGHODSUHQGL]DMH\SRURWUDODVFRQWULEXFLRQHV
WHyULFDVLQXLGDVSRUHOSODQWHDPLHQWRHYROXFLRQLVWDFX\RLQWHUpVVHFHQWUDHQOD
dimensin expresiva-motora-conductual de la emocin.

/DRULHQWDFLyQFRQGXFWXDOVHLQWHUHVDSRUODVOH\HVGHDSUHQGL]DMHGHODFRQGXFWD
emocional, entendiendo por conducta emocional un conjunto de respuestas ob-
VHUYDEOHVRDELHUWDV\VLROyJLFDVTXHVHSXHGHQFRQGLFLRQDUFRPRFXDOTXLHURWUD
conducta del organismo. Se excluye los componentes cognitivos y subjetivos de
ODHPRFLyQTXHVHUiQDERUGDGRVGHVGHRWURWLSRGHSODQWHDPLHQWRVWHyULFRV SRU
HMHOFRJQLWLYLVPR 

(QHOFDPSRGHODSUHQGL]DMHORVDVSHFWRVDIHFWLYRVPiVLQYHVWLJDGRVVRQHOPLHGR
ODDQVLHGDG\ODVIRELDV )HUQiQGH]$EDVFDO3DOPHUR&KyOL]0DUWtQH]6iQFKH]
 6XHVWXGLRVHKDUHDOL]DGRXWLOL]DQGRFRPRSDUWLFLSDQWHVVXMHWRVH[SHUL-
PHQWDOHVORVDQLPDOHV SHMUDWDVSHUURV 

'HVGH HO DSUHQGL]DMH REVHUYDFLRQDO OD HPRFLyQ SXHGH DGTXLULUVH D WUDYpV GH OD
observacin de los otros que funcionan como modelos a seguir; es decir, no es ne-
cesaria la experiencia directa del sujeto para adquirir una fobia o miedo particular.
(VWHWLSRSDUWLFXODUGHDSUHQGL]DMH\HODSUHQGL]DMHYLFDULRWDPELpQVHLQFOX\HQHQ
las teoras cognitivas de la emocin.

Destacamos que, en el mismo sentido que el estudio de la motivacin, en el siglo XXI el


HVWXGLRFLHQWtFRGHODHPRFLyQVHUHDOL]DGHVGHWUHVSHUVSHFWLYDVELROyJLFDFRQ-
GXFWXDO\FRJQLWLYD 3DOPHUR&DUSL*yPH]xLJXH]*XHUUHUR\0XxR]
3DOPHUR*yPH]xLJXH]&DUSL*XHUUHUR\'tH] 

$SRUWDFLRQHVEDVDGDVHQHODSUHQGL]DMH
$ FRQWLQXDFLyQ GHVFULELUHPRV ODV SULQFLSDOHV DSRUWDFLRQHV UHDOL]DGDV GHVGH HO
FDPSR GHO DSUHQGL]DMH FRQGLFLRQDPLHQWR FOiVLFR FRQGLFLRQDPLHQWR RSHUDQWH \
condicionamiento instrumental.

A lo largo de la exposicin del presente captulo prescindiremos de la explicacin


GHORVWpUPLQRVFDUDFWHUtVWLFRVGHODVWHRUtDVGHODSUHQGL]DMHSRUKDEHUVLGRGHVFUL-
WRVHQHOFDStWXORGHODPRWLYDFLyQDOTXHHOOHFWRUSRGUiFRQVXOWDUSDUDUHVROYHU
cualquier duda conceptual.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 199 Manual de teoras emocionales y motivacionales - UJI
&RQWULEXFLRQHVGHVGHHOFRQGLFLRQDPLHQWRFOiVLFR
En la segunda dcada del siglo XX:DWVRQHVFRQVLGHUDGRFRPRXQRGHORVDXWR-
res precursores en formular una teora conductista de la emocin. A continuacin
H[SRQHPRVODGHQLFLyQGHHPRFLyQSDUDHODXWRU :DWVRQ 

Una emocin es un patrn de reaccin hereditario que implica profundos cambios en todo el
mecanismo corporal, especialmente en los sistemas viscerales y glandulares. Por patrn de
reaccin queremos decir que los detalles separados de la respuesta aparecen con alguna cons-
WDQFLDFRQDOJXQDUHJXODULGDG\DSUR[LPDGDPHQWHHQHOPLVPRRUGHQVHFXHQFLDOFDGDYH]TXH
se presenta el estmulo excitatorio.

7DPELpQGHQHODHPRFLyQFRPRXQDUHVSXHVWDFRUSRUDOFRQFRQQRWDFLRQHVGHV-
RUJDQL]DGRUDV :DWVRQ 

>@ OD HPRFLyQ HV XQ SDWUyQ KHUHGDGR GH UHVSXHVWD TXH LPSOLFD SURIXQGRV FDPELRV GH ORV
mecanismos corporales como un conjunto, pero particularmente de los sistemas glandulares y
viscerales.

Por tanto, la emocin es una reaccin corporal a un estmulo concreto, en la


FXDOODH[SHULHQFLDFRQVFLHQWHQRHVUHOHYDQWH,GHQWLFDODVUHVSXHVWDVYLVFH-
rales con las emociones.

7UDVHOWUDEDMRUHDOL]DGRFRQQLxRV :DWVRQ\0RUJDQ VHSURSRQHODH[LV-


tencia de tres emociones innatas, destacando las manifestaciones conductuales
asociadas: el miedo que es la consecuencia de la retirada repentina del apoyo, un
ruido intenso o la aparicin sbita de un estmulo en los momentos de transicin
del sueo-vigilia o viceversa; el amor que es la consecuencia de la manipula-
FLyQGHOHVWyPDJR\GHODV]RQDVHUyJHQDVGHOFXHUSR\ODFyOHUDLUDTXHHVOD
consecuencia de la accin de impedir el movimiento libre.

Describe el patrn de respuesta hereditario de cada emocin:

 0LHGRODFRQWHQFLyQGHODUHVSLUDFLyQFHUUDUORVRMRVIUXQFLUORVODELRV\DSUH-
tar los puos. Se produce como respuesta innata a la presencia de ruidos inten-
sos, sbitos y a la falta repentina de apoyo.
Ira: gritar, agitacin, contraccin muscular, golpear con las extremidades supe-
riores e inferiores. Se produce ante la limitacin del movimiento.
 $PRUVRQUHtUHPLVLyQGHDUUXOORV\DEUD]RV(VODUHVSXHVWDDODVFDULFLDV

8QDGHODVFRQWULEXFLRQHVPiVLPSRUWDQWHVHVHOH[SHULPHQWRUHDOL]DGRMXQWRFRQ
5D\QHU :DWVRQ\5D\QHU TXHPXHVWUDTXHODVHPRFLRQHV HOPLHGRHQ
HVWHFDVR SXHGHQDSUHQGHUVHDOLJXDOTXHRWURWLSRGHUHVSXHVWDPHGLDQWHHOSUR-
FHGLPLHQWRGHOFRQGLFLRQDPLHQWRFOiVLFR :DWVRQ 

En un primer momento tenamos cierta resistencia hacia esos experimentos, pero era tal la
QHFHVLGDGGHHVWHWLSRGHHVWXGLRVTXHQDOPHQWHGHFLGLPRVH[SHULPHQWDUODSRVLELOLGDGGH
IDEULFDUPLHGRHQORVQLxRV\HVWXGLDUOXHJRORVPpWRGRVSUiFWLFRVGHHOLPLQDUORV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 200 Manual de teoras emocionales y motivacionales - UJI
(OREMHWLYRGHOH[SHULPHQWRGH:DWVRQ\5D\QHUFRQVLVWtDHQGHPRVWUDUTXHODHPR-
cin de miedo poda aprenderse ante estmulos que, en principio, no tenan la pro-
piedad de elicitarla. Para ello, el sujeto experimental fue un beb de once meses de
HGDGFRQRFLGRFRPRHOSHTXHxR$OEHUW$GHPiVVHPRVWUyODJHQHUDOL]DFLyQGHOD
respuesta de miedo a otros estmulos similares y su eliminacin mediante el con-
tracondicionamiento.

6LJXLHQGRHOSURFHGLPLHQWRGHOFRQGLFLRQDPLHQWRFOiVLFRXWLOL]DURQHOVRQLGRLQ-
WHQVR FRPR HVWtPXOR LQFRQGLFLRQDGR EI  TXH HOLFLWDED GH IRUPD QDWXUDO OD UHV-
SXHVWDLQFRQGLFLRQDGDGHOORUR\UHWLUDGDGHODPDQR RI UHVSXHVWDHPRFLRQDOGH
PLHGR(OHVWtPXORQHXWUR EN HPSDUHMDGRFRQHOEIHUDXQDUDWDEODQFD7UDVVX-
cesivos ensayos de emparejamiento, la presentacin aislada del EC, la rata blanca,
HOLFLWDEDODUHVSXHVWDFRQGLFLRQDGDGHPLHGR RC RSHUDWLYL]DGDPHGLDQWHHOOODQWR
y retirada de la mano del beb.

$GHPiV VH SURGXMR HO IHQyPHQR GH JHQHUDOL]DFLyQ GH OD UHVSXHVWD GH PLHGR D
otros estmulos similares al EC, por ejemplo, los peluches. Es decir, ante la presen-
FLDGHREMHWRVSDUHFLGRVDODUDWDEODQFD SHOREODQFR HOEHEpOORUDED

8QD YH] DGTXLULGD OD UHVSXHVWD FRQGLFLRQDGD GH PLHGR WDPELpQ VH GHEtD FRP-
SUREDUTXHHVWDVHSRGtDHOLPLQDUVHPHGLDQWHHOSURFHVRGHH[WLQFLyQ SUHVHQWD-
cin reiterada del EC  \ HO FRQWUDFRQGLFLRQDPLHQWR SURFHGLPLHQWR HQ HO TXH VH
presentaba otros estmulos diferentes junto con el EC'LFKRVHVWtPXORV SRUHM
FDUDPHORVFKRFRODWH FDUDFWHUL]DGRVSRUODHOLFLWDFLyQGHXQDUHVSXHVWDGLIHUHQWH
DODUHVSXHVWDGHPLHGR DOHJUtD 

EI RI
UXLGRLQWHQVR  OORUR

EI y EN RI
UXLGRLQWHQVR OORUR
\UDWDEODQFD

EC RC
UDWDEODQFD  OORUR

)LJXUD(VTXHPDGHDSOLFDFLyQGHOFRQGLFLRQDPLHQWRFOiVLFRDODHPRFLyQGHPLHGR

Esta parte de la investigacin no pudo concluirse debido al traslado del pequeo


Albert.

/D DSRUWDFLyQ UHOHYDQWH IXH OD IRUPXODFLyQ GHO FRQGLFLRQDPLHQWR FOiVLFR GH OD
conducta emocional aplicado al ser humano. No obstante, como contrapartida, se
FXHVWLRQyHOFXPSOLPLHQWRGHOFDUiFWHUpWLFRHQGLFKDLQYHVWLJDFLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 201 Manual de teoras emocionales y motivacionales - UJI
&RQWULEXFLRQHVGHVGHHOFRQGLFLRQDPLHQWRRSHUDQWH
3RURWUDSDUWHGHVGHHOFRQGLFLRQDPLHQWRRSHUDQWH6NLQQHUFRQVLGHUDODHPRFLyQ
FRPRXQDFRQGXFWDTXHDFRQWHFHDQWHODLQXHQFLDGHODPELHQWH1RVHQFRQWUD-
mos con dos hechos: la conducta emotiva y las circunstancias manipulables de
las que la conducta es funcin, que engloban el adecuado objeto de estudio de la
emocin. Por tanto, la emocin no es la causa de la conducta. Se produce tras las
consecuencias de la respuesta.

/DVFRQVHFXHQFLDVKDFHQUHIHUHQFLDDORVUHIRU]DGRUHVFRQWLQJHQWHVDODUHVSXHVWD
operante.

/D HPRFLyQ SXHGH FRQVLGHUDUVH FRPR SUHGLVSRVLFLRQHV SDUD FRPSRUWDVH GH XQ
PRGRFRQFUHWR 6NLQQHU 

&XDQGRHOKRPEUHGHODFDOOHGLFHTXHDOJXLHQWLHQHPLHGRHVWiHQIDGDGRRHQDPRUDGRKDEOD
en general de predisposiciones a actuar de manera enamorado, habla en general de predisposi-
ciones a actuar de maneras determinadas. El sujeto iracundo muestra una probabilidad incre-
PHQWDGDGHSHJDULQVXOWDURLQLJLURWUDFODVHGHLQMXULDV\XQDSUREDELOLGDGGLVPLQXLGDGH
ayudar, favorecer, confortar o hacer el amor.

Es decir, una persona enamorada muestra una tendencia incrementada a ayudar,


favorecer, acompaar, acariciar, y una tendencia disminuida a herir, de cualquier
forma que sea. Alguien que tiene miedo tiende a reducir o a evitar el contacto con
HVWtPXORVHVSHFtFRVKX\HQGRHVFRQGLpQGRVHRWDSiQGRVHORVRMRV\ORVRtGRV
al mismo tiempo es menos probable que avance hacia un terreno desconocido.
(VWRVVRQKHFKRV~WLOHVTXHSHUPLWHQXQDQiOLVLVFLHQWtFR

3RUWDQWRODVHWLTXHWDVGHHPRFLRQHVVLUYHQSDUDFODVLFDUODFRQGXFWDFRQUHV-
SHFWRDGLYHUVDVFLUFXQVWDQFLDVTXHDIHFWDQVXSUREDELOLGDG/RPiVDGHFXDGRHV
PDQWHQHUODIRUPDDGMHWLYD 6NLQQHU 

'HODPLVPDIRUPDTXHHORUJDQLVPRKDPEULHQWRSXHGHVHUGHVFULWRVLQGHPDVLDGDGLFXOWDG
PLHQWUDV TXH OD GHQLFLyQ GH KDPEUH SUHVHQWD PXFKRV SUREOHPDV DO GHVFULELU OD FRQGXFWD
FRPRWHPHURVDDIHFWXRVDWtPLGDHWFQRQRVYHPRVREOLJDGRVDGHQLUXQDVFRVDVOODPDGDV
emociones.

/DVH[SUHVLRQHVFRPXQHVGHHQDPRUDGRPLHGRVRHLUDFXQGRVXJLHUHQXQDGHQL-
cin de emocin como un estado conceptual en el que una respuesta determinada
se da en funcin de las circunstancias de la historia del individuo.

'LIHUHQFLDGRVWLSRVGHUHVSXHVWDVHPRFLRQDOHVUHHMRVVLPSOHV LQQDWRVRDSUHQ-
GLGRV \RSHUDQWHV FRQGXFWDVFRPSOHMDVDSUHQGLGDV 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 202 Manual de teoras emocionales y motivacionales - UJI
$SRUWDFLRQHVGHVGHDPERVWLSRVGHFRQGLFLRQDPLHQWR
7HRUtDGHORVGRVIDFWRUHV

0RZUHU  SURSRQHHOPRGHORGHORVGRVIDFWRUHVRHVWDGLRVRSURFHVRVSDUD


H[SOLFDUFyPRVHDGTXLHUHQODVIRELDV(QGHQLWLYDHODSUHQGL]DMHSRUHYLWDFLyQ
VHKDOODLPSOtFLWRHQDPERVSURFHVRV /HYLV\%UHZHU0DLD 

(QHOSULPHUHVWDGLRPHGLDQWHFRQGLFLRQDPLHQWRFOiVLFRXQHVWtPXORQHXWUR EN VH
DVRFLDDXQHVWtPXORLQFRQGLFLRQDGR EI SURGXFLpQGRVHODUHVSXHVWDHPRFLRQDOFRQGL-
FLRQDGDGHPLHGR RC 8QDYH]DFDEDGDODSUHVHQFLDGHOEC, la respuesta condicionada
GHPLHGRGLVPLQXLUiSRUORTXHSXHGHFRQVLGHUDUVHXQDIXHQWHGHUHIRU]DPLHQWRQH-
gativo. En este caso, se produce la respuesta de escape del miedo condicionado,
pues el sujeto ha estado en contacto con el EC aversivo.

En el segundo estadio, el ECDFW~DFRPRXQHVWtPXORGLVFULPLQDQWH ED GHODUHV-


puesta de evitacin, que acabara con la RC de miedo, al mismo tiempo que refor-
]DUtDODFRQGXFWDGHHVFDSHRHYLWDFLyQ(VGHFLUODUHVSXHVWDHVUHIRU]DGDSRUOD
UHGXFFLyQGHOPLHGRPiVTXHSRUODDXVHQFLDGHXQHVWtPXORDYHUVLYR

Una de las principales aplicaciones de esta teora es su aplicacin al estudio de la


DQVLHGDG%RUNRYHF  \+DPPRQG  SURSRQHQDGLFLRQDOPHQWH
el factor de la evitacin cognitiva y la percepcin autonmica para explicar la an-
siedad. El primer factor modula el mantenimiento de la ansiedad y el segundo el
mantenimiento y la reduccin de la ansiedad.

$SDUWLUGHODFRQWULEXFLyQGH0RZUHUVXUJLHURQRWUDVWHRUtDVTXHSURSRUFLRQDQ
H[SOLFDFLRQHV DOWHUQDWLYDV D OD FRQGXFWD GH HYLWDFLyQ YHU 4XLUyV \ &DEHVWUHUR
  3RU HMHPSOR OD teora unifactorial 6FKRHQIHOG \ +HUUQVWHLQ DxRV 
\ SURFHGLPLHQWRGHDSOLFDFLyQGHOUHIRU]DPLHQWRSRVLWLYRGHODHYLWDFLyQ
a travs de la inhibicin condicionada del miedo o las seales condicionadas de
VHJXULGDG 5HVFRUOD'LQVPRRU SURFHGLPLHQWRGHUHIRU]DPLHQWRGHOD
HYLWDFLyQ D WUDYpV GH OD UHGXFFLyQ GH OD IUHFXHQFLD GH GHVFDUJD 6LGPDQ 
'LQVPRRU ODteora de la conducta de evitacin de las reacciones de de-
IHQVDHVSHFtFDVGHODHVSHFLH %ROOHV'RPMDQ \ODhiptesis de la
inminencia depredadora )DQVHORZ\/HVWHU)DQVHORZ 

$ FRQWLQXDFLyQ GHVWDFDPRV DOJXQDV FRQVLGHUDFLRQHV UHDOL]DGDV VREUH HO PRGHOR


conductual:

a  (Q HO FRQWH[WR GH ODERUDWRULR VH PDQLSXODQ ODV FRQGLFLRQHV QHFHVDULDV SDUD
condicionar una respuesta emocional; sin embargo, en los distintos contextos
situacionales de la vida cotidiana es difcil y, aun as, se adquieren miedos a
HVWtPXORVHVSHFtFRV IRELDV 

b /RVHVWtPXORVGHHOHYDGDLQWHQVLGDGQRVLHPSUHSURGXFHQXQFRQGLFLRQDPLHQWR
HPRFLRQDO3RUHMHPSORHOVRQLGRGHORVSHWDUGRVHQODVHVWDV SHMODV)D-
OODVOD0DJGDOHQD 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 203 Manual de teoras emocionales y motivacionales - UJI
c  1RWRGRVORVHVWtPXORVWLHQHQHOPLVPRSRWHQFLDOSDUDVHUFRQGLFLRQDGRV

d 1RVLHPSUHHVSRVLEOHFRQVHJXLUODH[WLQFLyQGHXQDUHVSXHVWDFRQGLFLRQDGD

,QGHIHQVLyQDSUHQGLGDRGHVDPSDURDSUHQGLGR

El desamparo aprendido hace referencia a un estado de desmotivacin. Conse-


cuencia de una serie de estudios pioneros sobre la interaccin entre ambos tipos
GHFRQGLFLRQDPLHQWRHOFRQGLFLRQDPLHQWRFOiVLFR\HOFRQGLFLRQDPLHQWRRSHUDQWH
0DLHU  2YHUPLHU  2YHUPLHU \ 6HOLJPDQ  6HOLJPDQ \ 0DLHU
:HLVV.ULHFNKDXV\&RQWH 

6HOLJPDQ  VHLQWHUHVyHQLQYHVWLJDUTXpFLUFXQVWDQFLDVSDUWLFXODUHVGHO


DSUHQGL]DMHFRQOOHYDDXQDVLWXDFLyQGHLQGHIHQVLyQ HQ3XHQWH (QHOFRQWH[-
WRGHODERUDWRULRUHDOL]yXQH[SHULPHQWRVREUHPLHGR\DSUHQGL]DMHTXHFRQVLVWtDHQ
provocar descargas elctricas dolorosas a perros enjaulados, que no podan esca-
par de las jaulas. En otro experimento, los perros se introducan en una jaula con
GRVFRPSDUWLPHQWRVVHSDUDGRVSRUXQDSHTXHxDEDUUHUD(QXQDGHODVFiPDUDVORV
perros sufran descargas elctricas y en la otra no. Cuando los perros situados en
ODFiPDUDFRQSRVLELOLGDGGHGHVFDUJDVUHFLEtDQWDOHVGHVFDUJDVHOpFWULFDVFRUUtDQ
hasta que, por ensayo y error, saltaban la barrera y conseguan escapar de dichas
GHVFDUJDV8QDYH]DSUHQGLGDODUHVSXHVWDGHHVFDSHHQXQDSUy[LPDRFDVLyQORV
perros no esperaban a que les suministraran descargas, sino que saltaban inmedia-
WDPHQWHDODFiPDUDVHJXUDVLQGHVFDUJDV UHVSXHVWDGHHYLWDFLyQ 

(QODVHJXQGDSDUWHGHOH[SHULPHQWRVHXWLOL]yDORVSHUURVVLQH[SHULHQFLD\FRQ
experiencia de descargas inevitables. Se comprob que el comportamiento de estos
fue diferente. El grupo de perros sin experiencia, ante el suministro de descargas
elctricas, corran, saltaban, hasta que conseguan saltar la barrera y situarse en la
FiPDUDVHJXUD3RUHOFRQWUDULRHQORVSHUURVFRQH[SHULHQFLDGHGHVFDUJDVLQHYL-
tables, se observ una ausencia de cualquier accin para evitar dichas descargas.
(OFRPSRUWDPLHQWRTXHGDEDOLPLWDGRDDLVODUVHHQXQDHVTXLQDGHODFiPDUD\D
HPLWLUDXOOLGRVGHGRORU7UDVYDULRVHQVD\RVWDUGDURQEDVWDQWHWLHPSRHQDSUHQGHU
DVDOWDUODEDUUHUD\SDVDUDODFiPDUDVHJXUDFRPHWLHURQPiVHUURUHV\PRVWUDURQ
respuestas emocionales negativas.

3HWUL\*RYHUQ  GHVFULEHQORVVtQWRPDVGHOGHVDPSDURDSUHQGLGRSDVLYLGDG


GHFLHQFLDPRWLYDFLRQDO UHWUDVRGHODSUHQGL]DMHHIHFWRVVRPiWLFRV\GLVPLQX-
cin del desamparo con el tiempo.

 3DVLYLGDG GHFLHQFLDPRWLYDFLRQDO ORVDQLPDOHVTXHKDQH[SHULPHQWDGROD


IDOWDGHFRQWUROHQVLWXDFLRQHVSUHYLDVPXHVWUDQXQDHVSHFLHGHKROJD]DQHUtD
aprendida o pasividad en situaciones en las que s tienen el control.

 5HWUDVRGHODSUHQGL]DMHHODSUHQGL]DMHGHTXHODVFRQVHFXHQFLDVGHXQDVLWXD-
cin no pueden cambiarse mediante la conducta, produce como consecuencia
un tardo reconocimiento del posible control en situaciones similares.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 204 Manual de teoras emocionales y motivacionales - UJI
 (IHFWRVVRPiWLFRVORVDQLPDOHVFRQH[SHULHQFLDGHGHVDPSDURDSUHQGLGRPRV-
traron respuestas menos agresivas en situaciones competitivas o aversivas que
los animales sin experiencia de incontrolabilidad.

Disminucin del desamparo con el tiempo: la indefensin parece desaparecer


con el paso del tiempo

Esta investigacin evidencia una situacin de indefensin en el que el sujeto ex-


SHULPHQWDO ORV SHUURV  DSUHQGH D TXH VXV UHVSXHVWDV QR FRQWURODQ HO DPELHQWH
Aprende que ha perdido el control. Se trata de una situacin en la que creen que no
pueden hacer nada para cambiar la situacin, y falta la motivacin para iniciar una
accin que les permita conseguir una meta particular.

(QGHQLWLYDHOGHVDPSDURDSUHQGLGRVHFDUDFWHUL]DSRUXQGpFLWPRWLYDFLRQDO\
FRJQLWLYRFRQFRQQRWDFLRQHVHPRFLRQDOHVGHPLHGRWULVWH]DGHSUHVLyQTXHGL-
FXOWDQUHVROYHUFRQp[LWRODVLWXDFLyQSUREOHPD6XDSOLFDFLyQHQODVVLWXDFLRQHV
de maltrato permite describir, explicar y comprender las conductas de resignacin
y silencio por parte de las vctimas que lo sufren.

/DFRQWULEXFLyQGH6HOLJPDQPXHVWUDTXHODPRWLYDFLyQDFWXDOGHSHQGHGHODH[-
SHULHQFLDHQHOFRQWUROGHODPELHQWH/DH[SHULHQFLDGHIUDFDVRSURGXFHGHVPRWL-
vacin de acciones futuras que, en situaciones extremas conduciran a la ausencia
de reaccin.

Si bien es cierta que la aportacin de Seligman fue investigada en el contexto


de laboratorio y con animales, dicho fenmeno es similar a los sntomas de la
depresin reactiva en humanos. Esta extrapolacin ha sido criticada, ya que su
modelo no predice la prdida de autoestima caracterstica en la depresin. Como
consecuencia, Seligman y sus colaboradores reformularon su teora en trminos
FRJQLWLYRV $EUDPVRQ6HOLJPDQ\7HDVGDOH DUJXPHQWDQGRTXHODDWULEX-
cin de las causas en la falta de control es un factor modulador de la indefensin
aprendida.

&RQWULEXFLyQGHVGHHODSUHQGL]DMHREVHUYDFLRQDO
%DQGXUD  GHHQGHTXHODHPRFLyQSXHGHDSUHQGHUVHPHGLDQWHODREVHUYD-
cin o el modelamiento de los signos faciales, gestuales y posturales indicadores
de la activacin emocional de otros sujetos, sin necesidad de recurrir al ensayo y
error. En futuras ocasiones, ante eventos similares, tenderemos a reaccionar emo-
cionalmente de forma similar a las conductas emocionales observadas.

%DQGXUD5RVV\5RVV  UHDOL]DURQXQH[SHULPHQWRHQHOTXHXQRVQLxRVGH


edad preescolar observaban cmo unos modelos interaccionaban de forma agresi-
va con un mueco, mientras que otros modelos se sentaban y actuaban tranquila-
PHQWHDOODGRGHOPXxHFR/RVUHVXOWDGRVPRVWUDURQTXHORVQLxRVTXHREVHUYDURQ
el comportamiento del primer tipo de modelos, cuando se les dej interaccionar

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 205 Manual de teoras emocionales y motivacionales - UJI
con el mueco, lo hicieron de forma agresiva; es decir, imitaron la conducta agre-
siva observada. Por otra parte, los nios que observaron la conducta del segundo
tipo de modelos, permanecieron tranquilos al lado del mueco.

/DFRQFOXVLyQGHODLQYHVWLJDFLyQHVTXHODHPRFLyQSXHGHDSUHQGHUVHPHGLDQWH
ODREVHUYDFLyQGHRWURV PRGHORV /DUHOHYDQFLDGHHVWDDSRUWDFLyQWLHQHLPSOLFD-
FLRQHVHQORVGLVWLQWRVFRPSRUWDPLHQWRVTXHUHDOL]DQORVDGXOWRV\TXHVRQREVHU-
vados por los nios. Por ejemplo: los padres funcionan como modelos a seguir por
parte de sus hijos; los hermanos mayores son modelos a imitar por sus hermanos
pequeos; los personajes de los dibujos y de las pelculas emitidas por la televisin
tambin pueden funcionar como modelos potenciales a seguir.

3RURWUDSDUWH%DQGXUD  FRQVLGHUDTXHHQPXFKDVRFDVLRQHVODVIRELDVVH


adquieren no por exposicin o vivencia directa, sino mediante la observacin de
XQPRGHORTXHH[SHULPHQWDPLHGRDQWHXQREMHWRRFLUFXQVWDQFLDSDUWLFXODU HQ
3HWUL\*RYHUQ 8QDVSHFWRLPSRUWDQWHHVTXHSRVLELOLWDHODSUHQGL]DMHGH
XQDFRQGXFWDVLQQHFHVLGDGGHSUDFWLFDUXQDUHVSXHVWD\VLQUHIRU]DPLHQWR

Debemos tener en cuenta que es posible la adquisicin y la eliminacin del miedo


mediante la observacin de un modelo.

2WUDVFRQWULEXFLRQHV
(OSODQWHDPLHQWRGH6SHQFH\7D\ORU

$SDUWLUGHVXVDSRUWDFLRQHVHQHOFDPSRGHODPRWLYDFLyQ6SHQFH  
propone dos categoras: aproximacin y evitacin, con connotaciones apetitivas
la primera, y de aversin la segunda. Considera que el impulso responsable de
activar la conducta se produce a consecuencia de una respuesta emocional interna.

7D\ORU  HODERUyXQLQYHQWDULRSDUDPHGLUODUHVSRQVLYLGDGHPRFLR-


QDOHQSDUWLFXODUVREUHODDQVLHGDGOD(VFDODGH$QVLHGDG0DQLHVWD(ODXWRU
considera que un alto nivel de ansiedad se relaciona con una mayor cantidad
GH UHVSXHVWDV FOiVLFDPHQWH FRQGLFLRQDGDV (Q SDUWLFXODU OD DQVLHGDG SXHGH WH-
ner efectos activadores positivos o negativos, dependiendo de la probabilidad
de aparicin de la respuesta apropiada. Si esta probabilidad es elevada, podemos
DUPDUTXHORVHIHFWRVGHODDQVLHGDGIDFLOLWDQGLFKDUHVSXHVWDSRUHOFRQWUDULR
VLODSUREDELOLGDGHVEDMDORVHIHFWRVGHODDQVLHGDGGLFXOWDQODHMHFXFLyQGHOD
respuesta apropiada.

(OSODQWHDPLHQWRGH<RXQJ

El autor propone la existencia de procesos afectivos y de un continuo hednico


<RXQJ /RVSURFHVRVDIHFWLYRVVHFDUDFWHUL]DQSRUHOVLJQRODLQWHQVLGDG\
la duracin, destacando su funcin motivacional.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 206 Manual de teoras emocionales y motivacionales - UJI
(QSDUWLFXODU<RXQJQRKDEODGHHPRFLRQHV\HQVXOXJDUXWLOL]DORVWpUPLQRVGH
DJUDGDEOH\QRDJUDGDEOH3URSRQHTXHORVSURFHVRVDIHFWLYRVVHGHVSOD]DQDOR
largo de un continuo hednico y que estos acompaan a cualquier conducta.

El planteamiento de Bindra

%LQGUD  QRGLIHUHQFLDHQWUHORVWpUPLQRVPRWLYDFLyQ\HPRFLyQ3UR-


SRQHXQVLVWHPDPRWLYDFLRQDOFHQWUDOTXHHQJOREDDDPERVSURFHVRV6HUHHUHD
estos como acciones tpicas biolgicamente tiles para la especie. Estas acciones
son consecuencia de la interaccin entre los estmulos del ambiente, los incentivos
\ORVFDPELRVVLROyJLFRV(OUHVXOWDGRHVHOHVWDGRPRWLYDFLRQDOFHQWUDOTXHGHV-
HQFDGHQDUiODDFFLyQ

/DHPRFLyQWLHQHFRQQRWDFLRQHVGHFRQGLFLyQVLROyJLFD\QRGHSUHGLVSRVLFLyQ
emocional. Destacamos que, la conducta emocional puede tener efectos organi-
]DGRUHVRGHVRUJDQL]DGRUHVGHSHQGLHQGRGHODLQXHQFLDGHODPELHQWHGXUDQWHHO
desarrollo ontogentico del sujeto.

$SRUWDFLRQHVEDVDGDVHQGLPHQVLyQH[SUHVLYD
motora-conductual de la emocin
/RVVLJXLHQWHVSODQWHDPLHQWRVPXHVWUDQODLQXHQFLDGHOQHRGDUZLQLVPR$VXPHQ
ODSUHPLVDGHODFRQWLQXLGDGORJHQpWLFDHQWUHODVHVSHFLHVSDUDGHIHQGHUODVLPL-
OLWXGGHODGLPHQVLyQH[SUHVLYDGHODVHPRFLRQHVEiVLFDVHQWUHHOVHUKXPDQR\
otras especies animales.

En trminos generales, se asume que la expresin facial de las emociones ha evo-


OXFLRQDGRPHGLDQWHODVHOHFFLyQQDWXUDOFDUDFWHUL]DGDSRUVXIXQFLyQDGDSWDWLYD
de supervivencia de la especie y del individuo que, posteriormente, sigue mante-
nindola pero en trminos de facilitacin de la comunicacin entre los individuos
de una misma especie.

$GHPiVVHOHVSUHVXSRQHXQVXVWUDWRQHXURDQDWyPLFRHVSHFtFR FDUiFWHULQQD-
WR SDUDFDGDHPRFLyQEiVLFDFRQXQSDWUyQGHDFWLYDFLyQVLROyJLFDSDUWLFXODU
un patrn de expresin facial concreto y una experiencia subjetiva o sentimiento
propio.

/DH[SUHVLyQIDFLDOGHODVHPRFLRQHVVHDSOLFDDODVGHQRPLQDGDVHPRFLRQHVEiVL-
FDV$OJXQRVDXWRUHVFRPR7RPNLQV,]DUG\(NPDQPDQWLHQHQTXHHVWDVVRQXQ
SURGXFWRGHODHYROXFLyQORJHQpWLFD\RQWRJHQpWLFDGHODVHVSHFLHV

$XQTXHSRGHPRVKDOODUGLIHUHQWHVFODVLFDFLRQHVVREUHWLSRVGHHPRFLRQHVEiVL-
FDVSDUHFHH[LVWLUXQFRQVHQVRHQFRQVLGHUDUODVHPRFLRQHVGHDOHJUtDLUDWULVWH]D

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 207 Manual de teoras emocionales y motivacionales - UJI
PLHGR\DVFRFRPRHPRFLRQHVEiVLFDV (NPDQ $FDGDHPRFLyQEiVLFDOH
corresponde una serie de movimientos musculares faciales que son los mismos
SDUDORVLQGLYLGXRVGHODPLVPDHVSHFLHLQGHSHQGLHQWHPHQWHGHODFXOWXUDRUD]D
3UHVHQWDQSRUWDQWRXQFDUiFWHUXQLYHUVDO

(QOtQHDVJHQHUDOHVODVLQYHVWLJDFLRQHVUHDOL]DGDVFRQSULPDWHVQRKXPDQRVEH-
bs, nios nacidos ciegos y sordo-ciegos y los estudios transculturales, corroboran
HOFDUiFWHUXQLYHUVDOGHODH[SUHVLyQIDFLDOGHODVHPRFLRQHV1RREVWDQWHORVKD-
OOD]JRVHQORVHVWXGLRVFRQQLxRVFLHJRVQRVRQVLVWHPiWLFDVVLHQGRQHFHVDULDVX
LQYHVWLJDFLyQSRVWHULRU )UDLEHUJ 

8QLQGLYLGXRHVFDSD]GHH[SUHVDU\UHFRQRFHUXQDPLVPDH[SUHVLyQIDFLDOFRPR
SHUWHQHFLHQWHDXQDHPRFLyQEiVLFDSDUWLFXODU

$FRQWLQXDFLyQH[SRQGUHPRVORVSODQWHDPLHQWRVWHyULFRVGHORVDXWRUHVPiVUHOH-
vantes.

El planteamiento de Plutchik

3OXWFKLN  PDQWLHQHHOFDUiFWHUPXOWLGLPHQVLRQDOGHODHPRFLyQ LQWHQVLGDG


VLPLOLWXG\SRODULGDG 3DUDHODXWRUODHPRFLyQLPSOLFDXQDDGDSWDFLyQSURWRWtSLFD
y una cierta cognicin, siendo el procesamiento cognitivo anterior a la experiencia
HPRFLRQDO(VWDEOHFHXQDWD[RQRPtDGHHPRFLRQHVEiVLFDVPLHGRWULVWH]DLUD
DFHSWDFLyQDVFRH[SHFWDFLyQVRUSUHVD\DOHJUtD(VWDVSXHGHQFODVLFDUVHHQODV
GLPHQVLRQHVGHVLPLOLWXG\SRODULGDG/DGLPHQVLyQLQWHQVLGDGVHDSOLFDDORVHVWD-
dos emocionales que experimentamos, que poseen una mayor complejidad que las
HPRFLRQHVEiVLFDV/DFRPELQDFLyQGHHVWDVHPRFLRQHVGDOXJDUDODVHPRFLRQHV
mixtas.

Su postura ultraconservadora considera a las emociones como vestigios ancestra-


les de conductas de antao adaptativas.

3OXWFKLN  HVWDEOHFHODH[LVWHQFLDGHWUHVFRPSRQHQWHVHQODHPRFLyQFRJQL-


WLYRVXEMHWLYRVLROyJLFR\FRQGXFWXDO

El planteamiento de Tomkins

3DUD HO DXWRU ODV HPRFLRQHV EiVLFDV VRQ SURJUDPDV VXEFRUWLFDOHV LQQDWRV JH-
nticamente programados en nuestro cerebro, que se ponen en marcha ante los
FDPELRV GHO HQWRUQR /D HVWLPXODFLyQ DPELHQWDO SURGXFH OD DFWLYDFLyQ GH XQ
SURJUDPDVXEFRUWLFDOHVSHFtFRTXHSURPXHYHXQDVHULHGHFDPELRVTXHGDQOX-
gar a estados emocionales concretos. Sin embargo, la activacin del programa
QHXUDO QR HV VXFLHQWH SDUD SURGXFLU OD UHDFFLyQ HPRFLRQDO VLQR TXH HVWD GH-
pende del feedbackGHODYR]\GHODH[SUHVLyQIDFLDODVRFLDGDDGLFKDHPRFLyQ
3RVWHULRUPHQWH7RPNLQVFRQFUHWDTXHORVUHFHSWRUHVPXVFXODUHVGHODSLHOIDFLDO

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 208 Manual de teoras emocionales y motivacionales - UJI
feedbackSURSLRFHSWLYRVRQORVUHVSRQVDEOHVGHODH[SHULHQFLDHPRFLRQDO/D
secuencia sera la siguiente: activacin cortical-activacin subcortical-expresin
IDFLDOIHHGEDFN SURSLRFHSWLYRVHQWLPLHQWR H[SHULHQFLD HPRFLRQDO  5RVVHOOy \
5HYHUWSiJ 

/DKLSyWHVLVGHOfeedbackIDFLDO YHUJXUD WLHQHVXRULJHQHQHOFRQFHSWRGH


HPRFLyQGH:LOOLDP-DPHV

$GHPiVHQIDWL]DHOSDSHOPRWLYDGRUTXHGHVHPSHxDODVHPRFLRQHVSXHVSURSRU-
ciona la intensidad de la conducta necesaria para activar la conducta.

$GLIHUHQFLDGH3OXWFKLNHVWHDXWRUMXQWRFRQ,]DUGPDQWLHQHTXHODHPRFLyQSXH-
de ocurrir previamente a alguna forma de procesamiento cognitivo.

(VWDEOHFHGRVWLSRVGHHPRFLRQHVLQQDWDV\VRFLDOHVFDUDFWHUL]iQGRVHHVWDV~OWL-
mas por la ausencia de manifestacin expresiva, consecuencia de la imposicin de
ODVUHJODVGHODVRFLHGDGTXHYHWDQVXH[WHULRUL]DFLyQ

(OSODQWHDPLHQWRLQLFLDOGH7RPNLQVVREUHODKLSyWHVLVGHOfeedback facial mantiene que la mus-


culatura facial es el factor responsable de la induccin de la emocin, debido a la informacin
sensorial que esta proporciona al cerebro, desencadenando la emocin pertinente, al activarse el
programa afectivo asociado a la misma.

/RVDUJXPHQWRVGH7RPNLQVVRQORVVLJXLHQWHV
/DFDUDHVODSDUWHGHQXHVWURFXHUSRTXHWLHQHXQDPD\RUVHQVLELOLGDG FDQWLGDGGH
UHFHSWRUHVVHQVRULDOHV \UHSUHVHQWDFLyQFRUWLFDO
/DVH[SUHVLRQHVIDFLDOHVSUHVHQWDQXQFDUiFWHULQYROXQWDULRGLItFLOHVGHFRQWURODU

3RVWHULRUPHQWH 7RPNLQV UHIRUPXOy GLFKR SODQWHDPLHQWR SXQWXDOL]DQGR TXH ORV UHFHSWRUHV


sensoriales de la piel, activados por la musculatura facial, son los factores responsables de la
emocin.

)LJXUD/DKLSyWHVLVGHOfeedbackIDFLDOGH7RPNLQV

En la actualidad la investigacin no resulta concluyente aunque parece que la exa-


geracin intencional de la expresin facial aumenta la intensidad de la experiencia
emocional asociada a dicha emocin.

(OSODQWHDPLHQWRGH,]DUG

(QODPLVPDOtQHDTXH7RPNLQVHQIDWL]DHOSDSHOGHODH[SUHVLyQIDFLDOHOFDUiFWHU
motivacional de las emociones innatas y que cada emocin se asocia a un progra-
ma innato que recoge su experiencia emocional y su patrn de expresin facial
emocional particular.

Desde su teora diferencial de las emociones ,]DUG SURSRQHODH[LV-


WHQFLDGHGLH]HPRFLRQHVEiVLFDV H[FLWDFLyQLQWHUpVDOHJUtDVRUSUHVDDQJXVWLD
GRORU FyOHUDLUD DVFR GHVSUHFLR PLHGR YHUJHQ]D \ FXOSD  &DGD HPRFLyQ VH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 209 Manual de teoras emocionales y motivacionales - UJI
FDUDFWHUL]DSRUSRVHHUVXSURSLRVXVWUDWRQHXUDOVXSDWUyQH[SUHVLYR\VXH[SH-
riencia emocional o sentimiento. Cada elemento es necesario para poder hablar de
HPRFLyQ(QIDWL]DHOSDSHODGDSWDWLYRGHODVHPRFLRQHVSRUSRVHHUFDUDFWHUtVWLFDV
PRWLYDFLRQDOHVSURSLDVTXHJDUDQWL]DQODVXSHUYLYHQFLDGHOLQGLYLGXR\GHODSUR-
pia especie.

Por otra parte, las emociones pueden interactuar entre s dando lugar a mltiples
HVWDGRV HPRFLRQDOHV \ WDPELpQ FRQ RWURV SURFHVRV SVLFROyJLFRV SHUFHSFLyQ
FRJQLFLyQHWF VLHQGRODHPRFLyQHOIDFWRUPRWLYDGRUGHODFRQGXFWDUHVXOWDQWH
7DPELpQVHxDODODIXQFLyQVRFLDOGHODFRPXQLFDFLyQTXHGHVHPSHxDODH[SUHVLyQ
facial de la emocin.

Por ltimo, considera que la actividad neuroqumica produce cambios faciales y


corporales que, al llegar al cerebro se convierten en conscientes, dando lugar a las
HPRFLRQHVEiVLFDV

El planteamiento de Ekman

(ODXWRUPDQWLHQHWDPELpQHOFDUiFWHUXQLYHUVDOGHODH[SUHVLyQIDFLDOGHODVHPR-
FLRQHVEiVLFDV6XLQYHVWLJDFLyQVHFHQWUDHQODIXQFLyQVRFLDOGHODVHPRFLRQHVOD
FRPXQLFDFLyQ (NPDQ(NPDQ\2VWHU 

'HVWDFDODHODERUDFLyQGHXQVLVWHPDGHFRGLFDFLyQGHODH[SUHVLyQIDFLDOGHOD
emocin, )DFLDO$FWLRQ&RGLQJ6\VWHP FACS; FACS(NPDQ)ULHVHQ\+DJHU
 

El FACSHVXQSURFHGLPLHQWRTXHSHUPLWHLGHQWLFDUODVHPRFLRQHVDSDUWLUGHODV
unidades de accin HO UHFRQRFLPLHQWR GH ODV PLVPDV HVWi PRGXODGR SRU OD LQ-
IRUPDFLyQ SURSRUFLRQDGD SRU HO FRQWH[WR \ HO SURSLR REVHUYDGRU DWULEXFLRQHV
H[SHFWDWLYDVH[SHULHQFLDGLIHUHQFLDVLQGLYLGXDOHVHWF 

8QDXQLGDGGHDFFLyQ UA HVWiIRUPDGDSRUXQDVHULHGHPRYLPLHQWRVPXVFXODUHV
faciales cuyo conjunto global recibe la denominacin de unidad de accin. Dos
emociones pueden tener en comn dos UA idnticas. Algunos autores consideran
esta coincidencia como un factor explicativo de la confusin que puede producirse
entre dos emociones diferentes: por ejemplo, la sorpresa y el miedo.

3RURWUDSDUWH&KyOL]\)HUQiQGH]$EDVFDO  FRQVLGHUDQTXHHOHVWXGLRGH


la expresin o manifestacin de las emociones requiere la consideracin de las
WUHVGLPHQVLRQHVGHUHVSXHVWD FRJQLWLYDVXEMHWLYDFRQGXFWXDOH[SUHVLYD\VLR-
OyJLFDDGDSWDWLYD SDUDDERUGDUODFRPSOHMLGDGGHOIHQyPHQRHPRFLRQDO\HOORHQ
FRQVRQDQFLDFRQODGHQLFLyQGHHPRFLyQTXHVRVWLHQHQXQDH[SHULHQFLDDIHFWLYD
en cierta medida agradable o desagradable, que supone una cualidad fenomenol-
gica caracterstica y que comprende tres sistemas de respuesta: cognitivo-subjetivo;
FRQGXFWXDOH[SUHVLYR\VLROyJLFRDGDSWDWLYR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 210 Manual de teoras emocionales y motivacionales - UJI
Dicho sistema, el FACSVHKDOODHQFRQVRQDQFLDFRQORVHVWXGLRVGH'DUZLQ 
 HQORVTXHVHDVXPHODH[LVWHQFLDGHXQDVHULHGHHPRFLRQHVEiVLFDVLQQDWDV
\GHFDUiFWHUXQLYHUVDOSUHVHQWHVHQWRGRVORVVHUHVKXPDQRV\FRQXQDPDUFDGD
FRQWLQXLGDGORJHQpWLFDDWUDYpVGHODVHVSHFLHV HQ*yPH],xLJXH] 

Por otra parte, tambin existe otro procedimiento de medicin: el Sistema de Codi-
FDFLyQGH0i[LPD'LVFULPLQDFLyQGHO0RYLPLHQWR)DFLDOHOMAX ,]DUG 
Ambos sistemas se basan en la actividad muscular facial y se diferencian en el
procedimiento por el cual fueron desarrollados; mientras el MAX tiene un origen
terico basado en los msculos supuestamente implicados en la expresin de las
emociones, el FACS parte de una base anatmica y un desarrollo experimental. En
este ltimo no existe una relacin unvoca entre la accin muscular y una determi-
QDGDH[SUHVLyQDGHPiVUHTXLHUHGHRWURVSDUiPHWURVUHOHYDQWHVSDUDLGHQWLFDU
XQDHPRFLyQODLQWHQVLGDGGHFDGDDFFLyQIDFLDO HVFDODGHSXQWRV VXGXUDFLyQ
\ODVXQLGDGHVGHDFFLyQ UA LPSOLFDGDV

1RREVWDQWHDOJXQRVDVSHFWRVWHyULFRVQRHVWiQFRUURERUDGRVFLHQWtFDPHQWH SRU
HMHPSORODH[LVWHQFLDGHVHLVHPRFLRQHVEiVLFDV\ODKLSyWHVLVGHOfeedbackIDFLDO 
DXQTXHHVWiQVRPHWLGRVDGLVFXVLyQFLHQWtFDFRQWLQXDHQODDFWXDOLGDG &KyOL]\
)HUQiQGH]$EDVFDO 3RURWUDSDUWHHOFACSHVXQRGHORVLQVWUXPHQWRVPiV
XWLOL]DGRVHQODFRGLFDFLyQGHODH[SUHVLyQIDFLDOTXHSHUPLWHODLQYHVWLJDFLyQVR-
EUHODH[SUHVLyQGHODVHPRFLRQHVHQDUDVGHFODULFDUHODQiOLVLV\ODFRPSUHQVLyQ
en el estudio del campo de la emocin.

2WURVSODQWHDPLHQWRVFRQVLGHUDQTXHDSHVDUHOFDUiFWHUXQLYHUVDOGHODVHPRFLR-
QHVEiVLFDVHOFRQWH[WRGHEHWHQHUVHHQFXHQWDSDUDLQWHUSUHWDUODH[SUHVLyQIDFLDO
emocional. En particular, el modelo de la mnima universalidad establece que, en
RFDVLRQHVXQVXMHWRSXHGHXWLOL]DUODH[SUHVLyQIDFLDOFRQQHVLQVWUXPHQWDOHVFRQR
VLQFDUiFWHULQWHQFLRQDO&RPRFRQVHFXHQFLDODHPRFLyQEiVLFDVHFRQYLHUWHHQXQ
SURFHVRFRQWURODGR\IUtRVLQFRQWHQLGRDIHFWLYR3RUWDQWRHVWHPRGHORHQIDWL]DHO
factor del contexto situacional, el gnero del receptor y el propio estado afectivo,
VL ELHQ SXHGHQ WHQHUVH HQ FXHQWD IDFWRUHV DGLFLRQDOHV 5XVVHOO %DFKRURZVNL \
)HUQiQGH]'ROV 

(QODDFWXDOLGDG 5RVVHOOy\5HYHUW ORVKDOOD]JRVQHXURVLROyJLFRVDSRU-


tan evidencia sobre la existencia de determinados circuitos cerebrales asociados a
HPRFLRQHVWDPELpQHVSHFtFDV'LFKRVFLUFXLWRVWDPELpQVHDVRFLDQDVHQWLPLHQ-
WRVFRQFUHWRV\DODDFWLYDFLyQGHP~VFXORVIDFLDOHVSDUWLFXODUHV /H'RX[
3DQNVHSS   3RU RWUD SDUWH ORV SDWURQHV GH DFWLYDFLyQ DXWRQyPLFD QR VRQ
FRQFUHWRVSDUDFDGDHPRFLyQEiVLFDDXQTXHSRGHPRVHQFRQWUDUGHWHUPLQDGRVtQ-
GLFHVTXHDYDODQVXHVSHFLFLGDG3RUHMHPSORODVHFUHFLyQGHHSLQHIULQDHQHO
miedo y la norepinefrina en la ira; la vasoconstriccin perifrica en el miedo y la
vasodilatacin perifrica en la ira, etc.

(VWHWLSRGHSODQWHDPLHQWRVUHFLEHXQDVHULHGHFUtWLFDV 2UWRQ\\7XUQHU 
que expondremos a continuacin:

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 211 Manual de teoras emocionales y motivacionales - UJI
6HFXHVWLRQDHOFDUiFWHULQQDWRGHODVHPRFLRQHVEiVLFDVGHELGRDODIDOWDGHDFXHU-
GRHQWUHORVGLVWLQWRVDXWRUHVGHDSRUWDUXQDFODVLFDFLyQGHODVPLVPDVVLELHQHV
FLHUWRTXHSDUHFHH[LVWLUFRQVHQVRHQFLQFRHPRFLRQHV DOHJUtDLUDPLHGRWULVWH-
]DDVFR LQFOXVRGHFXiOHVVRQODVSULQFLSDOHVFDUDFWHUtVWLFDVGHODVPLVPDV3RU
ejemplo: la valencia o tono, la intensidad, la duracin, etc..

'HVGHXQSXQWRGHYLVWDQHXURVLROyJLFRQRH[LVWHHYLGHQFLDHPStULFDSDUDDUPDU
ODH[LVWHQFLDGHHPRFLRQHVEiVLFDV LQQDWDV 6HFRQVWDWDODH[LVWHQFLDGHGHWHUPL-
nados circuitos cerebrales para emociones concretas, aunque parece que se corres-
SRQGHQPiVELHQFRQVLVWHPDVGHUHVSXHVWD$OUHVSHFWRHOVLVWHPDGHDSUR[LPDFLyQ
ODDOHJUtD \HOVLVWHPDGHLQKLELFLyQRHYLWDFLyQGHODUHVSXHVWD HOPLHGR (VGH-
cir, no siempre los circuitos cerebrales se corresponden con una emocin discreta.

/RVUHVXOWDGRVGHODVLQYHVWLJDFLRQHVWUDQVFXOWXUDOHVUHYHODQTXHHOFDUiFWHUXQL-
YHUVDOGHODVHPRFLRQHVVHGHEHDTXHHOFDUiFWHUEiVLFRVHDWULEX\HDORVFRPSR-
QHQWHV GH OD H[SUHVLyQ HPRFLRQDO$GHPiV XQD PLVPD HPRFLyQ QR VLHPSUH VH
expresa con el mismo nmero de componentes.

&RQFOXVLRQHV
(QWpUPLQRVJHQHUDOHVODVDSRUWDFLRQHVUHDOL]DGDVGHVGHODVWHRUtDVFRQGXFWXDOHV
al campo de la emocin no han sido, en principio, demasiado relevantes, en el
VHQWLGRGHTXHODHPRFLyQKDVLGRWUDWDGDFRPRXQDFRQGXFWDPiVHVGHFLUFRPR
XQDUHVSRQGLHQWHFRQGLFLRQDPLHQWRFOiVLFRXRSHUDQWHFRQGLFLRQDPLHQWRRSH-
UDQWHPiVVLQDWHQGHUDODFRPSOHMLGDGGHVXUHVSXHVWD5HFRUGHPRVTXHODUHVSXHVWD
HPRFLRQDOSXHGHDERUGDUVHGHVGHWUHVGLPHQVLRQHVFRJQLWLYDVXEMHWLYD VHQWLPLHQWR 
VLROyJLFD\PRWRUDFRQGXFWXDOH[SUHVLYD&RQQHVGHLQYHVWLJDFLyQ\GLGiFWLFRV
explicamos la respuesta emocional separando dichos componentes de respuesta,
aunque en ningn momento debemos obviar que la emocin engloba los tres com-
ponentes.

'HVGHHOHQIRTXHGHODVDSUR[LPDFLRQHVFRQGXFWXDOHVODVWHRUtDVGHODSUHQGL]DMH
VHKDQFHQWUDGRHQODVGLPHQVLRQHVGHUHVSXHVWDVLROyJLFD\PRWRUDFRQGXFWXDO
expresiva, por considerarlas respuestas objetivas, directamente observables. El
inters se ha centrado en los cambios observables tanto de la conducta como del
DPELHQWH/DGLPHQVLyQGHUHVSXHVWDFRJQLWLYDVXEMHWLYD VHQWLPLHQWR QRKDVLGR
HVWXGLDGDSRUFXHVWLRQHVPHWRGROyJLFDV1RSRGtDREVHUYDUVHGLUHFWDPHQWH/RV
planteamientos cognitivistas recogen esta ltima dimensin, investigada con la
D\XGDGHODLQQRYDFLyQWHFQROyJLFD WpFQLFDVGHUHVRQDQFLDPDJQpWLFDWpFQLFDV
GH QHXURLPDJHQ HWF  HO XVR GH SURJUDPDV LQIRUPiWLFRV HWF FX\RV UHVXOWDGRV
SHUPLWHQUHDOL]DULQIHUHQFLDVVREUHHOSODQRVXEMHWLYRGHODHPRFLyQ

5HVDOWDPRVODLQYHVWLJDFLyQUHDOL]DGDHQHOHVWXGLRGHODH[SUHVLyQIDFLDOGHODV
emociones, si bien las premisas de las que parte todava no han sido corrobo-
UDGDVHQODDFWXDOLGDGORVKDOOD]JRVREWHQLGRVSRVLELOLWDQVXHVWXGLRFLHQWtFR
HQGLYHUVDVFXOWXUDV\VRFLHGDGHV FDUiFWHUXQLYHUVDOGHODVHPRFLRQHVEiVLFDV 
avalados por la investigacin del campo de la neurociencia.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 212 Manual de teoras emocionales y motivacionales - UJI
(QGHQLWLYDHOHVWXGLRFLHQWtFRGHODHPRFLyQUHTXLHUHGHODFRQVLGHUDFLyQGH
las tres dimensiones de respuesta para tener una comprensin global del mismo.
$KRUDELHQHOHQIRTXHWHyULFRGHODLQYHVWLJDFLyQPDUFDUiRHQIDWL]DUiODLPSRU-
tancia de uno de dichos componentes, en detrimento del estudio de los otros.

Bibliografa
ABRAMSON, L. Y.; M. E. P. SELIGMAN y J. D. TEASDALE  /HDUQHGKHOSOHVVQHVV
in human: critique and reformulation, -RXUQDORI$EQRUPDO3V\FKRORJ\

BANDURA, A.   3ULQFLSOHV RI %HKDYLRU 0RGLFDWLRQ +ROW 5LQHKDUW DQG
:LQVWRQ1XHYD<RUN
  6HOIHIFDF\WRZDUGDXQLI\LQJWKHRU\RIEHKDYLRUDOFKDQJH3V\-
chological Review
BANDURA, A.; D. ROSS y S. A. ROSS  7UDQVPLVVLRQRIDJJUHVVLRQWKURXJK
imitation of aggressive models, -RXUQDORI$EQRUPDODQG6RFLDO3V\FKRORJ\

BINDRA, D.   $ QHXURSV\FKRORJLFDO LQWHUSUHWDWLRQ RI WKH HIIHFWV RI GULYH
and incentive-motivation on general activity and instrumental behavior,
3V\FKRORJLFDO5HYLHZ
   7KH LQWHUUHODWHG PHFKDQLVPV RI UHLQIRUFHPHQW DQG PRWLYDWLRQ DQG
WKHQDWXUHRIWKHLULQXHQFHRQUHVSRQVHHQ:-$UQROG\'/HYLQH HGV 
1HEUDVND6\PSRVLXPRQ0RWLYDWLRQ8QLYHUVLW\RI1HEUDVND3UHVV/LQFROQ
BOLLES, R. C.  6SHFLHVVSHFLFGHIHQFHUHDFWLRQVDQGDYRLGDQFHOHDUQLQJ
3V\FKRORJLFDO5HYLHZ
BORKOVEC, T. D.  3K\VLRORJLFDODQGFRJQLWLYHSURFHVVLQWKHUHJXODWLRQ
RIDQ[LHW\HQ*(6FKZDUW]\'6KDSLUR (GV Consciousness and self-
UHJXODWLRQ$GYDQFHVLQUHVHDUFK 9ROSS 3OHQXP1XHYD<RUN
 ([WHQVLRQVRIWZRIDFWRUWKHRU\&RJQLWLYHDYRLGDQFHDQGDXWRQRPLF
SHUFHSWLRQHQ1%LUEDXPHU\+'.LPPHO (GV Biofeedback and self-
regulation. LEA+LOOVGDOH1-
DARWIN, C.  /DH[SUHVLyQGHODVHPRFLRQHVHQORVDQLPDOHV\HQHOKRPEUH.
3XEOLFDGRRULJLQDOPHQWHHQLQJOpVHQ $OLDQ]D0DGULG
DINSMOOR, J. A.   6WLPXOL LQHYLWDEO\ JHQHUDWHG E\ EHKDYLRU WKDW DYRLGV
HOHFWULFVKRFNDUHLQKHUHQWO\UHLQIRUFLQJ-RXUQDORIWKH([SHULPHQWDO$QDO\VLV
RI%HKDYLRU
DOMJAN, M.  3ULQFLSLRVGHDSUHQGL]DMH\FRQGXFWD7KRPVRQ0p[LFR
EKMAN, P.  )DFLDOH[SUHVVLRQVRIHPRWLRQ$PHULFDQ3V\FKRORJLVW

EKMAN, P. y OSTER, H   5HYLHZ RI UHVHDUFK  HQ 3 (NPDQ
HG  (PRWLRQ LQ WKH +XPDQ )DFH  HGLFLyQ SS   &DPEULGJH
8QLYHUVLW\3UHVV1XHYD<RUN
  Emotions in the human face&DPEULGJH8QLYHUVLW\3UHVV1XHYD<RUN

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 213 Manual de teoras emocionales y motivacionales - UJI
  )DFLDOH[SUHVVLRQVHQ7'DOJOHLVK\03RZHU HGV Handbook of
Cognition and Emotion SS :LOH\&KLFKHVWHU
EKMAN, P., W. V. FRIESEN y J. C. HAGER  New Version of the Facial Action
&RGLQJ 6\VWHP Disponible en http://dataface.nirc.com/Expression/FACS/New-
9HUVLRQQHZBYHUVLRQKWPO
FANSELOW, M. S.  7KHDGDSWLYHIXQFWLRQRIFRQGLWLRQHGGHIHQVLYHEHKDYLRU
An ecological approach to Pavlovian stimulus-substitution theory, en R. J.
%ODQFKDUG \ 3 ) %UDLQ HGV  (WKRH[SHULPHQWDO DSSURDFKHV WR WKH VWXG\ RI
behaviour SS .OXZHU1RUZHOO0$
FANSELOW, M. S. y L. S. LESTER  $IXQFWLRQDOEHKDYLRULVWLFDSSURDFKWR
aversively motivated behavior: Predatory imminence as a determinant of the
WRSRJUDSK\ RI GHIHQVLYH EHKDYLRU HQ 5 & %ROOHV \ 0 ' %HHFKHU HGV 
Evolution and learning SS (UOEDXP+LOOVGDOH1-
FERNNDEZ-ABASCAL, E. G. y M. CHLIZ MONTAS  Expresin facial de la
emocin. UNEDHGLFLRQHV0DGULG
FERNNDEZ-ABASCAL, E. G.; F. PALMERO; M. CHLIZ y F. MARTNEZ SNCHEZ  
0DQXDOGH0RWLYDFLyQ\(PRFLyQ5DPyQ$UHFHV0DGULG
GMEZ IGUEZ, C  ([SUHVLyQIDFLDOGHODHPRFLyQPsicothema,   

HAMMOND, L. J. (  &RQGLWLRQDO HPRWLRQDO VWDWHV HQ 3 %ODFN HG 
3K\VLRORJLFDO&RUUHODWHVRI(PRWLRQ$FDGHPLF3UHVV1XHYD<RUN
IZARD, C. E.   7KH 0D[LPDOO\ 'LVFULPLQDWLYH )DFLDO 0RYHPHQW &RGLQJ
6\VWHP,QVWUXFWLRQDO5HVRXUFHV&HQWHU8QLYHUVLW\RI'HODZDUH1HZDUN
  7KH3V\FKRORJ\RI(PRWLRQV3OHQXP3UHVV1XHYD<RUN
LEDOUX, J. E.   7KH (PRWLRQDO %UDLQ WKH 0\VWHULRXV 8QGHUSLQQLQJV RI
Emotional Life6LPRQDQG6FKXVWHU1XHYD<RUN
LEVIS, D. J. \.(BREWER  7KHQHXURWLFSDUDGR[DWWHPSWVE\WZRIDFWRU
fear theory and alternative avoidance models to resolve the issues associated
ZLWK VXVWDLQHG DYRLGDQFH UHVSRQGLQJ LQ H[WLQFWLRQ HQ 5 5 0RZUHU \ 6
%.OHLQ HGV +DQGERRNRIFRQWHPSRUDU\OHDUQLQJWKHRULHV SS 
0DKZDK/DZUHQFH(UOEDXP
MAIA, T. V.   7ZRIDFWRUWKHRU\ WKHDFWRUFULWLFPRGHODQG FRQGLWLRQHG
avoidance,/HDUQLQJ %HKDYLRU
MAIER, N. R. F.  3UREOHPVROYLQJDQGFUHDWLYLW\LQLQGLYLGXDOVDQGJURXSV.
:DGVZRUWK%HOPRQW&$
MOWRER, O. H.  2QWKHGXDOQDWXUHRIOHDUQLQJ$UHLQWHUSUHWDWLRQRIFRQ-
GLWLRQLQJDQGSUREOHPVROYLQJHarvard Educational Review
ORTONY, A. y T. J. TURNER   :KDWV EDVLF DERXW EDVLF HPRWLRQV"
3V\FKRORJLFDO5HYLHZ
OVERMIER, J. B. y M. E. P. SELIGMAN  (IIHFWVRILQHVFDSDEOHVKRFNXSRQ
subsequent escape and avoidance learning, Journal of Comparative and
3K\VLRORJLFDO3V\FKRORJ\
OVERMIER, J. B.   ,QWHUIHUHQFH ZLWK DYRLGDQFH EHKDYLRXU Journal of
([SHULPHQWDO3V\FKRORJ\
PALMERO, F.; C. GMEZ IGUEZ; A. CARPI; C. GUERRERO \-/ DEZ  0R-
tivacin y biologa: desarrollos tericos,5HYLVWD(OHFWUyQLFDGH0RWLYDFLyQ\
(PRFLyQ'LVSRQLEOHHQKWWSUHPHXMLHV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 214 Manual de teoras emocionales y motivacionales - UJI
PALMERO, F.; A. CARPI; C. GMEZ IGUEZ; C. GUERRERO y C. MUOZ  0R-
tivacin y cognicin: desarrollos tericos, Revista Electrnica de Motivacin
\(PRFLyQ'LVSRQLEOHHQKWWSUHPHXMLHV
PANKSEPP, J.   7KH FOHDUHVW SK\VLRORJLFDO GLVWLQFWLRQV EHWZHHQ HPRWLRQV
ZLOOEHIRXQGDPRQJWKHFLUFXLWVRIWKHEUDLQHQ3(NPDQ\5-'DYLGVRQ
HGV The nature of emotion SS 2[IRUG8QLYHUVLW\3UHVV2[IRUG
PETRI, H. L. y J. M. GOVERN   HGLFLyQ 0RWLYDFLyQ7HRUtDLQYHVWLJDFLyQ
\DSOLFDFLRQHV7KRPVRQ0p[LFR
PLUTCHIK, R.   (PRWLRQV LQ HDUO\ GHYHORSPHQW $ SV\FKRHYROXWLRQDU\
DSSURDFKHQ53OXWFKLN\+.HOOHUPDQ HGV (PRWLRQ7KHRU\5HVHDUFK
DQG ([SHULHQFH 9RO  (PRWLRQV LQ (DUO\ 'HYHORSPHQW SS  
$FDGHPLF3UHVV1XHYD<RUN
  The Emotions8QLYHUVLW\3UHVVRI$PHULFD1XHYD<RUN
PUENTE, A.   HGLFLyQ  &RJQLFLyQ \$SUHQGL]DMH )XQGDPHQWRV SVLFROy
gicos3LUiPLGH0DGULG
QUIRS, P. y R. CABESTRERO   $SRUWDFLRQHV D OD HPRFLyQ GHVGH OD SVL-
FRORJtDGHODSUHQGL]DMHHQ3LODU4XLUyV([SyVLWR\5D~O&DEHVWUHUR$ORQVR
HGV )XQFLRQHVDFWLYDGRUDVSULQFLSLRVEiVLFRVGHODPRWLYDFLyQ\HPRFLyQ
SS 5DPyQ$UHFHV0DGULG
RESCORLA, R. A. y R. L. SOLOMON  7ZRSURFHVVOHDUQLQJWKHRU\UHODWLRQ-
ships between Pavlovian conditioning and instrumental learning, 3V\FKRORJL-
FDO5HYLHZ
RESCORLA, R. A.  3UREDELOLW\RIVKRFNLQWKHSUHVHQFHDQGDEVHQFHRI&6LQ
fear conditioning, -RXUQDORI&RPSDUDWLYHDQG3K\VLRORJLFDO3V\FKRORJ\

ROSSELL, J. y X. REVERT  0RGHORVWHyULFRVHQHOHVWXGLRFLHQWtFRGHOD
HPRFLyQHQ)3DOPHUR\)0DUWtQH]6iQFKH] HGV 0RWLYDFLyQ\(PRFLyQ
SS 0F*UDZ+LOO0DGULG
SELIGMAN, M. E. P. y MAIER, N. R. F.  )DLOXUHWRHVFDSHWUDXPDWLFVKRFN
-RXUQDORI([SHULPHQWDO3V\FKRORJ\
SELIGMAN, M. E. P.   +HOSHOVVQHVV RQ GHSUHVVLRQ GHYHORSPHQW DQG
death6DQ)UDQFLVFR)UHHPDQ 7UDGXFFLyQ,QGHIHQVLyQ(QODGHSUHVLyQHO
GHVDUUROOR\ODPXHUWH 'HEDWH0DGULG
  Learned Helplessness and Depression in Animals and Man *HQHUDO
/HDUQLQJ3UHVVP0RUULVWRZQ1XHYD-HUVH\
SIDMAN, M  5HGXFWLRQRIVKRFNIUHTXHQF\DVUHLQIRUFHPHQWIRUDYRLGDQFH
behavior, -([SHULPHQWDO$QDO\VLVRI%HKDYLRU
SKINNER, B.  Sobre el conductismo)RQWDQHOOD%DUFHORQD
SPENCE, K. W.  %HKDYLRU7KHRU\DQG/HDUQLQJ3UHQWLFH+DOO(QJOHZRRG
Cliffs, Nueva Jersey.
 %HKDYLRUWKHRU\DQGFRQGLWLRQLQJ<DOH8QLYHUVLW\3UHVV1HZ+DYHQ
TAYLOR, J. A.  7KHUHODWLRQVKLSRIDQ[LHW\WRWKHFRQGLWLRQHGH\HOLGUH-
sponse, -RXUQDORI([SHULPHQWDO3V\FKRORJ\
   $ SHUVRQDOLW\ VFDOH RI PDQLIHVW DQ[LHW\ Journal of Abnormal and
6RFLDO3V\FKRORJ\
WATSON, J. B.  Behaviorism. University of Chicago Press, Chicago.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 215 Manual de teoras emocionales y motivacionales - UJI
WATSON, J. B. y RAYNER, R.  &RQGLWLRQHGHPRWLRQDOUHDFWLRQJournal of
([SHULPHQWDO3V\FKRORJ\
WATSON, J. B   $ VFKHPDWLF RXWOLQH RI WKH HPRWLRQV 3V\FKRORJLFDO
5HYLHZ
WATSON, J. B  ([SHULPHQWDOVWXGLHVRQWKHJURZWKRIWKHHPRWLRQVHQ
&0XUFKLVRQ HG 3V\FKRORJLHVRI&ODUN8QLYHUVLW\3UHVV:RUFHVWHU
0DVV
WATSON, J. B. y MORGAN, J. J. B.  (PRWLRQDOUHDFWLRQVDQGSV\FKRORJLFDO
experimentation, $PHULFDQ-RXUQDORI3V\FKRORJ\
WEISS, J. M.; E. E. KRIECKHAUS y R. CONTE  (IIHFWVRIIHDUFRQGLWLRQLQJRQ
subsequent avoidance behaviour, -RXUQDORI&RPSDUDWLYHDQG3K\VLRORJLFDO
3V\FKRORJ\
YOUNG, P. T.  0RWLYDWLRQDQG(PRWLRQ$6XUYH\RIWKH'HWHUPLQDQWVRI
+XPDQDQG$QLPDO$FWLYLW\:LOH\1XHYD<RUN

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 216 Manual de teoras emocionales y motivacionales - UJI
7HRUtDVFRJQLWLYDVHQHPRFLyQ
,QWURGXFFLyQ
(OLQWHUpVHQGHQLUTXpHVXQDHPRFLyQKDVLGRXQDFRQVWDQWHDOPLVPRWLHP-
SRTXHSUHVHQWDGLFXOWDGHVHQXQLFDUODV\DH[LVWHQWHV+D\TXHWHQHUHQFXHQWD
que las emociones son complejos procesos que han sufrido los sesgos peculiares
impuestos por las tendencias dominantes en cada poca segn los planteamien-
WRVYLJHQWHVXRULHQWDFLRQHVGHFDGDHVFXHODRJUXSRGHLQYHVWLJDFLyQ6LDGHPiV
tenemos en cuenta que la emocin puede ser considerada como un proceso en el
que intervienen distintos componentes, observaremos que, en la medida en la que
FDGDDXWRUVHFHQWUDHQDOJXQRGHHOORVHQVXVLQYHVWLJDFLRQHVSODQWHDXQDGHQL-
cin de emocin que difcilmente coincide con la de otro autor interesado en otro
GHORVFRPSRQHQWHV3RUHVWDVUD]RQHVFRPRUHSHWLGDPHQWHKDVHxDODGR0DQGOHU
 LQWHQWDUHVWDEOHFHUXQDGHQLFLyQFRQVHQVXDGDGHHPRFLyQHVSUiF-
WLFDPHQWHLPSRVLEOHHQODDFWXDOLGDG0LHQWUDVXQRVVXEUD\DQODVFDUDFWHUtVWLFDV
FRQGXFWXDOHVRWURVVHFHQWUDQHQORVDVSHFWRVVLROyJLFRVRELHQHQVXFDUiFWHU
DGDSWDWLYRRSDWROyJLFRLQFOXVRVHSRGUtDQFODVLFDUGHVHUPX\SUHFLVDV\RDP-
ELJXDV 3DOPHUR*XHUUHUR*yPH]&DUSL (VSUHFLVDPHQWHODDXVHQFLD
GH XQD GHQLFLyQ DPSOLDPHQWH DFHSWDGD OR TXH LPSLGH HO DVHQWDPLHQWR GH XQD
DFHSWDEOHWHRUtDGHODHPRFLyQ 6FKHUHU 

A grandes rasgos, podemos describir una emocin como un proceso complejo


TXHHVWiLQWHJUDGRSRUGLYHUVRVFRPSRQHQWHV(VWRVVRQORVQHXURVLROyJLFRVORV
FRPSRUWDPHQWDOHV \ ORV FRJQLWLYRV (VWi GHWHUPLQDGD PXOWLGLPHQVLRQDOPHQWH H
incluye diversos fenmenos o procesos afectivos aunque estos no pueden ser con-
VLGHUDGRVHQVXWRWDOLGDGSURFHVRVHPRFLRQDOHV %LVTXHUUD3DOPHUR0HV-
WUH 3DUDTXHWHQJDOXJDUODHPRFLyQHVQHFHVDULRTXHVHSHUFLEDFRQVFLHQWH
o inconscientemente, un estmulo o tenga lugar un acontecimiento externo o in-
terno a la persona, que ocurra en la actualidad, que tengamos un recuerdo de algo
que nos sucedi o que esperemos que suceda en el futuro. As, la valoracin del
estmulo como algo agradable o desagradable da lugar a la respuesta emocional
cuyas caractersticas es la corta duracin y alta intensidad de la respuesta, mani-
IHVWiQGRVHHVWDH[WHUQDHLQWHUQDPHQWH 3DOPHUR\0HVWUH 

'DGDODGLYHUVLGDGGHSDUiPHWURVTXHLQWHJUDQODHPRFLyQ\DODPSOLRGHVDUUROOR
de la psicologa como ciencia, se han desarrollado diversas teoras sobre la emo-
cin. En este captulo nos centraremos en los modelos cognitivos que explican el
desarrollo del proceso emocional y en las interacciones entre ambos procesos que-
GDQGRORVPRGHORVTXHH[SOLFDQORVFRPSRQHQWHVELRVLROyJLFRV\FRQGXFWXDOHV
en otros captulos de este manual.

/RVPRGHORVTXHDQDOL]DQ\H[SOLFDQORVSURFHVRVHPRFLRQDOHVGHVGHODGLPHQVLyQ
FRJQLWLYLVWDHQOtQHDVJHQHUDOHVSRGHPRVDSUHFLDUTXHHQIDWL]DQODLPSRUWDQFLDGH
ODYDORUDFLyQFRJQLWLYDSDUDODH[SHULHQFLDGHODHPRFLyQ/RVDUJXPHQWRVHPSOHD-
GRVGHVGHHVWDSHUVSHFWLYDHVWiQtQWLPDPHQWHUHODFLRQDGRVFRQHOSURFHVDPLHQWR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 217 Manual de teoras emocionales y motivacionales - UJI
activo de la informacin, subrayando la relevancia del funcionamiento superior
GHOLQGLYLGXR1RREVWDQWHFRPRSRGUHPRVDSUHFLDUWDPELpQVHORFDOL]DQHQHVWD
orientacin diversas aproximaciones relacionadas con el manejo de la informa-
cin referida al estmulo que potencialmente puede desencadenar una emocin,
as como toda aquella informacin procedente de la experiencia de una persona,
entre la que merece especial relevancia aquella que tiene que ver con las creencias,
los juicios, los valores, las expectativas, el afrontamiento, el etiquetado, etc., que
GHWHUPLQDUiODFXDOLGDGHPRFLRQDO/RVPRGHORVTXHKDQVHUYLGRGHEDVHSDUDOR
TXH SRVWHULRUPHQWH VHUi \ VLJXH VLHQGR XQD GH ODV YHUWLHQWHV PiV SURGXFWLYDV
de la psicologa experimental, y de la psicologa de la emocin en particular, son
GLYHUVRV(QWUHORVPLVPRVVHHQFXHQWUDQODVWHRUtDVSVLFRGLQiPLFDVHQFDEH]DGD
por la teora psicoanaltica, las teoras de evaluacin-valoracin, y las teoras que
dan primaca a un proceso respecto al otro.

7HRUtDSVLFRDQDOtWLFD
/RVHVFULWRVGH)UHXGUHSUHVHQWDQODIXHQWHEiVLFDGHORVWUDEDMRVSVLFRDQDOtWLFRV
FHQWUDGRVHQODVHPRFLRQHV$OJXQRVDXWRUHV /\RQV GHHQGHQTXH)UHXG
QXQFDDERUGyGLUHFWDPHQWHHOWHPDGHODVHPRFLRQHVHQVt7UDWyDOJXQRVIDFWRUHV
afectivos, como la ansiedad, y siempre con connotaciones de tratamiento o psico-
terapia. En su obra habla de afecto, para referirse a lo que actualmente podemos
sealar como emociones, haciendo que, como mucho, pueda sugerirse la existencia
de una dimensin subjetiva o sentimiento de la emocin. Creemos que, en alguna
PHGLGD)UHXGVHUHULyGHIRUPDFODUDDGHWHUPLQDGDVFDUDFWHUtVWLFDVHPRFLRQDOHV
de inters, proponiendo que el afecto comprende, por una parte, ciertas inervacio-
nes motoras o descargas, y, por otra parte, ciertos sentimientos. Estos ltimos son
GHGRVWLSRVSHUFHSFLRQHVGHODVDFFLRQHVPRWRUDVTXHVHKDQSURGXFLGR HQFLHUWD
PHGLGDUHFXHUGDEDVWDQWHDODWHRUtDGH-DPHV \VHQWLPLHQWRVGLUHFWRVGHSODFHU
\ GLVSODFHU TXH FRQHUHQ D OD HPRFLyQ XQD QRWD FDUDFWHUtVWLFD 3DUD )UHXG ODV
HPRFLRQHVSRGUtDQVHUFRQVLGHUDGDVFRPRODUHDFFLyQDVXFHVRVWUDXPiWLFRVTXH
no es necesario hayan acaecido al sujeto en cuestin, sino que simplemente forman
SDUWHGHVXEDJDMHKHUHGDGRLQFRQVFLHQWH\UHSULPLGR/DDSRUWDFLyQGH)UHXGDO
campo de la emocin se fundamenta en el papel que juega el inconsciente, propo-
QLHQGRTXHODHPRFLyQDOLJXDOTXHPXFKRVHYHQWRVPHQWDOHVSXHGHVHUORFDOL]DGD
en dicho nivel psquico, lo cual no impide que siga ejerciendo ciertos efectos sobre
OD SHUVRQD LQX\HQGR VREUH ODV GLVWLQWDV PDQLIHVWDFLRQHV FRQGXFWXDOHV TXH HVWD
OOHYDDFDER(VWHWLSRGHSURSXHVWDVFRQGXFHDTXHHOSURSLR)UHXG  
sugiera que lo que tienen que investigar los psiclogos para conocer la emocin se
HQFXHQWUDHQHOLQFRQVFLHQWH)UHXGHQXQFLyGRVWHRUtDVVREUHODSHUVRQDOLGDG(Q
la primera de ellas habla de consciente, preconsciente e inconsciente SDUD PiV
WDUGHSURSRQHUVXIRUPXODFLyQPiVFRQRFLGDHOello, el \Ry el V~SHU\R. En ambos
PRGHORV)UHXGFRQVLGHUDTXHODVHPRFLRQHVVRQLQFRQVFLHQWHVFDSDFHVGHMXJDUXQ
LPSRUWDQWHSDSHOHQHOHTXLOLEULRSVtTXLFR/DFRQVLGHUDFLyQGHHVWRVWUHVIDFWRUHV
SHUPLWHTXH)UHXGSURSRQJDWUHVYLVLRQHVGLIHUHQWHVGHODHPRFLyQFDGDXQDGH
HOODVEDVDGDHQXQRGHORVWUHVFRPSRQHQWHVUHVHxDGRV  XQDHPRFLyQHVHQVt
PLVPDXQLQVWLQWRRXQLPSXOVRLQQDWRTXHHVHVHQFLDOPHQWHLQFRQVFLHQWH  XQD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 218 Manual de teoras emocionales y motivacionales - UJI
HPRFLyQHVXQLQVWLQWRPiVXQDLGHDFRQORFXDOVHPDQWLHQHQODVFRQQRWDFLRQHV
inconscientes del instinto y se aaden las connotaciones de un objeto consciente;
 XQDHPRFLyQHVXQDIHFWRDOJRSDUHFLGRDOVHQWLPLHQWRTXHHVFRQVFLHQWHDXQ-
que las causas de la misma pueden no serlo.

$OJXQDVRULHQWDFLRQHVDFWXDOHVHQIDWL]DQTXHHOSVLFRDQiOLVLVSXHGHVHUHQWHQGLGR
FRPR XQD FLHQFLD ELROyJLFD 6ODYLQ \ .ULHJPDQ  3ORWNLQ   (Q HVWH
PDUFR GH UHIHUHQFLD HVWRV DXWRUHV GHHQGHQ TXH HO VHU KXPDQR HV XQD FULDWXUD
biolgica, y cada uno de los aspectos relacionados con el modo de funcionar y de
DGDSWDUVHSHUWHQHFHDOiPELWRELROyJLFR/DVHPRFLRQHVUHSUHVHQWDQXQPHFDQLV-
mo vital para entender esta adaptacin.

Desde las formulaciones psicoanalticas, una de las aportaciones que considera-


PRVHVHQFLDOHVHQHOiPELWRGHODHPRFLyQSURFHGHGH&DUO*XVWDY-XQJ(QVX
WHRUtDGHODSHUVRQDOLGDG-XQJ  KDEODGHODVDFWLWXGHVVHJ~QODV
FXDOHVXQVXMHWRSXHGHVHUFRQVLGHUDGRFRPRLQWURYHUWLGR DFWLWXGVXEMHWLYD RH[-
WUDYHUWLGR DFWLWXGREMHWLYD \GHODVIXQFLRQHVTXHVHUHHUHQDORVPRGRVTXH
XWLOL]DQORVVXMHWRVSDUDREWHQHU\SURFHVDUODLQIRUPDFLyQ\SHUPLWHQFODVLFDUD
dichos sujetos segn su peculiar forma de funcionar: por la sensacin, por la intui-
FLyQSRUHOSHQVDPLHQWR\SRUHOVHQWLPLHQWR-XQJ  SODQWHDTXHORVVXMHWRV
XVDQGRVIXQFLRQHVSDUDUHDOL]DUMXLFLRVVREUHHOPXQGRTXHOHVURGHDSHQVDPLHQ-
WR\VHQWLPLHQWR&RQFUHWDPHQWHVHSXHGHSHQVDUVREUHORVHYHQWRV HQXPHUDQGR
FDWHJRUL]DQGRRUJDQL]DQGRDQDOL]DQGR\VLQWHWL]DQGRVXVUHSHUFXVLRQHVVREUHHO
VXMHWR RVHSXHGHVHQWLUKDFLDGLFKRVHYHQWRV MX]JDQGRFRPREXHQDVRPDODV
placenteras o displacenteras, aceptables o inaceptables, las relaciones que puede
HVWDEOHFHUFRQHOORV 7DQWRHOSHQVDPLHQWRFXDQWRHOVHQWLPLHQWRUHSUHVHQWDQIRU-
PDVYiOLGDVSDUDHYDOXDU\YDORUDUORVGDWRVTXHVHREWLHQHQPHGLDQWHODVRWUDVGRV
IXQFLRQHV VHQVDFLyQHLQWXLFLyQ SRUHVDUD]yQHOSHQVDPLHQWR\HOVHQWLPLHQWR
VRQGRVPpWRGRVGLIHUHQWHVGHSURFHVDUODLQIRUPDFLyQ0HGLDQWHHOSHQVDPLHQWR
el sujeto forma conceptos, manipula ideas, evala la veracidad de estas y solucio-
QDSUREOHPDV0HGLDQWHHOVHQWLPLHQWRHOVXMHWRHVWDEOHFHVLDOJRHVEXHQRRPDOR
SDUDVXIXQFLRQDPLHQWR/DSHUVSHFWLYDGH-XQJHVWDEOHFHTXHa ORVVHQWLPLHQWRV
permiten la valoracin de un hecho; b ODVHPRFLRQHVVHFRQVWUX\HQDSDUWLUGH
ORVVHQWLPLHQWRV(QGHQLWLYDVHJ~QODDUJXPHQWDFLyQGH-XQJORVVHQWLPLHQWRV
permiten la ejecucin de constantes valoraciones acerca de los estmulos. Por lo
tanto, la fuente de la emocin es la energa psquica, que se produce a partir del
VHQWLPLHQWR\QRORVSURFHVRVVLROyJLFRVTXHUHSUHVHQWDQXQSDVRLQWHUPHGLR
HQWUHHOVHQWLPLHQWR\ODHPRFLyQ/RVSURFHVRVVLROyJLFRVSXHGHQVHUHQWHQGLGRV
en tanto que precursores directos de la emocin, pero no como su causa.

7HRUtDVGHODHYDOXDFLyQYDORUDFLyQ
/DHYDOXDFLyQ\YDORUDFLyQGHOHVWtPXORVRQXQDSDUWHHVHQFLDOGHOSURFHVRHPR-
FLRQDO\FRQWULEX\HQDLQWHUSUHWDUHOJUDGRGHEHQHFLRRGDxRTXHXQHVWtPXOR
puede causar desencadenando la experiencia subjetiva de la emocin activando la
UHVSXHVWDVLROyJLFD\ODSRVLEOHH[SUHVLyQFRQGXFWXDOGHODHPRFLyQ 3DOPHUR\

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 219 Manual de teoras emocionales y motivacionales - UJI
0HVWUH  $XQTXH SRGHPRV HQFRQWUDU TXH DPERV WpUPLQRV VH XWLOL]DQ GH
forma indiscriminada, consideramos pertinente resear algunos matices entre los
mismos. As, la evaluacin hace referencia al reconocimiento, la ubicacin en una
GHWHUPLQDGDORFDOL]DFLyQGLPHQVLRQDOODPHGLFLyQGHXQHVWtPXORRVLWXDFLyQTXH
DIHFWDDXQLQGLYLGXR/DvaloracinHQFDPELRVHUHHUHDORTXHHVHLQGLYLGXR
HVWLPDRFUHHTXHVHUiVXLQWHUDFFLyQFRQHVHHVWtPXORRDFRQWHFLPLHQWRHVWRHVOD
YDORUDFLyQKDFHUHIHUHQFLDDFyPRFUHHXQLQGLYLGXRTXHOHDIHFWDUiHVHHVWtPXOR
UHSUHVHQWDXQEHQHFLRRXQDSpUGLGD"SRQHHQSHOLJURVXHVWDELOLGDG"VXSRQH
XQFDPELRDXQDVLWXDFLyQPHMRU"RSRUHOFRQWUDULRVXSRQHXQFDPELRDXQD
VLWXDFLyQSHRU"(QODYDORUDFLyQVHLQFOX\HQHFHVDULDPHQWHHOELHQHVWDUHOHTXLOL-
brio, la estabilidad de un individuo. Sin dichos elementos no ha lugar a hablar de
emocin alguna, ya que una emocin ocurre en la medida en la que previamente
se ha llegado a la conclusin de que el estmulo que es evaluado y valorado posee
ODVXFLHQWHFDSDFLGDGFRPRSDUDSURGXFLUHVDGHVHVWDELOL]DFLyQRGHVHTXLOLEULR
en un individuo 3DOPHUR 

Aunque son diversos los planteamientos defendidos para demostrar la importancia


de la evaluacin y la valoracin, hay algunos que son especialmente notables, al
menos si nos atenemos a la repercusin que han tenido en el devenir de los estu-
dios sobre la Emocin.

/DHYDOXDFLyQVLRORJtDFRJQLFLyQ
/RVWUDEDMRVUHDOL]DGRVSRU*UHJRULR0DUDxyQ  VREUHODLQWHUDFFLyQHQWUHOD
UHDFFLyQVLROyJLFD\FRJQLFLyQKDQVLGRIXQGDPHQWDOHVHQHOGHVDUUROORGHSRVWH-
riores orientaciones cognitivistas en el estudio de la emocin. En su experimenta-
cin, tras administrar una inyeccin de epinefrina a un conjunto de sujetos, descu-
EUHTXHHOGHORVPLVPRVGHFtDH[SHULPHQWDUXQDDXWpQWLFDHPRFLyQPLHQWUDV
TXHHOUHVWDQWHGHFtDTXHH[SHULPHQWDEDDOJRSDUHFLGRDXQDHPRFLyQSHUR
VXH[SHULHQFLDHUDPiVIUtD\QRWtSLFDGHORTXHHOORVFRQVLGHUDEDQXQDDXWpQWL-
ca emocin. Descubri que los sujetos que haban informado tener una autntica
experiencia emocional tenan un motivo para dicha experiencia al experimentar,
SUHYLDPHQWHSHQVDPLHQWRVUHODFLRQDGRVFRQODWULVWH]DPLHQWUDVVHSURGXFtDQORV
HIHFWRVGHODHSLQHIULQD'HWDOPRGRODDFWLYDFLyQVLROyJLFDSRUVtPLVPDQRHVVX-
FLHQWHSDUDH[SHULPHQWDUXQDHPRFLyQHVQHFHVDULDODLQWHUDFFLyQFRQODFRJQLFLyQ
6LELHQODDFWLYDFLyQVLROyJLFDTXHVHKDEtDSURGXFLGRSRUHIHFWRGHODLQ\HFFLyQGH
epinefrina, es un factor importante en el proceso emocional, no menos importante
UHVXOWDORTXH0DUDxyQGHQRPLQDrazn intelectual, aspecto este que permite la
LQWHUSUHWDFLyQGHORVFDPELRVVLROyJLFRV

$SDUWLUGHODVDSRUWDFLRQHVGH0DUDxyQGHXQDIRUPDEDVWDQWHVLPLODU6FKDFKWHU
 SODQWHDODWHRUtDELIDFWRULDOGHODHPRFLyQHQODTXHHVWDEOHFHTXHORV
HVWDGRV HPRFLRQDOHV HVWiQ GHWHUPLQDGRV SULQFLSDOPHQWH SRU IDFWRUHV FRJQLWLYRV
\VLROyJLFRV 6HJ~Q6FKDFKWHU  \6FKDFKWHU\6LQJHU
 FXDOTXLHUHVWDGRHPRFLRQDOHVHOUHVXOWDGRGHGRVIDFWRUHVSRUXQD
SDUWHHODURXVDORDFWLYDFLyQVLROyJLFD\SRURWUDSDUWHORVDVSHFWRVFRJQLWLYRV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 220 Manual de teoras emocionales y motivacionales - UJI
UHODFLRQDGRVFRQODVFDXVDVDPELHQWDOHVGHGLFKDDFWLYDFLyQVLROyJLFD /RVGRV
IDFWRUHVVRQQHFHVDULRVSDUDTXHVHSURGX]FDODHPRFLyQGHWDOVXHUWHTXHFDGD
uno de ellos, individualmente, no puede originar la emocin. 7DOFRPRSODQWHDHO
SURSLR6FKDFKWHU  HOVXMHWRFXDQGRH[SHULPHQWDVXDFWLYDFLyQVLROyJLFD
EXVFDODUD]yQGHODPLVPDPHGLDQWHXQDDWULEXFLyQFDXVDOHQVXPHGLRDPELHQWH
externo. /DSHUFHSFLyQGHODDFWLYDFLyQRDURXVDOHVSUHYLDDOSURFHVRGHDWULEX-
cin, haciendo que la emocin adquiera la caracterstica de la intensidad en cierta
medida, se trata de una argumentacin al estilo de James.

/RVFOiVLFRVWUDEDMRVGH0DUDxyQ  \GH6FKDFKWHU\6LQJHU  GHPXHV-


WUDQTXHODDFWLYDFLyQVLROyJLFD\ORVIDFWRUHVFRJQLWLYRVSXHGHQRFXUULUGHIRUPD
LQGHSHQGLHQWHDXQTXHHQDXVHQFLDGHODDFWLYDFLyQVLROyJLFDORVIDFWRUHVFRJ-
QLWLYRVSRUVtVRORVVRQLQVXFLHQWHVSDUDTXHODH[SHULHQFLDGHODHPRFLyQUHVXOWH
completa.

'HPRGRJHQHUDOHOPRGHORSODQWHDGRSRU0DUDxyQ\SRU6FKDFKWHUSXHGHVHU
considerado como una combinacin de las aportaciones de James y de Cannon.
$KRUDELHQODWHRUtDGH6FKDFKWHUGHIRUPDSDUWLFXODUYDPiVDOOiGHODVWHRUtDV
GH-DPHV\&DQQRQHQWDQWRTXHSODQWHDTXHORVFDPELRVVLROyJLFRV\ORVIDF-
tores cognitivos son necesarios para la experiencia de la emocin. Para Schachter
 VHUtDPX\GLItFLOFRQVLGHUDUODHPRFLyQVRORFRPRORVFDPELRVYLVFHUDOHV
o perifricos; es necesario considerar tambin el componente cognitivo. Aqu es
GRQGHPiVVHYHODLQXHQFLDGH0DUDxyQSXHV6FKDFKWHUGHHQGHTXHORVFDP-
ELRV VLROyJLFRV SRU Vt VRORV QR VRQ VXFLHQWHV SDUD LQLFLDU OD H[SHULHQFLD GH
XQDHPRFLyQ/RVFDPELRVVLROyJLFRVKDQGHVHUH[SOLFDGRVHLQWHUSUHWDGRV\
cuando ocurren, el sujeto experimenta una emocin particular, o cualquier otro
HVWDGRQRHPRFLRQDO/DVHFXHQFLDFDXVDOHQODIRUPXODFLyQGH6FKDFKWHUHVOD
siguiente: estmulo, cambios corporales, percepcin de los cambios corporales,
interpretacin de los cambios corporales, emocin; como se aprecia, es una espe-
FLFDFLyQFRJQLWLYLVWDGHODWHRUtDGH-DPHV/DGLIHUHQFLDHQWUH-DPHV\6FKDFKWHU
VHFHQWUDHQTXHSDUDDTXHOORVFDPELRVVLROyJLFRVRFRUSRUDOHV\DSRVHHQVX
SURSLRUyWXORHPRFLRQDO DXQTXH-DPHVQRH[SOLFDTXpVXFHGHHQWUHODRFXUUHQFLD
GHORVFDPELRVFRUSRUDOHV\ODH[SHULHQFLDVXEMHWLYDGHODHPRFLyQ PLHQWUDVTXH
para Schachter, se requiere alguna forma de cognicin que interprete esos cambios
VLROyJLFRV HVWR HV 6FKDFKWHU LQGLFD TXH OR TXH RFXUUH HQWUH ORV FDPELRV FRU-
porales y la experiencia subjetiva de la emocin es un proceso de evaluacin de
GLFKRVFDPELRVFRUSRUDOHV 7UDVHVHSURFHVRGHFRJQLFLyQHOVXMHWRSRQHUyWXOR
a la emocin.

7HRUtDVGHODYDORUDFLyQ
/DHVHQFLDGHORVSODQWHDPLHQWRVFRJQLWLYLVWDVHQHOHVWXGLRGHODHPRFLyQVHFHQ-
tra en la idea de que, para conocer las emociones, es imprescindible conocer pre-
YLDPHQWHFyPRUHDOL]DQODVSHUVRQDVVXVMXLFLRVDFHUFDGHODPELHQWHHQHOTXHYLYHQ
ya que las emociones se producen como consecuencia de los juicios acerca del
mundo. Es decir: las emociones requieren pensamientos previos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 221 Manual de teoras emocionales y motivacionales - UJI
&RQODVDSRUWDFLRQHVGH0DJGD$UQROGVHSXHGHFRPHQ]DUDKDEODUGHODDSUR[L-
PDFLyQ FRJQLWLYLVWD PRGHUQD HQ HO HVWXGLR GH ODV HPRFLRQHV )XH TXLHQ SULPH-
ro expuso, de una forma detallada en dos volmenes, las investigaciones previas
UHODFLRQDGDV FRQ ORV DVSHFWRV SVLFROyJLFRV $UQROG  D  \ QHXURVLROyJLFRV
$UQROGE GHODHPRFLyQSODQWHDQGRWDPELpQVXSURSLDWHRUtDHQWpUPLQRVGH
relevancia de la valoracin para entender la ocurrencia de las emociones.

Como factor cognitivo, la valoracin hace referencia a una especie de constructo


que nos permite obtener cierta informacin acerca de un estmulo o situacin en tr-
PLQRVGHFXDQEXHQRRPDORHVSDUDQRVRWURV6HJ~Q$UQROG  FXDOTXLHUFRVD
FRQODTXHVHHQFXHQWUDHOVXMHWRWDQWRLQWHUQD UHFXHUGR\RLPDJLQDFLyQ FRPR
H[WHUQDPHQWHHVHYDOXDGD\YDORUDGDGHIRUPDDXWRPiWLFD/DYDORUDFLyQFRPSOH-
menta la percepcin del sujeto, produciendo una tendencia a hacer algo: cuando
esta tendencia es fuerte, se denomina emocin. eVDHVODLGHDGH$UQROG D
E TXHVLQYDORUDFLyQ appraisal QRHVSRVLEOHODHPRFLyQ3DUDIUDVHDQGRD
$UQROG3DUDTXHRFXUUDXQDHPRFLyQHOHVWtPXORGHEHVHUYDORUDGRFRPRDOJR
que me afecta de algn modo, que me afecta personalmente como individuo, con
PLH[SHULHQFLDSDUWLFXODU\PLVPHWDVSDUWLFXODUHV $UQROGDS  Para
esta autora, la secuencia de eventos en el proceso emocional es la siguiente: percep-
cin, appraisalHPRFLyQ$GHPiVLQWHQWDGLVWLQJXLUHQWUHHPRFLyQ\VHQWLPLHQWRV
/DVHPRFLRQHVVHGHULYDQGHODYDORUDFLyQSRVLWLYDRQHJDWLYDGHORVREMHWRVSHU-
cibidos o imaginados, mientras que los sentimientos se derivan de la consideracin
EHQHFLRVDRSHUMXGLFLDOTXHWLHQHSDUDHOVXMHWRODYDORUDFLyQUHDOL]DGD$GHPiV
de la relevancia de la valoracin en el momento en el que ocurre un evento, Arnold
FRQVLGHUDTXHWDPELpQHVQHFHVDULRLGHQWLFDUODDFWLYDFLyQVLROyJLFDHVQHFHVD-
ria la actividad cognitiva para interpretar dichos cambios. Es decir, si conocemos
TXpHVWiRFXUULHQGRVLROyJLFDPHQWHGHVGHTXHVHSURGXFHODSHUFHSFLyQKDVWDTXH
HPSLH]DODHPRFLyQVHSRGUiFRQRFHUPHMRUODHPRFLyQ

(QORVWUDEDMRVTXHOOHYyDFDERHQODGpFDGDGHORVVHWHQWD $UQROG VHRE-


VHUYDODLQXHQFLDGHDXWRUHVTXHKDQHVWXGLDGRODHPRFLyQGHVGHXQDYHUWLHQWH-
siolgica. Concretamente, en la teora de Arnold son importantes los planteamien-
WRVHQWUHRWURVDXWRUHVGH0DF/HDQ  HQORVTXHVHGHHQGHODH[LVWHQFLDGH
tres cerebros, o tres niveles de funciones cerebrales, el reptiliano, el paleomamfe-
ro y el neomamfero. As, Arnold considera que el sistema lmbico, el hipocampo y
HOFHUHEHORVRQHVWUXFWXUDVLPSRUWDQWHVSDUDHQWHQGHUODHPRFLyQ<SRURWURODGR
aunque critic los planteamientos de Darwin y de James, en su obra tambin se
GHWHFWDQLQXHQFLDVGHDPERVDXWRUHV'H'DUZLQSRVWXODTXHODVHPRFLRQHVKDQ
GHVHUFRQVLGHUDGDVFRPRXQLPSXOVRSDUDODDFFLyQJDUDQWL]DQGRGHHVWHPRGR
OD VXSHUYLYHQFLD \ DGDSWDFLyQ &RPR LQXHQFLD GH-DPHV$UQROGFUHHTXHFDGD
HPRFLyQSRVHHXQSDWUyQHVSHFtFRGHUHVSXHVWDVLROyJLFD$UQROG DE 
GHHQGHVXWHRUtDSODQWHDQGRTXHODHPRFLyQHVXQDWHQGHQFLDVHQWLGDTXHOOHYDD
una persona a aproximarse a lo que es bueno, a evitar lo que es malo y a ignorar lo
TXHHVLQGLIHUHQWH HOVLVWHPDOtPELFRVHUtDODHVWUXFWXUDTXHFRQWURODHVWDGLPHQ-
VLyQGHDJUDGRGHVDJUDGR 0iVHVSHFtFDPHQWH$UQROGVXJLHUHTXHORVHYHQWRVR
situaciones son valorados como buenos o malos para un organismo a partir de tres
HMHVEHQHFLRVRSHUMXGLFLDOSUHVHQFLDDXVHQFLDGHDOJ~QREMHWRHYHQWRFRQFUHWR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 222 Manual de teoras emocionales y motivacionales - UJI
TXHHVWiVLHQGRYDORUDGR\TXHHVHOTXHSRWHQFLDOPHQWHGHVHQFDGHQDUiODHPR-
FLyQVLDVtFRQFOX\HHOSURFHVRGHYDORUDFLyQ\GLFXOWDGSDUDDSUR[LPDUVHR
HYLWDUHVHREMHWR/DVDSRUWDFLRQHVGH$UQROGVHUiQDVXPLGDVSRU5LFKDUG/D]DUXV
TXLHQSXHGHVHUFRQVLGHUDGRVXVHJXLGRUPiVGLUHFWR

(QHIHFWR/D]DUXV  KDSODQWHDGRODLPSRUWDQFLDGHODYDORUD-


cin cognitiva para entender la ocurrencia de una emocin. Para que una persona
experimente una emocin, el primer paso de la secuencia procesal es la valora-
FLyQFRJQLWLYDGHODVLWXDFLyQ /D]DUXV.DQQHU\)RONPDQ 6HJ~Q/D]DUXV
 H[LVWHQWUHVIRUPDVGHYDORUDFLyQa SULPDULDTXHVHUHHUHDODGHFLVLyQ
GHO VXMHWR VREUH ODV FRQVHFXHQFLDV TXH WHQGUiQ VREUH VX ELHQHVWDU ORV HVWtPXORV
que le afectan; estas consecuencias pueden ser positivas, negativas o irrelevantes;
b VHFXQGDULDTXHVHUHHUHDODGHFLVLyQGHOVXMHWRDFHUFDGHORTXHGHEHRSXHGH
hacer tras la evaluacin de la situacin; es decir, la capacidad para controlar las
consecuencias del evento; c UHYDORUDFLyQTXHVHUHHUHDODFRQVWDQWHHYDOXDFLyQ
que debe hacer el sujeto en su proceso interactivo con el ambiente; esto es, la cons-
WDWDFLyQGHORVUHVXOWDGRVREWHQLGRVFRQODVYDORUDFLRQHVSULPDULD\VHFXQGDULD/D
LQFOXVLyQGHHVWDWHUFHUDIRUPDGHYDORUDFLyQUHHMDODVFRQQRWDFLRQHVGLQiPLFDV
del proceso de valoracin. En este marco terico, los sucesivos procesos de valo-
UDFLyQGHWHUPLQDQTXpHPRFLRQHVVHQWLUiHOVXMHWR/RVLQGLFLRVGHODH[LVWHQFLDGH
una emocin, aunque no se encuentran siempre en sincrona, son los siguientes:
DVSHFWRVVXEMHWLYRVDVSHFWRVVLROyJLFRVHLPSXOVRVGHDFFLyQ

6LODYDORUDFLyQ DSSUDLVDO HVLPSRUWDQWHHQODWHRUtDGH/D]DUXVFRPRPRPHQWR


previo y necesario en la ocurrencia de un proceso emocional u otro, o ninguno,
QR HV PHQRV LPSRUWDQWH HO DIURQWDPLHQWR FRSLQJ  HQ HO GHVDUUROOR GHO SURFHVR
HPRFLRQDO (O DIURQWDPLHQWR IXH GHQLGR SRU /D]DUXV \ )RONPDQ   
FRPRDTXHOORVHVIXHU]RVFRJQLWLYRV\FRQGXFWXDOHVFRQVWDQWHPHQWHFDPELDQWHV
TXHVHGHVDUUROODQSDUDPDQHMDUODVGHPDQGDVHVSHFtFDVH[WHUQDVRLQWHUQDVTXH
son evaluadas como excedentes o desbordantes de los recursos de la persona. En
HVWHVHQWLGRVHFRQVLGHUDHODIURQWDPLHQWRFRPRDOJRGLQiPLFRHQODLQWHUDFFLyQ
entre la persona y el entorno. Segn cmo sea el afrontamiento, se puede cambiar
SRUFRPSOHWRODVLJQLFDFLyQTXHWLHQHSDUDHOELHQHVWDUGHOVXMHWRORTXHHVWiRFX-
UULHQGR(VWDVLJQLFDFLyQSXHGHVHUFDPELDGDGHGRVIRUPDVSRUXQDSDUWHPH-
diante acciones que alteran los trminos y condiciones actuales en la relacin entre
la persona y el ambiente, y, por otra parte, mediante la actividad cognitiva que in-
X\HHQHOGHVSOD]DPLHQWRHQODHYLWDFLyQRHQODVLJQLFDFLyQGHODVLWXDFLyQTXH
RULJLQDHOSUREOHPD/DSULPHUDIRUPDGHFDPELDUODVLJQLFDFLyQODTXHVHUHHUH
DODVDFFLRQHVVHGHQRPLQDDIURQWDPLHQWRFHQWUDGRHQHOSUREOHPDRVLWXDFLyQ/D
VHJXQGDIRUPDGHFDPELDUODVLJQLFDFLyQODTXHVHUHHUHDODDFWLYLGDGFRJQLWL-
YDVHGHQRPLQDDIURQWDPLHQWRFHQWUDGRHQODHPRFLyQPiVFRP~QPHQWHGHQRPL-
nado afrontamiento cognitivo, ya que, para el autor, el afrontamiento centrado en
ODHPRFLyQHVXQSURFHVRHVHQFLDOPHQWHFRJQLWLYR(QGHQLWLYDODDUJXPHQWDFLyQ
GH/D]DUXVGHHQGHTXHORVIDFWRUHVFRJQLWLYRVGHEHQSUHFHGHUDODHPRFLyQ

&RQ HVRV GRV DQWHFHGHQWHV 0DJGD$UQROG \ 5LFKDUG /D]DUXV  KDQ VXUJLGR GL-
versas aproximaciones basadas en la importancia de la valoracin, todas ellas con

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 223 Manual de teoras emocionales y motivacionales - UJI
el denominador comn de los procesos cognitivos antecediendo a la ocurrencia
de una emocin, de tal forma que las emociones ocurren porque el resultado de
OD YDORUDFLyQ UHDOL]DGD LQGLFD TXH HO HYHQWR R VLWXDFLyQ HV VLJQLFDWLYR SDUD HO
ELHQHVWDURHTXLOLEULRGHORUJDQLVPRHQFXHVWLyQ :HLQHU(OOVZRUWK
5RVHPDQ5RVHPDQ$QWRQLRX\-RVH 6LGLFKRHTXLOLEULRVHYH
DPHQD]DGRODSHUVRQDSXHGHHPSOHDUGLYHUVDVHVWUDWHJLDVFRPRODUHYDORUDFLyQ
SDUDUHFXSHUDUODHVWDELOLGDG 9RORNQRY\'HPDUHH 8QDGHODVOtQHDVGH
LQYHVWLJDFLyQTXHPiVIUXWRVHVWiDSRUWDQGRHQODDFWXDOLGDGHVSUHFLVDPHQWHOD
que se deriva de la solucin propuesta al problema de la relacin existente entre
procesos afectivos y procesos cognitivos, abogando, en ltima instancia, por una
FRQWLQXDLQWHUDFFLyQHQWUHDPERVWLSRVGHSURFHVRV /D]DUXV 

3UHGRPLQLRFRJQLFLyQHPRFLyQ
Aunque son diversos los autores que han defendido la primaca, e incluso la inde-
pendencia, de los procesos cognitivos/afectivos, en este apartado nos remitiremos
solo a algunos de ellos, ya que consideramos que su aportacin ha sido importante
en un momento concreto del desarrollo de la psicologa de la emocin y por la
importante repercusin que siguen teniendo en la actualidad, haciendo necesaria
VXUHIHUHQFLDSDUDHQWHQGHUHOIXWXURPiVLQPHGLDWR

(Q OD WHRUtD GH 0DQGOHU TXHGD SDWHQWH TXH OD HPRFLyQ FRQVWD GH WUHV DVSHFWRV
DFWLYDFLyQ LQWHUSUHWDFLyQ FRJQLWLYD \ FRQVFLHQFLD /D DFWLYDFLyQ TXH VXHOH VHU
indiferenciada, hace referencia a la actividad en el sistema nervioso autonmico,
SDUWLFXODUPHQWHHQODUDPDVLPSiWLFDGHOPLVPR/DH[SHULHQFLDGHODHPRFLyQ\
la conducta emocional son el resultado de la interaccin entre la activacin auto-
QyPLFD\ODLQWHUSUHWDFLyQ\YDORUDFLyQFRJQLWLYDV/DDFWLYDFLyQSURSRUFLRQDOD
intensidad de la emocin, mientras que la interpretacin y valoracin cognitivas
proporcionan la cualidad de la emocin. A partir de la activacin y la interpreta-
cin-valoracin cognitivas, se produce la consciencia emocional. Es decir, la acti-
YDFLyQGHOVLVWHPDQHUYLRVRVLPSiWLFRHVHOLQLFLRGHORVSURFHVRVHPRFLRQDOHV(O
DQiOLVLVGHHVDDFWLYDFLyQSURSRUFLRQDODFXDOLGDGHPRFLRQDO/XHJRHOUHVXOWDGR
de la valoracin produce la consciencia y respuesta emocionales. En suma, la teo-
UtDGH0DQGOHULQFOX\Ha ORVHVWtPXORVGHODPELHQWHb XQVLVWHPDHVWUXFWXUDGR
que interpreta tales estmulos; c GRVVLVWHPDVGHUHVSXHVWDXQRTXHVHUHHMDHQOD
DFFLyQ\RWURTXHORKDFHDWUDYpVGHODDFWLYDFLyQVLROyJLFDHVWD~OWLPDFRQGRV
IXQFLRQHVHVHQFLDOHVODKRPHRVWDVLV\ODE~VTXHGDGHLQIRUPDFLyQ XQVLVWHPD
de feedback, que permite la percepcin de la activacin y el control de la accin.

$Vt SXHV SDUD 0DQGOHU   OD FRJQLFLyQ SDUHFH MXJDU XQ GREOH SDSHO HQ OD
emocin. En primer lugar, los factores cognitivos pueden ser considerados como
elicitadores de un estado emocional; en segundo lugar, como una accin interpretati-
va y valorativa. Precisamente, esta funcin valorativa determina la cualidad emocional
H[SHULPHQWDGDSRUHOVXMHWR(QXQRGHORV~OWLPRVWUDEDMRV0DQGOHU  SURSR-
na un modelo cognitivo para el estudio del estrs, que recuerda bastante algunos
DUJXPHQWRVGH 6HO\H    SXHV HQIDWL]DOD LGHDGH TXH ODV HPRFLRQHV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 224 Manual de teoras emocionales y motivacionales - UJI
cuando son intensas, restringen el campo atencional del sujeto, pudiendo tambin
interferir en los procesos cognitivos. Como se puede apreciar, estudiando la rela-
FLyQHQWUHODFRJQLFLyQ\ODHPRFLyQ0DQGOHUGDSULRULGDGSURFHVDODODGLPHQVLyQ
cognitiva.

6LHQGRLPSRUWDQWHODDUJXPHQWDFLyQGH0DQGOHUTXLHQDQXHVWURMXLFLRGHIRUPD
PiVFODUDKDGHIHQGLGRODSULPDFtDGHODFRJQLFLyQVREUHODHPRFLyQKDVLGR/D]D-
UXVTXLHQVXJLHUHODSHUWLQHQFLDGHGLVWLQJXLUHQWUHLQIRUPDFLyQ\YDORUDFLyQ
6LELHQODLQIRUPDFLyQVHUHHUHDODVFDUDFWHUtVWLFDVTXHGHQHQDXQHVWtPXORR
VLWXDFLyQODYDORUDFLyQVHUHHUHDODVLJQLFDFLyQTXHGLFKDLQIRUPDFLyQSRVHH
para la integridad y el bienestar de la persona que percibe ese estmulo o situacin.
El objetivo de la valoracin cognitiva consiste en hacer congruentes dos aspectos
en ocasiones contradictorios: por una parte, las metas y creencias que posee la per-
VRQDUHVSHFWRDODPELHQWH\SRURWUDSDUWHODSURSLDUHDOLGDGDPELHQWDOTXHDIHFWDUi
al resultado de la interaccin entre persona y ambiente. Parece evidente, entonces, que
la mayor probabilidad de adaptacin se encuentra en el mayor ajuste entre la realidad
ambiental y la percepcin que la persona posee del ambiente.

(OKHFKRGHDUPDUTXHODVFRVDVVRQFRPRXQDSHUVRQDODVSHUFLEHSHUPLWH
HQIDWL]DUODGLPHQVLyQFRJQLWLYDHQODVLQWHUDFFLRQHVTXHXQDSHUVRQDOOHYDDFDER
FRQVXDPELHQWHFRQORFXDOVHHVWiGHIHQGLHQGRTXHHQORVSURFHVRVHPRFLRQDOHV
tiene que existir alguna suerte de procesamiento cognitivo previo que antecede, e
incluso condiciona y determina, la aparicin de una emocin. Ahora bien, desde
un punto de vista adaptativo, es imprescindible que dicha percepcin se ajuste lo
Pi[LPRDODQDWXUDOH]DUHDOGHODVFRVDVSRUTXHDXQTXHODVFRVDVsean para una de-
terminada persona tal como dicha persona las percibe, las cosas siguen siendo como
son.

Por lo que respecta a la primaca de la emocin sobre la cognicin, uno de los


Pi[LPRVGHIHQVRUHVKDVLGR=DMRQF  TXLHQFODUDPHQWHHQIUHQWDGR
DODSURSXHVWDGH/D]DUXVSLHQVDTXHODHPRFLyQHVLQGHSHQGLHQWHGHODFRJQL-
cin, pudiendo ocurrir antes que cualquier forma de cognicin. /DSURSXHVWDGH
=DMRQF =DMRQF\0DUNXV VHFHQWUDHQHOKHFKRGHTXHDXQTXHHQPXFKDV
ocasiones la cognicin se encuentra asociada con la emocin, esta puede ocurrir
sin cognicin. (Q FXDOTXLHU FDVR HQIDWL]D =DMRQF OD HPRFLyQ RFXUUH DQWHV TXH
cualquier forma de procesamiento cognitivo. Algunos aspectos caractersticos de
ODIRUPXODFLyQGH=DMRQF  SRQHQGHUHOLHYHTXHa ODHPRFLyQHVXQSURFHVR
EiVLFRHVDOJRXQLYHUVDOHQWUHWRGDVODVHVSHFLHVDQLPDOHVb ODVHPRFLRQHVVRQ
inevitables; simplemente ocurren, tanto si quiere el sujeto como si no; c ODVHPR-
FLRQHVVRQGLItFLOHVGHDOWHUDUXQDYH]RFXUUHXQDHPRFLyQVHSURGXFHXQDVyOLGD
asociacin con la situacin que la desencadena; como las reacciones emociona-
OHVQRUHVSRQGHQDORVDUJXPHQWRVOyJLFRVGLItFLOPHQWHORJUDUHPRVPRGLFDUODV
d ODVUHDFFLRQHVHPRFLRQDOHVVRQGLItFLOHVGHYHUEDOL]DUFRQFUHWDPHQWHSDUHFH
que la comunicacin de las emociones encuentra su principal medio a travs de los
OHQJXDMHVQRYHUEDOHV IXQGDPHQWDOPHQWHODH[SUHVLyQ (Q~OWLPDLQVWDQFLD=DMRQF
establece que los procesos emocionales se encuentran fuera por lo tanto, son inde-
SHQGLHQWHVGHORVSURFHVRVFRJQLWLYRV&RPRLQGLFD,]DUG  ODSULPDFtDGH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 225 Manual de teoras emocionales y motivacionales - UJI
la emocin en la evolucin parece clara, ya que el desarrollo evolutivo depende en
gran medida de la expresin emocional, y a ciertas edades los procesos represen-
WDWLYRVDVtFRPRORVHYDOXDWLYRV\YDORUDWLYRVWRGDYtDQRHVWiQORVXFLHQWHPHQWH
desarrollados. Es este el caso del apego en los infantes de muchas especies.

/RVHVWXGLRVGH%RZHU  DFHUFDGHODUHODFLyQHQWUHFRJQLFLyQ\HPR-


cin indican que una variable afectiva como el humor o estado afectivo parece
WHQHUXQDSRGHURVDLQXHQFLDVREUHORVSURFHVRVFRJQLWLYRVLQFOX\HQGRODPHPR-
ria, el pensamiento y la percepcin social. 6HJ~QVXWHRUtD %RZHU\&RKHQ 
se puede hablar de una memoria dependiente del estado/DLQIRUPDFLyQTXHVH
adquiere durante un estado emocional particular se recuerda con mayor facilidad
FXDQGRHOVXMHWRVHHQFXHQWUDHQXQHVWDGRHPRFLRQDOVHPHMDQWH$GHPiVFXDQGR
HOVXMHWRVHHQFXHQWUDHQXQHVWDGRHPRFLRQDOSDUWLFXODUWLHQGHDIRFDOL]DUVXDWHQ-
FLyQVREUHDTXHOORVHYHQWRVDQHVFRQVXHVWDGR([LVWHSRUWDQWRXQOWURVHOHFWL-
vo para la informacin que el sujeto adquiere. Es un planteamiento muy atractivo,
que en la actualidad sigue siendo una de las importantes lneas de investigacin.

(OQXHYRPRGHORFRJQLWLYLVWD
/DVLWXDFLyQDFWXDOHQHOHVWXGLRGHODHPRFLyQHVEDVWDQWHSDUDGyMLFD6RUSUHQGH
descubrir cmo en las modernas formulaciones tericas en torno a la emocin se
sigue debatiendo acerca de la pertinencia de considerar los tres procesos crticos
FRJQLFLyQDIHFWR\PRWLYDFLyQFRPRHQWLGDGHVLQGHSHQGLHQWHV DUJXPHQWRSOD-
WyQLFR RFRPRHQWLGDGHVLQWHUGHSHQGLHQWHVHLQWHUUHODFLRQDGDV DUJXPHQWRDULVWR-
WpOLFR 7DPELpQHVSHUWLQHQWHUHVHxDUFyPRODVFOiVLFDVDSRUWDFLRQHVGH'HVFDUWHV
VRQ REMHWR GH GHEDWH HQ OD DFWXDOLGDG /D SRVWXUD GXDOLVWD GH 'HVFDUWHV KD VLGR
PLQXFLRVDPHQWHUHYLVDGDSRU'DPDVLR  FRQVLGHUDQGRORVSXQWRVGp-
ELOHVGHGLFKDIRUPXODFLyQ/DYLJHQFLDGHODVIRUPXODFLRQHVFOiVLFDVHQQXHVWURV
das se torna muy tangible cuando observamos que, de nuevo, se discute acerca
de la pertinencia de estudiar la emocin como una disciplina independiente, o si,
SRUHOFRQWUDULRORPiVDSURSLDGRHVFRQVLGHUDUTXHODHPRFLyQVHHQFXHQWUDLQ-
VHSDUDEOHPHQWHXQLGDDODFRJQLFLyQLQFOXVRFRPRLQGLFD/D]DUXV  DOD
cognicin y a la motivacin.

,QWHUDFFLyQDIHFWRFRJQLFLyQ
3DUHFHHYLGHQWHTXHHOPRPHQWRDFWXDOFRPLHQ]DDGHFDQWDUVHSRUODWHQGHQFLD
LQWHUDFFLRQLVWDHQYLUWXGGHODFXDOVHDGPLWHODSUiFWLFDLPSRVLELOLGDGGHVHSDUDU
el afecto de la cognicin. (Q OD H[SRVLFLyQ GH ODV ~OWLPDV LQYHVWLJDFLRQHV HVWi
completamente aceptado que la cognicin es imprescindible para entender cmo
DSDUHFH VH PDQWLHQH \ VH PRGLFD HO DIHFWR SHUR WDPELpQ HVWi SHUIHFWDPHQWH
DFHSWDGRODLPSRUWDQFLDGHODIHFWRSDUDLQXLUHQHOPRGRPHGLDQWHHOTXHVHOOH-
YDQDFDERORVSURFHVRVFRJQLWLYRV/DFDXVDGHHVWDFRQWURYHUVLDSXHGHVHUGHELGD
FRPRKDVHxDODGR/\RQV  en el hecho de que el pensamiento occidental se
ha sentido muy cmodo con la consideracin de la cognicin y el afecto como

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 226 Manual de teoras emocionales y motivacionales - UJI
LQVWDQFLDVVHSDUDGDVFDGDXQDGHHOODVFRQVXSURSLDUHDOLGDG/DGLIHUHQFLDVXEV-
WDQFLDOTXHVXVWHQWDHVWDVSRVWXUDVFRQWUDSXHVWDVHVWiUHODFLRQDGDHQODFRQFHSFLyQ
GHTXpVHHQWLHQGHSRUFRJQLFLyQ 3DOPHUR $XQTXH/D]DUXV  \=D-
MRQF  FRLQFLGHQHQTXHVHUHTXLHUHDOJXQDIRUPDGHLQIRUPDFLyQVHQVRULDO
SDUDTXHVHH[SHULPHQWHODHPRFLyQQRHVWiQGHDFXHUGRHQORTXHVHUHHUHDTXp
FRQVWLWX\HODFRJQLFLyQ/D]DUXVGHQHODFRJQLFLyQHQWpUPLQRVGHFRQRFLPLHQ-
WRSRUHOFRQRFLPLHQWRPLHQWUDVTXH=DMRQFGHQHODFRJQLFLyQHQWpUPLQRVGH
FRQRFLPLHQWRSRUODGHVFULSFLyQ

2WURSRWHQFLDOSXQWRGHGHVDFXHUGRWLHQHTXHYHUFRQODXELFDFLyQGHODHPRFLyQ
HQHOiPELWRJHQHUDOGHODGLVFLSOLQDSVLFROyJLFD(VGHFLUODUHODFLyQ\RLQWHU-
GHSHQGHQFLD GH OD HPRFLyQ UHVSHFWR D RWURV SURFHVRV SVLFROyJLFRV EiVLFRV (Q
este sentido, para muchos autores, el estudio de la emocin puede llevarse a cabo
sin contemplar la vinculacin o asociacin interdependiente de dicho proceso con
RWURVSURFHVRVEiVLFRV (VWHWLSRGHDUJXPHQWRVSURFHGHGHODVFOiVLFDVDSRUWDFLR-
QHVGH3ODWyQ(VWHGHHQGHODLQGHSHQGHQFLDGHODUD]yQ FRJQLFLyQ ODSDVLyQ
HPRFLyQ \HOGHVHRRFRQDFLyQ PRWLYDFLyQ $VtDORODUJRGHORVVLJORV XVIII
y XIX, hubo psiclogos que, interesados en alguno de los tres campos reseados,
DGRSWDURQXQDSRVWXUDLQGLYLGXDOL]DGDGHFDGDXQRGHHOORVJHQHUDQGRJUDQFRQ-
troversia en el seno de la disciplina psicolgica. En cierta medida, es una situacin
TXHVLJXHYLJHQWHDSHVDUGHORVHVIXHU]RVSRUYROYHUDFRQVLGHUDUODFODUDLQWHUDF-
cin entre emocin, motivacin y cognicin.

(QODV~OWLPDVGpFDGDVWUDVYHULFDUHPStULFDPHQWHODLPSRVLELOLGDGGHDEVWUDHU
un funcionamiento cognitivo asptico, sin interferencias afectivas, da la impresin
GH TXH VH GHVFXEUH OD FRQFHSFLyQ LQWHUDFFLRQLVWD DIHFWRFRJQLFLyQ /DV DSRUWD-
FLRQHV PiV UHFLHQWHV GH /D]DUXV   DERJDQ D IDYRU GH OD LQWHUDFFLyQ HQWUH
cognicin, emocin y motivacin, de tal suerte que, segn el autor, no es posible
HQWHQGHUODGLQiPLFDFRQGXFWXDOGHXQVHUKXPDQRVLQFRQVLGHUDUODFRQWLQXDGD
interaccin entre los tres procesos reseados.

5HOHYDQFLDGHODFRJQLFLyQHQHODIHFWR

/DLPSRUWDQFLDGHORVSURFHVRVFRJQLWLYRVHQORVSURFHVRVHPRFLRQDOHV\HQHO
afecto en general, se fundamenta en la delimitacin del proceso de valoracin,
asumiendo que este es una condicin necesaria para que ocurra un proceso emo-
FLRQDO(QODDFWXDOLGDGSDUHFHFRQUPDUVHODUHOHYDQFLDGHODYDORUDFLyQVLJQL-
FDWLYDFRPRSDVRSUHYLR\QHFHVDULRSDUDTXHRFXUUDXQSURFHVRHPRFLRQDO'H
este modo, parece sensato proponer y/o aceptar que los procesos cognitivos se en-
cuentran ntimamente relacionados con los procesos afectivos en general y con los
SURFHVRVHPRFLRQDOHVHQSDUWLFXODU,QYHVWLJDUODLQXHQFLDGHORVGLVWLQWRVSUR-
FHVRVFRQWULEX\HDFRPSUHQGHUFyPRVHGHVHQFDGHQDRUHJXODODHPRFLyQ -XWWD
/LUD\0DWWLKDV 

Es evidente que existe un paso intermedio entre el estmulo y la reaccin que permite
a esa persona responder de un modo particular y no de otro a la ocurrencia de dicho

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 227 Manual de teoras emocionales y motivacionales - UJI
estmulo. A ese paso intermedio le podemos denominar valoracin o cualquier otra
cosa. Dicha valoracin tiene connotaciones de estimacin acerca de la posibilidad,
PiVRPHQRVSUREDEOHGHFDPELRHQHOELHQHVWDURHTXLOLEULRGHODSHUVRQDXRUJD-
QLVPRTXHOOHYDDFDERHODQiOLVLVGHODVLWXDFLyQRHYHQWRTXHOHDIHFWD

No obstante, hay que tener en cuenta algunas caractersticas imprevisibles de la


RFXUUHQFLDGHODVHPRFLRQHV/DLPSUHYLVLELOLGDGXQLGDDODJUDQLQWHQVLGDGFRQ
la que suelen producirse algunas respuestas emocionales, pueden llevar a la duda
GHVLWDPELpQHQHVDVRFDVLRQHVVHHVWiSURGXFLHQGRXQSURFHVRGHYDORUDFLyQ
Una alternativa viable consiste en proponer la existencia de dos vas de ocurren-
FLDGHODYDORUDFLyQWDOFRPRVHH[SRQHHQODVLJXLHQWHWDEOD WDEOD 

Proceso de abajo hacia arriba Proceso de arriba hacia abajo

9tDVGHODYDORUDFLyQ Computada Reinstalada

7LSRVGHFDWHJRUL]DFLyQ Basada en la teora Basada en el prototipo

)RUPDVGHSURFHVDPLHQWR Basado en reglas Asociativo

)XQFLyQFRQGXFWXDO )OH[LELOLGDG Preparada/rgida

7DEOD'REOHYtDHQODRFXUUHQFLDGHODYDORUDFLyQ &ORUH\2UWRQ\

Una de las vas tendra caractersticas de abajo hacia arriba, mientras que la otra
mostrara connotaciones de arriba hacia abajo.

9tDVGHODYDORUDFLyQ

/DYDORUDFLyQOOHYDGDDFDERGHVGHODSHUVSHFWLYDde abajo hacia arriba consiste


HQHODQiOLVLVHLQWHUSUHWDFLyQGHODVLJQLFDFLyQTXHSRVHHQORVHVWtPXORV\VLWXD-
FLRQHVTXHDIHFWDQDXQLQGLYLGXR,PSOLFDODFRPSXWDFLyQRHODQiOLVLVHODERUDGR
GHFDGDXQDGHODVYDULDEOHVTXHFRQJXUDQODVLWXDFLyQFRQVLGHUDQGRODUHOHYDQ-
FLD\ODUHSHUFXVLyQGHFDGDXQDGHHOODV0HGLDQWHHVWHWLSRGHSURFHVRHODQiOLVLV
y valoracin se llevan a cabo sobre eventos o situaciones que se encuentran fuera
GHOLQGLYLGXR\TXHHQFLHUWDPHGLGDUHSUHVHQWDQXQDDPHQD]DSDUDVXSURSLR
HTXLOLEULRFRQVLGHUDQGRODVLJQLFDFLyQTXHSRVHHHVDVLWXDFLyQHQHVHPRPHQWR

/DYDORUDFLyQOOHYDGDDFDERGHVGHODSHUVSHFWLYDde arriba hacia abajo consis-


WHHQODUHLQVWDODFLyQRUHFRQVWUXFFLyQGHYDORUDFLRQHVDQWHULRUHVTXHHQVX
PRPHQWRRFXUULHURQFRPRFRQVHFXHQFLDGHODVLJQLFDFLyQTXHWHQtDQHYHQWRVR
situaciones a las que se tuvo que enfrentar ese individuo. Ahora, cuando aparece
una situacin o estmulo idntico, similar o parecido a aquella situacin pasada,
GHIRUPDDXWRPiWLFDVHreinstala la misma valoracin ocurrida entonces. En este
WLSRGHSURFHVRQRFXHQWDODVLJQLFDFLyQUHDOTXHSRVHHODVLWXDFLyQDFWXDO\D
TXHORYHUGDGHUDPHQWHLPSRUWDQWHHVHOLPSDFWRGHODVLWXDFLyQSDVDGD(ODQiOLVLV
y valoracin se llevan a cabo sobre eventos y situaciones que se encuentran fuera
del individuo, pero, debido a su similitud con una valoracin anterior, de forma

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 228 Manual de teoras emocionales y motivacionales - UJI
DXWRPiWLFDVRQYDORUDGRVVHJ~QHOPLVPRSDWUyQTXHHQODRFDVLyQDQWHULRU Uno de
ORVDQWHFHGHQWHVPiVFODURVGHHVWHWLSRGHDFWLYDFLyQHPRFLRQDOVHHQFXHQWUDHQORV
WUDEDMRVGH)UHXGFXDQGRSURSRQtDTXHODVHPRFLRQHVHVSHFtFDVVHHQFXHQWUDQ
HQUDL]DGDV HQ VLWXDFLRQHV WUDXPiWLFDV RFXUULGDV GXUDQWH OD HWDSD LQIDQWLO LQFOX-
\HQGRHOSURSLRWUDXPDGHOQDFLPLHQWR/DRFXUUHQFLDGHXQDHPRFLyQHQODYLGD
adulta es simplemente la recurrencia de una emocin que tuvo su primera mani-
festacin en un momento concreto del desarrollo infantil.

(Q~OWLPDLQVWDQFLDFRPRVHxDODQ&ORUH\2UWRQ\  WDQWRGDFXiOVHDODIRUPD


mediante la que se lleva a cabo el proceso de valoracin de una situacin o evento
actuales, ya que lo verdaderamente importante es que la emocin ocurre como con-
VHFXHQFLDGHODDFWLYDFLyQGHXQSURFHVRFRJQLWLYRUHODFLRQDGRFRQODVLJQLFDFLyQ
de la situacin. En ambas vas existe un proceso cognitivo previo: la valoracin.

7LSRVGHFDWHJRUL]DFLyQ

(QFLHUWDPHGLGDORVGRVWLSRVGHFDWHJRUL]DFLyQLPSOLFDGRVHQODRFXUUHQFLDGH
XQDHPRFLyQUHHMDQODVGRVIRUPDVTXHJHQHUDOPHQWHKDQVLGRSURSXHVWDVHQORV
DUJXPHQWRVFRJQLWLYLVWDVSRUXQDSDUWHODFDWHJRUL]DFLyQEDVDGDHQHOSURWRWLSRR
EDVDGDHQHOFDVR\SRURWUDSDUWHODFDWHJRUL]DFLyQEDVDGDHQODWHRUtD(QDPEDV
SRVLELOLGDGHVODHPRFLyQRFXUUHFRPRFRQVHFXHQFLDGHODXELFDFLyQORFDOL]DFLyQ
RFDWHJRUL]DFLyQGHXQDVLWXDFLyQFRPRHPRFLRQDOPHQWHVLJQLFDWLYD

/DFDWHJRUL]DFLyQEDVDGDHQHOSURWRWLSRKDFHUHIHUHQFLDDODVLPLOLWXGH[LVWHQWH
entre las caractersticas aparentes de los atributos observables con la de los atribu-
tos del prototipo.

/DFDWHJRUL]DFLyQEDVDGDHQODWHRUtDVHFHQWUDHQODFRQVLGHUDFLyQGHORVDVSHFWRV
subyacentes de la situacin presente, estableciendo en qu medida se cumplen las
FDUDFWHUtVWLFDVGHQLWRULDVLQGHSHQGLHQWHPHQWHGHODVFDUDFWHUtVWLFDVREVHUYDEOHV
$XQTXH OD SULPHUD GH ODV GRV IRUPDV GH FDWHJRUL]DFLyQ HV OD TXH SHUPLWH XQD
WHPSRUDOPHQWHPiVEUHYHGHFLVLyQDFHUFDGHVLODVLWXDFLyQSXHGHVHUFRQVLGHUDGD
FRPRSRWHQFLDOPHQWHVLJQLFDWLYDSDUDODRFXUUHQFLDGHXQDHPRFLyQWDPELpQHV
la que implica una mayor probabilidad de error, pues la apariencia de ciertas ca-
UDFWHUtVWLFDVPDQLHVWDVQRVLJQLFDQHFHVDULDPHQWHODH[LVWHQFLDGHODUHJODTXH
WLSLFDHVDVLWXDFLyQ

)RUPDVGHSURFHVDPLHQWR

/DVIRUPDVGHSURFHVDPLHQWRVRQDVDEHUHODVRFLDWLYR\HOEDVDGRHQUHJODV$
SDUWLUGHOSURFHVDPLHQWRDVRFLDWLYRODVVLWXDFLRQHV\HYHQWRVVRQRUJDQL]DGRV
GHDFXHUGRFRQODVLPLOLWXG\FRQWLJLGDGWHPSRUDOVXEMHWLYDVTXHSRVHHQFRQ
otros eventos que forman parte de la experiencia de un individuo. A partir del
SURFHVDPLHQWREDVDGRHQUHJODVODVLWXDFLyQHVRUJDQL]DGDGHDFXHUGRFRQHVWUXF-
WXUDVVLPEyOLFDV3DUHFHXQKHFKRFRQVWDWDGRTXHHQODDFWLYLGDGGLDULDLQX\HQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 229 Manual de teoras emocionales y motivacionales - UJI
ODVGRVIRUPDVGHSURFHVDPLHQWRDODKRUDGHHQWHQGHUFyPRVRQFDWHJRUL]DGDVODV
situaciones. En ambas posibilidades, la situacin termina siendo considerada por
ODSHUVRQDFRPRHPRFLRQDOPHQWHVLJQLFDWLYDFRQORFXDOHQHOFDVRGHTXHVH
cumplan las condiciones mnimas para la elicitacin, se desencadena de forma
V~ELWD\DXWRPiWLFDODHPRFLyQFRUUHVSRQGLHQWH

)XQFLyQFRQGXFWXDO

En cuanto a las funciones conductuales que generalmente se atribuyen a las emo-


ciones, se puede hablar, por una parte, de la preparacin para la accin inmediata
7RDWHV \SRURWUDSDUWHGHODH[LELOLGDGRYHUVDWLOLGDGDGDSWDWLYDV
6FKHUHU $XQTXHODVGRVIXQFLRQHVFRQGXFWXDOHVVRQUHOHYDQWHVHQ
ocasiones resulta muy difcil combinarlas de forma coherente. En unas situaciones
VHUHTXLHUHXQHODERUDGR\PLQXFLRVRDQiOLVLVPLHQWUDVTXHHQRWUDVORPiVDGDS-
WDWLYRFRQVLVWHHQXQDUHVSXHVWDH[LEOH\YHUViWLO

/DVYHQWDMDVGHULYDGDVGHODIXQFLyQGHSUHSDUDFLyQSDUDODDFFLyQLQPHGLDWDWLH-
nen que ver con el incremento en la velocidad de procesamiento, mientras que los
EHQHFLRVDVRFLDGRVDODIXQFLyQGHH[LELOLGDGVHUHHUHQDODWRPDGHFRQVFLHQ-
FLDUHVSHFWRDODVLJQLFDFLyQGHODVLWXDFLyQ$SDUWLUGHODVGRVUXWDVSURSXHVWDV
para la ocurrencia de la valoracin, parece desprenderse que este proceso se en-
cuentra siempre presente en los procesos emocionales, pudiendo sugerir que se
trata de un paso necesario para que ocurra una emocin.

1RREVWDQWHODPiVUHFLHQWHDSUR[LPDFLyQDOHVWXGLRGHODYDORUDFLyQHQODVHPRFLR-
nes no considera dicho proceso cognitivo como algo exacto, como algo inamovible;
PiVELHQHOSURFHVRGHYDORUDFLyQWLHQHTXHVHUFRQVLGHUDGRFRPRXQSDVRQHFHVD-
ULRHVRVtSDUDODRFXUUHQFLDGHXQDHPRFLyQSHURFRQSRVLELOLGDGGHXFWXDFLyQ
HQORTXHUHVSHFWDDOUHVXOWDGRGHODVLJQLFDFLyQGHSHQGLHQGRGHFXiOHVVHDQODV
FRQGLFLRQHVPRPHQWiQHDVGHODSHUVRQDTXHUHDOL]DODYDORUDFLyQ .DLVHU\:HKUOH
.LUE\\6PLWK3HFFKLQHQGD.DSSDV\6PLWKHQWUHRWURV DVt
FRPRGHODVLQXHQFLDVVRFLRFXOWXUDOHVHVSHFtFDVTXHKDUHFLELGRHVDSHUVRQD\
TXHPDUFDQODVLJQLFDFLyQGHORVHYHQWRVTXHOHDIHFWDQ +DLGW.ROOHU\'LDV
0HVTXLWD)ULMGD\6FKHUHU 

5HOHYDQFLDGHODIHFWRHQODFRJQLFLyQ
A diferencia de los estudios citados en el apartado anterior que concluyen que la
FRJQLFLyQ LQX\H HQ OD HPRFLyQ HQ RWURV WUDEDMRV %RZHU  &DUSL 0HLOiQ
*XHUUHUR*yPH]\3DOPHUR*XHUUHUR*ULVNHYLFLXV6KLRWD\1HXIHOG
 VHSUHWHQGHGHPRVWUDUTXHHODIHFWRLQX\HRPRGXODHOPRGRGHOOHYDUD
FDERHOSURFHVDPLHQWRGHODLQIRUPDFLyQTXHUHFLEHXQRUJDQLVPR'HPRGRPiV
FRQFUHWRORVWUDEDMRVGH%RZHU  FHQWUDGRVHQODUHODFLyQH[LVWHQWHHQWUH
KXPRU\PHPRULDUHSUHVHQWDQXQDGHODVRULHQWDFLRQHVGHLQYHVWLJDFLyQPiVSUR-
ductivas de los ltimos tiempos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 230 Manual de teoras emocionales y motivacionales - UJI
&RPRLQGLFD)RUJDV D HQHOPRPHQWRDFWXDOORVWUDEDMRVHQORVTXHVHWUDWD
GHYHUODFRQH[LyQFRJQLFLyQDIHFWRSHUPLWHQODXWLOL]DFLyQLQGLVWLQWDGHORVWpUPLQRV
afecto, humor y emocin. Es cierto que existen diferencias entre dichos trminos, atri-
buyndosele al afecto la mayor entidad general, de tal suerte que el humor y la emo-
cin seran manifestaciones afectivas particulares. No obstante, hay que recordar
TXHGHORVWUHVWpUPLQRVDORVTXHQRVDFDEDPRVGHUHIHULUHOPiVXWLOL]DGRHQHVWH
tipo de trabajos sigue siendo el humor o estado afectivo actual, ya que su mayor
duracin respecto a la emocin permite una mejor manipulacin experimental a la
KRUDGHYHULFDUVXVHIHFWRVVREUHORVSURFHVRVFRJQLWLYRV(QODHMHFXFLyQH[SH-
rimental se elige aquella variable afectiva que mejor permite la manipulacin y la
YHULFDFLyQGHORVUHVXOWDGRV\HQHVWHFDVRWDOFRPRLQGLFiEDPRVVHWUDWDGHO
HVWDGRDIHFWLYRRKXPRU/RVGLVHxRVPiVXWLOL]DGRVVHKDQFHQWUDGRHQHVWDEOHFHU
la existencia de, por una parte, una memoria dependiente del humor, y, por otra
parte, una memoria congruente con el humor. En ambas posibilidades, como ha
HQIDWL]DGRUHFLHQWHPHQWH)RUJDV  ORYHUGDGHUDPHQWHLPSRUWDQWHHVFRQVWD-
tar que el afecto en general, el humor, o la emocin en particular, no representan
DOJRLQFLGHQWDOHQODYLGD\HQODFRQVWUXFFLyQGHOFRQRFLPLHQWRTXHUHDOL]DXQVHU
humano. El afecto forma parte inseparable del modo en que una persona percibe
el mundo, del modo mediante el cual esa persona almacena, selecciona y recupera
la informacin, y del modo en que esa persona lleva a cabo cualesquiera otras ac-
tividades cognitivas en su vida diaria.

Por lo que respecta a la existencia de una memoria dependiente del humor, se


propone que el rendimiento en tareas de memoria se incrementa cuando el hu-
mor que posee una persona en el momento de recordar coincide con el humor
TXH SRVHtD HQ HO PRPHQWR GH FRGLFDU \ DOPDFHQDU XQ GHWHUPLQDGR PDWHULDO
&RQFUHWDPHQWHVLXQDSHUVRQDH[SHULPHQWDXQKXPRUSDUWLFXODUHVPiVSUREDEOH
que recuerde el material que fue aprendido bajo un estado o humor similar al que
H[SHULPHQWDHQHVWRVPRPHQWRV (LFK 

Por lo que respecta a la existencia de una memoria congruente con el humor, se


plantea que el rendimiento cognitivo de una persona es mayor cuando el material que
WLHQHTXHWUDWDUWDQWRVLWLHQHFRQQRWDFLRQHVGHHQWUDGDFRGLFDFLyQDSUHQGL]DMH
como si tiene connotaciones de salida recuperacin, recuerdo, posee una cualidad
afectiva que coincide con el estado o humor que esa persona posee en ese momento.

/D FRGLFDFLyQ FRQJUXHQWH FRQ HO KXPRU VH GHQH FRPR HO LQFUHPHQWR HQ HO
DSUHQGL]DMHGHDTXHOPDWHULDOTXHSRVHHXQWRQRRFXDOLGDGDIHFWLYDFRQJUXHQWHR
similar al estado o humor que posee una persona en ese momento repercutiendo,
por tanto, en la mejora del rendimiento ya que las asociaciones que se producen
VRQPiVHODERUDGDV

/DUHFXSHUDFLyQFRQJUXHQWHFRQHOKXPRUSXHGHVHUGHQLGDFRPRXQLQFUHPHQWR
en el recuerdo de aquel material que posee un tono afectivo congruente o afn con
el que experimenta la persona en este momento. No obstante, estos efectos son
PiV GLItFLOHV GH HVWDEOHFHU &DUSL 0HLOiQ *XHUUHUR *yPH] \ 3DOPHUR 
*XHUUHUR 8QRGHORVH[SHULPHQWRVHQORVTXHFRQPD\RUFODULGDGVHSXGR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 231 Manual de teoras emocionales y motivacionales - UJI
DSUHFLDUHVWHWLSRGHUHODFLyQHVHOTXHOOHYDURQDFDER%XUNH\0DWKHZV  
quienes pusieron de relieve que las personas ansiosas recuerdan un mayor nmero
de situaciones y trminos ansigenos que las personas no ansiosas. No obstante,
FRPRLQGLFDQ(OOLV\0RRUH  HVWRVUHVXOWDGRVSXHGHQVHUHQJDxRVRVSXHV
tambin se podra defender que el material que recupera y recuerda una persona
posee el tono o cualidad afectiva que tena esa persona cuando dicho material fue
FRGLFDGR R DSUHQGLGR HV GHFLU OR TXH RFXUUH FXDQGR QRV UHIHUtDPRV D OD PH-
moria dependiente del humor. Cabra la posibilidad de que ese material, aunque
no posea intrnsecamente determinadas connotaciones de un determinado tipo de
DIHFWRKD\DDGTXLULGRHVWDVSRUTXHFXDQGRIXHSURFHVDGR\FRGLFDGR DSUHQGL-
]DMH HOLQGLYLGXRH[SHULPHQWDEDHVHWLSRSDUWLFXODUGHDIHFWRFRQORFXDOHVDLQ-
IRUPDFLyQHQSULQFLSLRDVpSWLFDSDVDDSRVHHUGLFKDVFRQQRWDFLRQHVDIHFWLYDV XQ
VLPSOHHMHUFLFLRGHFRQGLFLRQDPLHQWR /DGLIHUHQFLDTXHH[LVWHHQWUHODPHPRULD
dependiente del humor y la memoria congruente con el humor consiste en que,
en aquella, lo importante es la asociacin entre el material y el estado o humor,
mientras que, en esta, lo importante es la consistencia entre el material y el estado
o humor.

Como ya se ha comentado, uno de los autores pioneros en este tipo de trabajos ha


VLGR%RZHU  TXLHQSURSRQHXQDKLSyWHVLVHQODTXHFODUDPHQWHVHDSUHFLD
la relacin existente entre variables afectivas y variables cognitivas. En uno de los
H[SHULPHQWRVPiVFRQRFLGRVGHHVWHDXWRU %RZHU0RQWHLUR\*LOOLJDQ 
los investigadores conforman dos grupos de personas tristes y alegres para que
DSUHQGDQOLVWDVGHSDODEUDV/XHJRFXDQGRTXLHUHYHULFDUORVHIHFWRVGHOKXPRU
o estado afectivo sobre la memoria, Bower encuentra que, si las personas se en-
cuentran en el mismo estado o humor triste o alegre que cuando llevaron a cabo
HODSUHQGL]DMHHOUHQGLPLHQWRUHFXHUGRGHSDODEUDVHUDPXFKRPHMRUTXHVLODV
personas trataban de recordar dichas palabras en un estado o humor diferente al
TXHH[SHULPHQWDEDQFXDQGRRFXUULyHODSUHQGL]DMH

En el modelo propuesto por Bower denominado, genricamente, teora de la red


asociativa se establece que el estado afectivo o el humor juegan un papel rele-
vante en el tipo y profundidad del procesamiento cognitivo que la persona lleva a
FDERHQFDGDFDVR/RVHVWDGRVHPRFLRQDOHVVRQUHSUHVHQWDGRVFRPRQRGRVHQOD
PHPRULDVHPiQWLFDTXHSRVLELOLWDUtDODRUJDQL]DFLyQGHORVFRQWHQLGRVGHLQIRU-
PDFLyQFXDQGRHVWRVVRQDGTXLULGRV DSUHQGL]DMH \TXHLQXLUtDHQORVSURFHVRV
GH UHFXSHUDFLyQ GH HVD LQIRUPDFLyQ GHVGH ORV VLVWHPDV GH PHPRULD UHFXHUGR 
As, la activacin de un nodo emocional concreto dara como resultado la mayor
accesibilidad a todo aquel material almacenado en la memoria que es congruente
con la cualidad emocional del nodo activado.

&RPRVHxDODHOSURSLR%RZHU  >@ORVHVWDGRVDIHFWLYRVSRVHHQXQQRGRRXQLGDGHVSHFtFDHQODPHPRULD


que tambin se encuentra unido con otras proposiciones que describen eventos de la propia vida, durante los cuales se pro-
GXMRHVDHPRFLyQ RHVWDGRDIHFWLYR >@ FRQVLJXLHQWHPHQWH >@ODDFWLYDFLyQGHXQQRGRGHHPRFLyQSDUWLFXODUWDPELpQ
GHVHQFDGHQDODDFWLYDFLyQHQDTXHOODVRWUDVHVWUXFWXUDVGHODPHPRULDFRQODVTXHHVWiFRQHFWDGR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 232 Manual de teoras emocionales y motivacionales - UJI
No obstante, los resultados obtenidos no siempre van en el mismo sentido, hacien-
GRTXHDOJXQRVDXWRUHV %RZHU&DUSL0HLOiQ*XHUUHUR*yPH]\3DOPHUR
(LFK0DFDXOD\\5\DQ(LFK*XHUUHUR WUDWHQGHGLOX-
FLGDUTXpHVORTXHYHUGDGHUDPHQWHKDFHTXHHQXQDVRFDVLRQHVDSDUH]FDHOHIHFWR
\HQRWUDVRFDVLRQHVQRVHSURGX]FD(QHVWHRUGHQGHFRVDVSDUHFHTXHH[LVWHQ
algunos aspectos que juegan un papel destacado en el efecto de la memoria depen-
diente del estado o humor. Son los siguientes:

a $XQTXHVRORVHKDQLQYHVWLJDGRDOJXQDVGLPHQVLRQHVDIHFWLYDVUHODFLRQDGDVFRQ
ODVHPRFLRQHVGHLUDWULVWH]DRDOHJUtDODPHPRULDGHSHQGLHQWHGHOKXPRUQR
se ve afectada por el tipo de procedimiento usado a la hora de provocar en las
personas un determinado estado o humor.

b /RVHIHFWRVSURGXFLGRVSRUODPHPRULDGHSHQGLHQWHGHOKXPRUVRQPiVHYL-
GHQWHV FXDQGR VH FRQWUDVWDQ HVWDGRV SH WULVWH]D YV DOHJUtD  TXH FXDQGR VH
compara alguno de los tres humores reseados con un estado o humor neutro.

c  /RV HIHFWRV GH OD PHPRULD GHSHQGLHQWH GHO KXPRU VRQ PiV QRWDEOHV FXDQWR
mayor es la intensidad del humor bajo el que se lleva a cabo el proceso de
DSUHQGL]DMH

d /RVHIHFWRVGHODPHPRULDGHSHQGLHQWHGHOKXPRUVRQPiVGpELOHVFXDQGRVH
WUDWDQGHYHULFDUHQWDUHDVGHODERUDWRULRTXHFXDQGRVHOOHYDQDFDERXWLOL]DQ-
do material procedente de la vida real de las personas implicadas.

/DH[LVWHQFLDGHFLHUWDVLQFRQJUXHQFLDVHQORVUHVXOWDGRVREWHQLGRVOOHYDDTXHHQ
QXHVWURV GtDV DOJXQRV DXWRUHV )RUJDV   SURSRQJDQ XQD UHIRUPXODFLyQ TXH
HVWiDOFDQ]DQGR\DPX\EXHQRVUHVXOWDGRV1RVUHIHULPRVDO0RGHORGH,QIXVLyQ
GHO$IHFWR MIA 

/Dinfusin del afectoSXHGHVHUGHQLGDFRPRXQSURFHVRPHGLDQWHHOFXDOODLQ-


IRUPDFLyQDIHFWLYDLQX\H\HVLQFRUSRUDGDHQHOSURFHVDPLHQWRFRQVWUXFWLYRTXH
lleva a cabo una persona, repercutiendo selectivamente en los procesos de apren-
GL]DMHGHPHPRULDGHDWHQFLyQHWFHLQFOXVRWDPL]DQGRHOUHVXOWDGRGHORVSUR-
FHVRVGHOLEHUDWLYRV\GHWRPDGHGHFLVLRQHV8QRGHORVSULQFLSLRVTXHVHGHHQGH
en el MIAVHUHHUHDTXHODQDWXUDOH]D\JUDGRGHLQXHQFLDGHODIHFWRVREUHORV
procesos cognitivos dependen del tipo particular de estrategia de procesamiento
XWLOL]DGDHQODUHVROXFLyQGHXQDWDUHD3DUDHOORWDOFRPRSURSRQHQTXLHQHVKDQ
SXHVWRDSUXHEDHOPRGHOR 3HWW\*OHLFKHU\%DNHU)LHGOHU)RUJDV
D KD\TXHDVXPLUXQDVXHUWHGHprincipio de parsimonia, en virtud
GHOFXDOFDGDSHUVRQDWLHQGHDPLQLPL]DUHOHVIXHU]RFRJQLWLYRDODKRUDGHUHDOL-
]DUXQDGHWHUPLQDGDDFWLYLGDGVLHPSUH\FXDQGRFRQGLFKRPtQLPRHVIXHU]RVH
consiga dar cumplida cuenta de las exigencias particulares que implica la tarea en
cuestin. As pues, las estrategias de procesamiento pueden ser de cuatro tipos:
DFFHVRGLUHFWRSURFHVDPLHQWRPRWLYDGRSURFHVDPLHQWRKHXUtVWLFR FRQRFLPLHQWR
GHODVIXHQWHV \SURFHVDPLHQWRVXVWDQWLYR/DVGRVSULPHUDVHVWUDWHJLDVVRQODV
PiVVHQFLOODVODVPiVFHUUDGDV\ODVTXHPHQRUSRVLELOLGDGGHMDQDODLQXHQFLD

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 233 Manual de teoras emocionales y motivacionales - UJI
SRUSDUWHGHODIHFWRVREUHODSURSLDHVWUDWHJLDGHSURFHVDPLHQWR/DVRWUDVGRVHV-
WUDWHJLDVVRQPiVDELHUWDV\H[LEOHVSHUPLWLHQGRODSRVLELOLGDGGHTXHHODIHFWR
SXHGDHMHUFHUVXLQXHQFLDVREUHHOSURFHVDPLHQWR

Por lo que respecta a la estrategia basada en el acceso directo, puede ser considera-
GDFRPRHOPpWRGRPiVVLPSOHGHUHDOL]DUXQDWDUHDFRJQLWLYD\HVWiVyOLGDPHQWH
basada en la recuperacin de contenidos cognitivos ya almacenados. El desempe-
xRGHHVWHWLSRGHHVWUDWHJLDHVPiVSUREDEOHFXDQGRODWDUHDDUHDOL]DUHVEDVWDQWH
IDPLOLDURUXWLQDULDH[LJHXQDUHVSXHVWDSUiFWLFDPHQWH\DHODERUDGD\DOPDFHQDGD
existe muy poca o ninguna implicacin personal, y no existen otras connotacio-
nes cognitivas, afectivas o motivacionales que exijan otro tipo de estrategia de
SURFHVDPLHQWR/DHVWUDWHJLDUHIHULGDDOprocesamiento motivado, ocurre cuando
el procesamiento de la informacin se encuentra guiado por un fuerte objetivo ya
existente, de tal forma que, tambin en esta estrategia de procesamiento, es poca
ODDFWLYLGDGFRJQLWLYDFRQVWUXFWLYDTXHSXHGHUHDOL]DUVHFRQORTXHFRQVLJXLHQWH-
PHQWHWDPELpQHVUHGXFLGDODSUREDELOLGDGGHTXHHODIHFWRSXHGDLQXLUVREUHOD
actividad cognitiva.

En la estrategia de procesamiento heurstico FRQRFLPLHQWRGHODVIXHQWHV VXHOH


producirse cuando no existe una respuesta ya elaborada ni existe un objetivo claro
que motive la consecucin por parte de la persona. En estos casos, aunque la actividad
cognitiva constructiva es mayor que en la estrategia de procesamiento motivado, se
LPSRQHODHVWUDWHJLDGHOOHYDUDFDERXQDUHVSXHVWDTXHVLJQLFDHOPtQLPRHVIXHU]R
SRVLEOH&RPRLQGLFDQ&ORUH6FKZDU]\&RQZD\  ODHVWUDWHJLDGHSURFHVD-
miento heurstico ocurre cuando la tarea es relativamente simple o tpica, posee baja
UHOHYDQFLDRVLJQLFDFLyQSHUVRQDOQRH[LVWHQXQRVREMHWLYRVPRWLYDFLRQDOHVODFD-
pacidad cognitiva es limitada, y la situacin no exige un procesamiento delimitado
o exhaustivo.

Por lo que respecta a la estrategia de procesamiento sustantivo, es la que implica


un mayor procesamiento constructivo de la informacin, con lo cual se incrementa
QRWDEOHPHQWH OD SUREDELOLGDG GH TXH HO DIHFWR LQX\D VREUH HO SURFHVDPLHQWR
esto es, existe una gran probabilidad de que tenga lugar la infusin del afecto.
(VODHVWUDWHJLDTXHH[LJHXQPD\RUHVIXHU]RFRJQLWLYR\DTXHRFXUUHVRORFXDQ-
do no son viables las tres estrategias anteriores, que, tal como hemos sealado,
VXHOHQVHUODVTXHH[LJHQXQPHQRUHVIXHU]R&RPRFRQVHFXHQFLDODHVWUDWHJLDGH
procesamiento sustantivo suele ser la que entra en juego cuando la tarea es suma-
PHQWHFRPSOHMDRDWtSLFDFXDQGRUHSUHVHQWDXQDJUDQLPSOLFDFLyQRVLJQLFDFLyQ
SHUVRQDOHV\ODSHUVRQDHQFXHVWLyQGLVSRQHGHODVXFLHQWHFDSDFLGDGFRJQLWLYD
para llevarla a cabo, sin que exista una meta motivacional que gue su actividad.
(QHVWHWLSRGHHVWUDWHJLDHVFXDQGRHODIHFWRSXHGHHMHUFHUVXPD\RULQXHQFLD
sobre la actividad cognitiva.

(QVXPDFRPRVHxDODQDOJXQRVDXWRUHV %RGHQKDXVHQ)RUJDV\)LHGOHU
)RUJDV ORTXHSHUPLWHKDEODUGHXQDPD\RURPHQRUSDUWLFLSDFLyQ
del afecto en la actividad cognitiva tiene que ver, esencialmente, con el tipo de
WDUHDDUHDOL]DU\FRQORVFRQWHQLGRVTXHSRVHHHORUJDQLVPRHQFXHVWLyQ&XDQGR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 234 Manual de teoras emocionales y motivacionales - UJI
la actividad es poco creativa, poco constructiva, tambin es poco lo que la persona
SXHGHDSRUWDUGHVtPLVPDFRQORTXHHODIHFWRLQX\HSRFRRQDGDHQODFRJQL-
FLyQ$KRUDELHQFXDQGRODWDUHDHVPiVDELHUWDVHSUHVWDPiVDODHVSHFXODFLyQ
permite la construccin de secuencias de informacin y deja que la persona com-
plete los huecos o lagunas con contenidos que, aunque en principio no han sido
asignados a esa actividad.

/D FRPSOHMD UHODFLyQ H[LVWHQWH HQWUH SURFHVRV FRJQLWLYRV \ SURFHVRV DIHFWLYRV KD
contribuido a que se considere un sistema de mltiples niveles de procesamiento que
SHUPLWDH[SOLFDUGHIRUPDOyJLFDFyPRVHYDSURFHVDQGRODLQIRUPDFLyQ\FXiOHV
son las repercusiones sobre la GLPHQVLyQHPRFLRQDO*HQpULFDPHQWHHVWRVHQIRTXHV
de estudio e investigacin han recibido la denominacin de formulaciones o modelos
multinivel. En cierta medida, las teoras multinivel son modelos esencialmente cog-
QLWLYLVWDVTXHGHIHQGLHQGRODH[LVWHQFLDGHXQDHVWUXFWXUDFLyQMHUiUTXLFDPHQWH
RUJDQL]DGDWUDWDQGHLQFOXLUORVSURFHVRVDIHFWLYRVHQVXRUJDQL]DFLyQWHyULFD

$VtHOHVWXGLRGHORV6XEVLVWHPDV&RJQLWLYRV,QWHUDFWLYRV 7HDVGDOH 
desde una orientacin clnica, trata de explicar cmo los procesos afectivos son
susceptibles de inclusin dentro de un modelo general de procesamiento de la
LQIRUPDFLyQ/DUHSHUFXVLyQPiVFODUDGHORVSURFHVRVDIHFWLYRVSDUHFHWHQHUOX-
JDUHQORVVLVWHPDVGHPHPRULD(VWDUHSHUFXVLyQHVPXFKRPiVDFXVDGDHQODV
PXHVWUDVGHSHUVRQDVGHSUHVLYDV 7HDVGDOH\%DUQDUG HQFLHUWDPHGLGD
UHFXHUGDEDVWDQWHDODVDUJXPHQWDFLRQHVFOiVLFDVGH%RZHU  

(OPiVUHFLHQWHGHORVPRGHORVPXOWLQLYHOHVHOTXHKDSURSXHVWR6FKHUHU  
$VtDSDUWLUGHOD\DFOiVLFDIRUPXODFLyQTXHUHDOL]DUDQ/HYHQWKDO\6FKHUHUUH-
ULpQGRVHDORVQLYHOHVVHQVRULDOPRWRUHVTXHPiWLFR\FRQFHSWXDOSDUDH[SOLFDU
cmo los procesos emocionales podan ser explicados desde un planteamiento
FRJQLWLYLVWD /HYHQWKDO/HYHQWKDO\6FKHUHU VRQPXFKRV\
JUDQGHVORVHVIXHU]RVUHDOL]DGRVHQODDFWXDOLGDGSDUDKDFHUFRQJUXHQWHXQSODQ-
teamiento aspticamente cognitivista con los procesos emocionales. En aquella
primera formulacin, los autores proponan que, en el nivel sensorial-motor, la
valoracin sera rudimentaria, funcionando una especie de mecanismo innato de
GHWHFFLyQTXHSHUPLWHODUHVSXHVWDDXWRPiWLFDPHGLDQWHODDFWLYDFLyQGHXQRVVLV-
WHPDVHVSHFLDOL]DGRVHQHOSURFHVDPLHQWRGHSDWURQHVHVSHFtFRVGHHVWtPXORV(Q
el nivel esquemticoODYDORUDFLyQVHUHDOL]DPHGLDQWHODDFWLYDFLyQGHPyGXORV
de informacin que son el resultado de la experiencia de esa persona, de los apren-
GL]DMHVUHDOL]DGRVDORODUJRGHVXYLGDSHUPLWLHQGRODIRUPDFLyQGHDVRFLDFLRQHV
HVSHFtFDVHQWUHHVWtPXORVFRQFUHWRV\UHVSXHVWDVSDUWLFXODUHV(QHVWHQLYHOGH
SURFHVDPLHQWRHVLPSRUWDQWHHOIDFWRUVRFLDOGHDSUHQGL]DMHSHUPLWLHQGRHQWHQ-
GHUODRFXUUHQFLDIUHFXHQWHGHUHVSXHVWDVFXDVLDXWRPiWLFDVTXHFXUVDQSRUGHEDMRGH
los umbrales de la consciencia. En el nivel conceptual, la valoracin se lleva a
cabo merced al funcionamiento de un conjunto de reglas y criterios que se aplican de
IRUPDFRQVFLHQWH\GHOLEHUDGDFDGDYH]TXHODSHUVRQDVHHQIUHQWDDXQDVLWXDFLyQ
o evento. En este nivel de procesamiento, adquiere una relevancia fundamental
el funcionamiento cortical superior, con connotaciones conscientes y con amplia
VLJQLFDFLyQFXOWXUDO /HYHQWKDO\6FKHUHU 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 235 Manual de teoras emocionales y motivacionales - UJI
(QVXUHFLHQWHIRUPXODFLyQ6FKHUHU  SURSRQHTXHHQHOSURFHVRGHYDORUD-
FLyQLQWHUYLHQHQFXDWURPRPHQWRVRIDVHVTXHUHVXOWDQGHFLVLYRVDV  DQiOLVLVGH
ODUHOHYDQFLDGHOHVWtPXORRVLWXDFLyQ  HYDOXDFLyQGHODLPSOLFDFLyQGHOLQGL-
YLGXRHQHOHVWtPXORRVLWXDFLyQ  FRQVWDWDFLyQGHODFDSDFLGDGGHFRQWUROTXH
SRVHHHOLQGLYLGXRSDUDDIURQWDUHVDVLWXDFLyQRORTXHHVORPLVPRDQiOLVLVGH
ORVUHFXUVRVGLVSRQLEOHVSDUDUHDOL]DUODWDUHDH[LJLGDSRUODVLWXDFLyQ\  DQiOL-
VLVGHODVLJQLFDFLyQSHUVRQDOTXHSRVHHHVDVLWXDFLyQSDUDHOLQGLYLGXRGHVGHOD
perspectiva de las normas sociales y culturales en las que se inserta ese individuo.
En dicho planteamiento quedan explcitos dos aspectos. En el primero de ellos
se pone de relieve que los distintos subsistemas que participan en el proceso de
YDORUDFLyQSDUHFHQEDVWDQWHLQWHUGHSHQGLHQWHVDSUHFLiQGRVHFyPRORVFDPELRVHQ
cualquiera de ellos repercuten de forma clara sobre los otros. Con el segundo de
los aspectos, queda clara la idea del proceso de autoregulacin, que es indispensa-
EOHSDUDHQWHQGHUFyPRHORUJDQLVPRHVFDSD]GHDMXVWDUVXVGLVWLQWRVUHFXUVRVDODV
exigencias concretas de cada situacin. Esta idea ha sido ampliada recientemente
SRU %RQDQQR   TXLHQ KD HVSHFLFDGR HO SDSHO GH OD UHWURDFFLyQ QHJDWLYD
PHFDQLVPR LPSUHVFLQGLEOH SDUD KDEODU GH DGDSWDFLyQ HQ XQ VLVWHPD MHUiUTXLFR
GHRUJDQL]DFLyQGHORVSURFHVRVGHUHJXODFLyQHPRFLRQDO([LVWHQWUHVFDWHJRUtDV
EiVLFDVGHDXWRUHJXODFLyQHPRFLRQDOODUHJXODFLyQGHFRQWUROTXHRFXUUHHQHO
momento de ocurrencia de una emocin, la regulacin anticipatoria, que ocurre
LQPHGLDWDPHQWH DQWHV GH TXH VH GHVHQFDGHQH XQD HPRFLyQ FXDQGR OD SHUVRQD
DGYLHUWHTXHYDDRFXUULUHVDHPRFLyQ \ODUHJXODFLyQH[SORUDWRULDTXHHVXQD
forma de ejercitar las estrategias de control en ausencia de una emocin, incluso
en ausencia de la sospecha de que pueda ocurrir una emocin. En ltima instancia,
ODVLJXLHQWHJXUDLOXVWUDGHIRUPDVXFLQWDODLGHDGH6FKHUHU

)LJXUD)RUPXODFLyQGH6FKHUHU 

Probablemente, una de las debilidades de este tipo de estudios actuales tiene que
YHUFRQHODIiQSRUGHVPHQX]DUKDVWDHOOtPLWHODLQIRUPDFLyQSURFHVDGD$GHPiV
FRPRLQGLFD7HDVGDOH  DXQTXHSDUHFHEXHQRVHJXLUDEULHQGROtQHDVGHWUD-
EDMRHVWHWLSRGHLQWHQWRVSURSRUFLRQDPiVSUHJXQWDV\GXGDVTXHUHVSXHVWDVH[-
SOLFDQGRPX\SRFRGHODYHUGDGHUDUHODFLyQHQWUHFRJQLFLyQ\HPRFLyQ RDIHFWR
HQJHQHUDO 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 236 Manual de teoras emocionales y motivacionales - UJI
 Conclusiones
/DGLYHUVLGDGGHPRGHORVFLWDGRVGDXQDYLVLyQGHOLQWHUpVSRUFRQRFHUORVPHFD-
nismos de los distintos procesos psicolgicos. No tan solo de forma independiente
VLQRHQFyPRLQWHUDFFLRQDQ\VHPRGLFDQ(QODDFWXDOLGDGH[LVWHQSRFDVGXGDV
GHTXHHODIHFWRLQX\HHQORVSURFHVRVFRJQLWLYRV DWHQFLyQPHPRULDHYDOXD-
FLyQYDORUDFLyQWRPDGHGHFLVLRQHVHWF DOPLVPRWLHPSRTXHORVSURFHVRVFRJ-
nitivos tienen una gran relevancia a la hora de entender cmo, y de qu tipo, es la
respuesta, afectiva en general, y emocional en particular, que ejecuta una persona,
VHJ~QVHDHOSURFHVRGHYDORUDFLyQTXHHVWDUHDOL]DVREUHHOHVWtPXORRVLWXDFLyQ
que le afecta.

Se pueden establecer algunos aspectos que, en cierta medida, sealan lo que tiene
que ser el futuro en el estudio de la emocin. Por una parte, es conveniente supri-
PLURDOPHQRVUHGXFLUODDPELJHGDGTXHURGHDDORVREMHWLYRVGHODVWHRUtDVED-
VDGDVHQODYDORUDFLyQ\SRURWUDSDUWHHVSUHFLVRGHQLUFRQH[DFWLWXGODVLJQL-
cacin de los trminos cognicin y valoracinDOPHQRVHQHOiPELWRGHODHPRFLyQ

0iV TXH HO HVWtPXOR PiV TXH OD HYHQWXDO UHVSXHVWD TXH SXHGD DSDUHFHU FRPR
consecuencia de dicho estmulo, el proceso de evaluacin y de valoracin que
OOHYHPRVDFDERVREUHHOHVWtPXORGHWHUPLQDUiVLVHSURGXFHXQDHPRFLyQXRWUD
o ninguna. /DUHOHYDQFLDGHODYDORUDFLyQHQODVHPRFLRQHVHVWDOTXHFRPRFRQ-
secuencia de dicho proceso, el organismo responde de forma conjunta y sincroni-
]DGDDFWLYDQGRWRGRVDTXHOORVVLVWHPDV\VXEVLVWHPDVQHFHVDULRVSDUDFRQWURODUOD
situacin o estmulo que fue valorado.

Una parte sustancial de los procesos de valoracin que se llevan a cabo en un ser
humano ocurre por debajo de los umbrales de la consciencia, probablemente a
partir de la actividad que tiene lugar en las estructuras subcorticales. Como indica
6FKHUHU   GHSHQGLHQGR GH OD UHOHYDQFLD GHO HVWtPXOR R VLWXDFLyQ GHSHQ-
diendo del nivel de procesamiento en el que se lleve a cabo la valoracin, esta
WHQGUiDFFHVRDODFRQVFLHQFLDRQR6LELHQSDUHFHFRPSOHWDPHQWHDVXPLGRTXH
un proceso consciente de valoracin no admite ninguna suerte de duda, tambin
KD\TXHDGPLWLUTXHHQRFDVLRQHVSXHGHRFXUULUXQDUHDFFLyQUHHMDGHGHIHQVD
FRPSOHWDPHQWHDXWRPiWLFDHQODFXDOWDPELpQVHKDSURGXFLGRDOJXQDIRUPDGH
evaluacin, valoracin y respuesta ajustada al resultado de esa evaluacin y valo-
racin. Es cierto que cabe la posibilidad de que, tras esta forma de valoracin, no
RFXUUDXQDHPRFLyQFRPSOHWDXQDHPRFLyQFRPRWDO6LQHPEDUJRHVWHDQiOLVLV
GHODVLJQLFDFLyQGHOHVWtPXORLPSOLFDGR\DHVHQVtPLVPRXQSURFHVRGHYDORUD-
cin. /DYDORUDFLyQHVLPSUHVFLQGLEOHSDUDTXHRFXUUDXQDHPRFLyQXQDHPRFLyQ
HVHOUHVXOWDGRGHXQDYDORUDFLyQVLJQLFDWLYD\DXQTXHQRWRGDVODVYDORUDFLRQHV
VLJQLFDWLYDVGHVHQFDGHQHQXQSURFHVRHPRFLRQDOcada proceso emocional siem-
SUHHVHOUHVXOWDGRGHXQDYDORUDFLyQVLJQLFDWLYD.

Cualquier lnea divisoria entre la emocin y la cognicin, si es que existe, de-


SHQGH GH FyPR GHQDPRV OD FRJQLFLyQ. Si consideramos que la cognicin es
SHQVDPLHQWRFRQVFLHQWHSRVWXUDFRQFODURVRUtJHQHVORVyFRV\JUDQUHSHUFXVLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 237 Manual de teoras emocionales y motivacionales - UJI
HQODSVLFRORJtD *ULIWKV HOUHVXOWDGRHVTXHPXFKRVHYHQWRVHPRFLRQDOHV
no implican cognicin. Probablemente tengamos que hacer referencia al principio
de la causalidad recprocaSURSXHVWRSRU%DQGXUD  SDUDUHIHULUVHDODSR-
sibilidad de que un nico evento puede ser considerado como respuesta del evento
anterior y como estmulo de la respuesta siguiente.

En sntesis, tal como se ha puesto de relieve en los trabajos de los ltimos aos,
WDQWRHOVLVWHPDFRJQLWLYRFRPRHOVLVWHPDDIHFWLYR HPRFLRQDO SXHGHQVHUFRQ-
VLGHUDGRV FRPR GRV VLVWHPDV GH DGDSWDFLyQ ORJHQpWLFDPHQWH DSURSLDGRV SDUD
JDUDQWL]DUODVXSHUYLYHQFLDGHODVHVSHFLHV(OVLVWHPDHPRFLRQDOHVFRQVLGHUDGR
FRPRXQPHFDQLVPRGHHPHUJHQFLDFDSD]GHLQWHUUXPSLUODVDFFLRQHVHQFXUVR
llevando al organismo a la seleccin de un patrn de respuesta diferente del que
exista en el momento de la irrupcin. Por su parte, el sistema cognitivo puede ser
FRQVLGHUDGR FRPR XQ PHFDQLVPR PiV FRPSOHMR \ DYDQ]DGR FDSD] GH SURFHVDU
H[KDXVWLYDPHQWHWRGDODLQIRUPDFLyQGHODVVLWXDFLRQHVPiVFRPSOHMDVSHUPLWLHQ-
GRDGHPiVODSODQLFDFLyQGHHVWUDWHJLDV\IRUPDVFRQFUHWDVGHFRQGXFWDFRQODV
que hacer frente a la situacin. El sistema emocional tiene una forma de actuacin
DXWRPiWLFDHQODTXHHOSURFHVDPLHQWRVHUHDOL]DUHVWULFWLYDPHQWHVRORFRQDTXH-
llos signos o seales de la situacin que parecen relevantes; el resultado es una
UHVSXHVWD UiSLGD LQPHGLDWD (O VLVWHPD FRJQLWLYR WLHQH XQD IRUPD GH DFWXDFLyQ
PiVHODERUDGDPiVFRQWURODGD\PiVPLQXFLRVDGHODLQIRUPDFLyQSHUPLWLHQGROD
VHOHFFLyQGHDTXHOODVHVWUDWHJLDVTXHVRQRDOPHQRVORSDUHFHQODVPiVDSURSLD-
das a cada situacin a la que se enfrenta el individuo.

Bibliografa
ARNOLD0% D (PRWLRQDQG3HUVRQDOLW\9RO3V\FKRORJLFDO$VSHFWV.
&ROXPELD8QLYHUVLW\3UHVV1XHYD<RUN
  E  (PRWLRQ DQG 3HUVRQDOLW\ 9RO  1HXURORJLFDO DQG 3K\VLRORJLFDO
Aspects&ROXPELD8QLYHUVLW\3UHVV1XHYD<RUN
ARNOLD0%  )HHOLQJVDQG(PRWLRQV7KH/R\ROD6\PSRVLXP. Academic
3UHVV1XHYD<RUN
BANDURA $   7KH VHOI V\VWHP LQ UHFLSURFDO GHWHUPLQLVP American
3V\FKRORJLVW
BISQUERRA5  7HRUtDVGHODVHPRFLRQHVHQ5%LVTXHUUD$O]LQD HG 
3VLFRSHGDJJtDGHODVHPRFLRQHVSS6tQWHVLV0DGULG
BODENHAUSEN*9  (PRWLRQDURXVDODQGVWHUHRW\SLFMXGJPHQWDKHXULVWLF
PRGHORIDIIHFWDQGVWHUHRW\SLQJHQ'0DFNLH\'+DPLOWRQ HGV $IIHFW
&RJQLWLRQ DQG 6WHUHRW\SLQJ ,QWHUDFWLYH 3URFHVHV LQ ,QWHUJURXS 3HUFHSWLRQ
SS $FDGHPLF3UHVV6DQ'LHJR
BONANNO * $   (PRWLRQ VHOIUHJXODWLRQ HQ 7 - 0D\QH \ * $
%RQDQQR*HRUJH$ HGV (PRWLRQV&XUUUHQW,VVXHVDQG)XWXUH'LUHFWLRQV
Emotions and Social Behavior SS 7KH*XLOIRUG3UHVV1XHYD<RUN
BOWER*+  0RRGDQGPHPRU\$PHULFDQ3V\FKRORJLVW

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 238 Manual de teoras emocionales y motivacionales - UJI
  +RZPLJKWHPRWLRQVDIIHFWOHDUQLQJ"HQ6$&KULVWLDQVRQ HG 
7KH +DQGERRN RI (PRWLRQ DQG 0HPRU\ 5HVHDUFK DQG 7KHRU\ SS  
/DZUHQFH(UOEDXP+LOOVGDOH1-
   6RPH UHODWLRQV EHWZHHQ HPRWLRQV DQG PHPRU\ HQ 3 (NPDQ \
5 - 'DYLGVRQ HGV  7KH 1DWXUH RI (PRWLRQ )XQGDPHQWDO 4XHVWLRQV
SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
BOWER*+\COHEN35  (PRWLRQDOLQXHQFHVLQPHPRU\DQGWKLQNLQJ
'DWD DQG WKHRU\ HQ 0 6 &ODUN \ 67 )LVNH HGV  Affect and Cognition
SS /DZUHQFH(UOEDXP$VVRFLDWHV+LOOVGDOH1XHYD-HUVH\
BOWER * + . 3 MONTEIRO \ 6 * GILLIGAN   (PRWLRQDO PRRG DV
a context for learning and recall, Journal of Verbal Learning and Verbal
Behavior
BULL 1   7KH DWWLWXGH WKHRU\ RI HPRWLRQ Nervous Mental Disease
Monographs
BURKE 0 \ $ 0 MATHEWS   $XWRELRJUDSKLFDO PHPRU\ DQG FOLQLFDO
anxiety, Cognition and Emotion
CARPI, A.; J. J. MEILN; C. GUERRERO; C. GMEZ\)PALMERO  (VWDGRV
$IHFWLYRV,QGXFLGRV\5HFXHUGRGH3DODEUDVHQ-0'tD]*yPH]\(*iPH]
$UPDV FRUGV 0RWLYDFLyQ\(PRFLyQ,QYHVWLJDFLRQHVDFWXDOHV SS 
6HUYLFLR3XEOLFDFLRQHV8QLYHUVLGDG/D/DJXQD6DQWD&UX]GH7HQHULIH
CLORE*/\$ORTONY  &RJQLWLRQLQHPRWLRQ$OZD\VVRPHWLPHVRU
QHYHUHQ5'/DQH\/1DGHO HGV Cognitive Neuroscience of Emotion
SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
CLORE * / 1 SCHWARZ \ 0 CONWAY   $IIHFWLYH FDXVHV DQG
FRQVHTXHQFHVRIVRFLDOLQIRUPDWLRQSURFHVVLQJHQ56:\HU\76UXOO HGV 
7KH +DQGERRN RI 6RFLDO &RJQLWLRQ  HG SS   /DZUHQFH (UOEDXP
$VVRFLDWHV+LOOVGDOH1-
DAMASIO$5  'HVFDUWHVHUURU(PRWLRQV5HDVRQDQGWKH+XPDQ%UDLQ.
$YRQ%RRNV1XHYD<RUN
 $VHFRQGFKDQFHIRUHPRWLRQHQ5'/DQH\/1DGHO HGV Cognitive
Neuroscience of Emotion SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
EICH(  6HDUFKLQJIRUPRRGGHSHQGHQWPHPRU\3V\FKRORJLFDO6FLHQFH,

EICH, E.; E. MACAULAY\/RYAN  0RRGGHSHQGHQWPHPRU\IRUHYHQWVRI
the personal past, -RXUQDORI([SHULPHQWDO3V\FKRORJ\*HQHUDO
ELLIS+&\%$MOORE  0RRGDQGPHPRU\HQ7'DOJOHLVK\03RZHU
HGV Handbook of Cognition and Emotion SS :LOH\&KLFKHVWHU
FIEDLER.  2QWKHWDVNWKHPHDVXUHVDQGWKHPRRGLQUHVHDUFKRQDIIHFW
DQG VRFLDO FRJQLWLRQ HQ - 3 )RUJDV HG  Emotion and Social Judgments
SS 3HUJDPRQ2[IRUG
FORGAS-3 E 6WUDQJHFRXSOHVPRRGHIIHFWVRQMXGJPHQWVDQGPHPRU\
about prototypical and atypical targets, 3HUVRQDOLW\ DQG 6RFLDO 3V\FKRORJ\
Bulletin
  1HWZRUN WKHRULHV DQG EH\RQG HQ7 'DOJOHLVK \ 0 3RZHU HGV 
Handbook of Cognition and Emotion SS :LOH\&KLFKHVWHU
FORGAS - 3 \ . FIEDLER   8V DQG 7KHP PRRG HIIHFWV RQ LQWHUJURXS
discrimination, -RXUQDORI3HUVRQDOLW\DQG6RFLDO3V\FKRORJ\

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 239 Manual de teoras emocionales y motivacionales - UJI
FREUD 6   2EUDV &RPSOHWDV  YRO~PHQHV . Bliblioteca Nueva,
0DGULG
GRIFFITHS3(  :KDW(PRWLRQV5HDOO\$UH7KH3UREOHPRI3V\FKRORJLFDO
Categories. University of Chicago Press, Chicago.
GUERRERO&  5HODFLRQHVDIHFWRFRJQLFLyQ&yPRLQX\HQXHVWURHVWDGR
DIHFWLYRHQORVSURFHVRGHDSUHQGL]DMH\PHPRULD"HQ&*yPH]$&DUSL
& *XHUUHUR \ ) 3DOPHUR &RRUGV  8QD EUHYH LQWURGXFFLyQ D ORV SURFHVRV
SVLFROyJLFRVEiVLFRVSS2QWL*UjFV9DOHQFLD
GRISKEVICIUS9 0 1 SHIOTA \ 6 / NEUFELD   ,QXHQFH RI GLIIHUHQW
3RVLWLYH (PRWLRQV RQ 3HUVXDVLRQ 3URFHVVLQJ $ )XQFWLRQDO (YROXWLRQDU\
Approach, (PRWLRQYROQ
HAIDT-6+KOLLER\0*DIAS  $IIHFWFXOWXUHDQGPRUWDOLW\RULV
LWZURQJWRHDW\RXUGRJ"-RXUQDORI3HUVRQDOLW\DQG6RFLDO3V\FKRORJ\

IZARD&(  7KH3V\FKRORJ\RI(PRWLRQV3OHQXP3UHVV1XHYD<RUN
JUNG & *   3V\FKRORJLFDO 7\SHV +* %D\QHV WUDGXFWRU  +DUFRXUW
%UDFHDQG&R1XHYD<RUN
   7ZR HVVD\V RQ DQDO\WLFDO SV\FKRORJ\ HQ + 5HDG 0 )RUGKDP \
*$GOHU HGV &ROOHFWHG:RUNVYRO SS 3ULQFHWRQ8QLYHUVLW\
Press; Princeton, Nueva Jersey.
 7KHGHYHORSPHQWRISHUVRQDOLW\HQ+5HDG0)RUGKDP\*$GOHU
HGV  &ROOHFWHG :RUNV YRO  SS   3ULQFHWRQ 8QLYHUVLW\ 3UHVV
Princeton, Nueva Jersey.
JUTTA-<.LIRA y S. MATTHIAS  &RJQLFLyQ\(PRFLyQUHJXODWLRQ
HQ .ULQJ $QQ 0 (G  6ORDQ 'HQLVH 0 (G  Emotion regulation and
SV\FKRSDWKRORJ\ $ WUDQVGLDJQRVWLF DSSURDFK WR HWLRORJ\ DQG WUHDWPHQW,
SS*XLOIRUG3UHVV1HZ<RUN1<86
KAISER6\7WEHRLE  6LWXDWHGHPRWLRQDOSUREOHPVROYLQJLQLQWHUDFWLYH
FRPSXWHUJDPHVHQ1+)ULMGD HG 3URFHHGLQJVRIWKH9,,,WK&RQIHUHQFH
RIWKH,QWHUQDWLRQDO6RFLHW\IRU5HVHDUFKRQ(PRWLRQV ISRE SS 
ISRE6WRUUV&7
KIRBY / ' \ & $ SMITH   )UHDNLQJ TXLWWLQJ DQG VWD\LQJ HQJDJHG
SDWWHUQV RI SV\FKRSK\VLRORJLFDO UHVSRQVH WR VWUHVV HQ 1 + )ULMGD HG 
3URFHHGLQJVRIWKH1LQWK&RQIHUHQFHRIWKH,QWHUQDWLRQDO6RFLHW\IRU5HVHDUFK
RQ(PRWLRQV,65( SS ISRE7RURQWR
LAZARUS 5 6   3V\FKRORJLFDO 6WUHVV DQG WKH &RSLQJ 3URFHVV 0F*UDZ
+LOO1XHYD<RUN
  7KRXJKWVRQWKHUHODWLRQVEHWZHHQHPRWLRQDQGFRJQLWLRQAmerican
3V\FKRORJLVW
  2QWKHSULPDF\RIFRJQLWLRQ$PHULFDQ3V\FKRORJLVW
  Emotion and Adaptation2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
  7KHFRJQLWLRQHPRWLRQGHEDWHDELWRIKLVWRU\HQ7'DOJOHLVK\0
3RZHU HGV Handbook of Cognition and Emotion SS :LOH\&KLFKHVWHU
LAZARUS, R. S.; A. D. KANNER y S. FOLKMAN   (PRWLRQV $ FRJQLWLYH
SKHQRPHQRORJLFDODQDO\VLVHQ53OXWFKLN\+.HOOHUPDQ HGV Emotion:
7KHRU\5HVHDUFKDQG([SHULHQFH 9RO 7KHRULHVRI(PRWLRQ SS 
$FDGHPLF3UHVV1XHYD<RUN

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 240 Manual de teoras emocionales y motivacionales - UJI
LEVENTHAL +   7RZDUG D FRPSUHKHQVLYH WKHRU\ RI HPRWLRQ HQ
/ %HUNRZLW] HG  $GYDQFHV LQ ([SHULPHQWDO 6RFLDO 3V\FKRORJ\ YRO 
SS $FDGHPLF3UHVV1XHYD<RUN
  $ SHUFHSWXDOPRWRU WKHRU\ RI HPRWLRQ HQ / %HUNRZLW] HG 
$GYDQFHVLQ([SHULPHQWDO6RFLDO3V\FKRORJ\YRO SS $FDGHPLF
3UHVV1XHYD<RUN
LEVENTHAL+\.SCHERER  7KHUHODWLRQVKLSRIHPRWLRQWRFRJQLWLRQD
functional approach to a semantic controversy, Cognition and Emotion
LYONS:  Emocin. Anthropos, Barcelona.
  7KHSKLORVRSK\RIFRJQLWLRQDQGHPRWLRQHQ7'DOJOHLVK\03RZHU
HGV Handbook of Cognition and Emotion SS :LOH\&KLFKHVWHU
MACLEAN3'  3V\FKRVRPDWLFGLVHDVHDQGWKHYLVFHUDOEUDLQ5HFHQW
GHYHORSPHQWV EHDULQJ RQ WKH 3DSH] WKHRU\ RI HPRWLRQ 3V\FKRVRPDWLF
Medicine
MANDLER*  7KHVHDUFKRIHPRWLRQHQ//HYL HG Emotions: Their
Parameters and Measurement SS 5DYHQ3UHVV1XHYD<RUN
  Mind and Emotion:LOH\1XHYD<RUN
   0LQG DQG %RG\ 3V\FKRORJ\ RI (PRWLRQ DQG 6WUHVV. Norton, Nueva
<RUN
MARAN*  &RQWULEXWLRQDOpWXGHGHODFWLRQHPRWLYHGHODGUHROLQH
Revue Franaise dEndocrinologie
MESQUITA % 1 + FRIJDA \ . 5 SCHERER   &XOWXUH DQG HPRWLRQ HQ
- ( %HUU\ 3 % 'DVHQ \ 7 6 6DUDVZDWKL HGV  Handbook of Cross-cultural
3V\FKRORJ\9RO%DVLF3URFHVVHVDQG'HYHORSPHQWDO3V\FKRORJ\ SS 
Allyn and Bacon, Boston.
PALMERO)  /DHPRFLyQGHVGHHOPRGHORFRJQLWLYLVWDRevista Electr-
QLFDGH0RWLYDFLyQ\(PRFLyQ REME) vol. VIQ
PALMERO)&GUERRERO; C. GMEZ y A. CARPI  &HUWH]DV\FRQWURYHUVLDV
en el estudio de la emocin, 5HYLVWD (OHFWUyQLFD GH 0RWLYDFLyQ \ (PRFLyQ
REME , IXQ
PALMERO)\0MESTRE  (PRFLyQHQ-00HVWUH1DYDV\)3DOPHUR
&DQWHUR FRRUG SS0F*UDZ+LOO0DGULG
PECCHINENDA, A.; A. KAPPAS y C. A. SMITH  (IIHFWVRIGLIFXOW\DQGDELOLW\
LQ D GXDOWDVN YLGHR JDPH SDUDGLJP RQ DWWHQWLRQ SK\VLRORJLFDO UHVSRQVHV
performance, and emotion-related appraisal, 3V\FKRSK\VLRORJ\
PETTY5()GLEICHER y S. BAKER  0XOWLSOHUROHVIRUDIIHFWLQSHU-
VXDVLRQHQ-3)RUJDV HG Emotion and Social Judgments SS 
3HUJDPRQ2[IRUG
PLOTKIN +   Darwin Machines and the Nature of Knowledge +DUYDUG
8QLYHUVLW\3UHVV&DPEULGJH0$
ROSEMAN,-  $SSUDLVDOGHWHUPLQDQWVRIGLVFUHWHHPRWLRQVCognition
and Emotion
ROSEMAN , -   :K\ WKHVH DSSUDLVDOV" $QFKRULQJ DSSUDLVDO PRGHOV WR
UHVHDUFK RQ HPRWLRQDO EHKDYLRXU DQG UHODWHG UHVSRQVH V\VWHPV HQ 1 +
)ULMGD HG 3URFHHGLQJVRIWKH1LQWK&RQIHUHQFHRIWKH,QWHUQDWLRQDO6RFLHW\
IRU5HVHDUFKRQ(PRWLRQVISRE SS ISRE7RURQWR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 241 Manual de teoras emocionales y motivacionales - UJI
ROSEMAN, I. J.; A. A. ANTONIOU y P. E. JOSE  $SSUDLVDOGHWHUPLQDQWVRI
emotions: constructing a more accurate and comprehensive theory, Cognition
and Emotion
SCHACHTER6  7KH3V\FKRORJ\RI$IOLDWLRQ. Stamford University Press,
Stamford, California.
   7KH LQWHUDFWLRQ RI FRJQLWLYH DQG SK\VLRORJLFDO GHWHUPLQDQWV RI
HPRWLRQDO VWDWH HQ / %HUNRZLW] HG  Advances in Experimental Social
3V\FKRORJ\YRO SS $FDGHPLF3UHVV1XHYD<RUN
  $ FRJQLWLYHSK\VLRORJLF YLHZ RI HPRWLRQ HQ .OLQHEHUJ \ &KULVWLH
HGV  3HUVSHFWLYHV LQ 6RFLDO 3V\FKRORJ\ SS   +ROW 5LQHKDUW \
:LQVWRQ1XHYD<RUN
  7KHDVVXPSWLRQRILGHQWLW\DQGSHULSKHULDOLVWFHQWUDOLVWFRQWURYHUVLHV
LQPRWLYDWLRQDQGHPRWLRQHQ0%$UQROG HG Feelings and Emotions: The
/R\ROD6\PSRVLXP SS $FDGHPLF3UHVV1XHYD<RUN
  (PRWLRQ2EHVLW\DQG&ULPH$FDGHPLF3UHVV1XHYD<RUN
SCHACHTER, S. y J. E. SINGER   &RJQLWLYH VRFLDO DQG SK\VLRORJLFDO
determinants of emotional state, 3V\FKRORJLFDO5HYLHZ
  &RPPHQWV RQ WKH 0DVODFK DQG 0DUVKDOO=LPEDUGR H[SHULPHQWV
-RXUQDORI3HUVRQDOLW\DQG6RFLDO3V\FKRORJ\
SCHERER . 5   2Q WKH QDWXUH DQG IXQFWLRQ RI HPRWLRQ D FRPSRQHQW
SURFHVVDSSURDFKHQ.56FKHUHU\3(NPDQ HGV Approaches to Emotion
SS /DZUHQFH(UOEDXP$VVRFLDWHV+LOOVGDOH1-
  $SSUDLVDOWKHRU\HQ7'DOJOHLVK\03RZHU HGV Handbook of
Cognition and Emotion SS :LOH\&KLFKHVWHU
  3V\FKRORJLFDOPRGHOVRIHPRWLRQHQ-&%RURG HG 7KH1HXURSV\-
FKRORJ\RI(PRWLRQ SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
  $SSUDLVDOFRQVLGHUHGDVDSURFHVVRIPXOWLQLYHOVHTXHQWLDOFKHFNLQJ
HQ.56FKHUHU$6FKRUU\7-RKQVWRQH HGV $SSUDLVDO3URFHVVLQ(PRWLRQ
7KHRU\0HWKRGV5HVHDUFK SS 2[IRUG8QLYHUVLW\3UHVV1XHYD<RUN
SELYE+  Stress$FWD0RQWUHDO
  7KHHYROXWLRQRIWKHVWUHVVFRQFHSWAmerican Scientist
SLAVIN0\KRIEGMAN'  7KH$GDSWLYH'HVLJQRIWKH+XPDQ3V\FKH.
*XLOIRUG3UHVV1XHYD<RUN
TEASDALE - '   7KH UHODWLRQVKLS EHWZHHQ FRJQLWLRQ DQG HPRWLRQ WKH
PLQGLQSODFH LQ PRRG GLVRUGHUV HQ ' 0 &ODUN \ &* )DLUEXUQ HGV 
6FLHQFH DQG 3UDFWLFH RI &RJQLWLYH %HKDYLRXU 7KHUDS\ SS   2[IRUG
2[IRUG8QLYHUVLW\3UHVV
  0XOWLOHYHOWKHRULHVRIFRJQLWLRQHPRWLRQUHODWLRQVHQ7'DOJOHLVK
\03RZHU HGV Handbook of Cognition and Emotion SS :LOH\
Chichester.
TEASDALE, J. D. y P. J. BARNARD  $IIHFW&RJQLWLRQDQG&KDQJH5HPRGHOOLQJ
Depressive Thought(UOEDXP+RYH
TOATES)0  0RWLYDWLRQDQGHPRWLRQIURPDELRORJLFDOSHUVSHFWLYHHQ
9 +DPLOWRQ * + %RZHU \ 1 + )ULMGD HGV  Cognitive Perspectives on
Emotion and Motivation SS .OXZHU$FDGHPLF'RUGUHFK
 $QLPDOPRWLYDWLRQDQGFRJQLWLRQHQ+5RLWEODW\-$0H\HU HGV 
&RPSDUDWLYH $SSURDFKHV WR &RJQLWLYH 6FLHQFH &RPSOH[ $GDSWLYH 6\VWHPV
SS 7KH0,73UHVV&DPEULGJH0$

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 242 Manual de teoras emocionales y motivacionales - UJI
VOLOKNOV51\+$DEMAREE  6SRQWDQHRXVHPRWLRQUHJXODWLRQWR
positive and negative stimuli, %UDLQDQGFRJQLWLRQYROQSS
WEINER%  $Q$WWULEXWLRQDO7KHRU\RI0RWLYDWLRQDQG(PRWLRQ. Springer,
1XHYD<RUN
ZAJONC 5 %   )HHOLQJ DQG WKLQNLQJ 3UHIHUHQFHV QHHG QR LQIHUHQFHV
$PHULFDQ3V\FKRORJLVW
  2QWKHSULPDF\RIDIIHFW$PHULFDQ3V\FKRORJLVW
  (PRWLRQVHQ'*LOEHUW67)LVNH\*/LQG]H\ HGV Handbook
RI6RFLDO3V\FKRORJ\WKHGYRO SS 0F*UDZ+LOO1XHYD<RUN
ZAJONC5%\0DUNXV+  $IIHFWDQGFRJQLWLRQ7KHKDUGLQWHUIDFHHQ
&(,]DUG-.DJDQ\5%=DMRQF HGV (PRWLRQV&RJQLWLRQDQG%HKDYLRU
SS &DPEULGJH8QLYHUVLW\3UHVV&DPEULGJH

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 243 Manual de teoras emocionales y motivacionales - UJI
9. Proceso de estrs
,QWURGXFFLyQ
Cuando se estudia el proceso de estrs nos encontramos con algo frecuente en el
iPELWRGHODSVLFRORJtDDVDEHUWRGRHOPXQGRFRQRFHTXpHVHOHVWUpVSHURSRFDV
YHFHVVHHQFXHQWUDTXHGRVSHUVRQDVGHQDQHOHVWUpVHQORVPLVPRVWpUPLQRV

(OHVWUpVHVXQWpUPLQRTXHSURFHGHGHODItVLFD(QHVWHiPELWRHVWUpVVLJQLFD
SUHVLyQXWLOL]iQGRVHSDUDH[SOLFDUORVHIHFWRVTXHVHSURGXFHQVREUHXQFXHUSR
cuando este es sometido a una presin. Estrs tiene, pues, connotaciones de pre-
sin. As, cuando sobre un cuerpo se coloca un peso, este ejerce presin sobre
DTXHO(OFXHUSRUHVLVWLUiODSUHVLyQVLHOSHVRHVDVHTXLEOHDVXFDSDFLGDGGHUH-
VLVWHQFLD\DJXDQWH9HDPRVODVSUHPLVDVLPSOtFLWDVHQHVWHSRVWXODGRDVXPLHQGR
que lo hacemos desde el marco de referencia de la fsica.

Primera premisa: si vamos incrementando progresivamente el peso sobre el cuer-


po, es decir, si vamos incrementando progresivamente la presin sobre ese cuerpo,
REVHUYDUHPRVFyPROOHJDGRXQPRPHQWRHVWHHPSLH]DDUHVHQWLUVHKDVWDTXHVL
VHJXLPRVLQFUHPHQWDQGRHOSHVRHOFXHUSRVHURPSHUi(QHVWDSULPHUDSUHPLVD
HOSHVRKDVLGRVXSHULRUDODFDSDFLGDGGHUHVLVWHQFLDGHOFXHUSR\ORKDGHVWUR]DGR

Segunda premisa: si vamos incrementando progresivamente el peso o la presin


sobre un cuerpo, pero nunca se llega a sobrepasar su capacidad de resistencia, ob-
servaremos que el cuerpo se mantiene indemne, sin romperse.

Tercera premisaWRGRFXHUSRWLHQHXQSXQWRTXHHVHOPiVGpELOSDUDUHVLVWLUOD
eventual presin a la que puede ser sometido.

$HVWDVWUHVSUHPLVDVEiVLFDVSRGUtDPRVDxDGLUDOJXQRVFRURODULRVTXHHQQXHVWUD
RSLQLyQSHUODQODUHODFLyQUHDOHQWUHXQFXHUSR\ODVSUHVLRQHVDODVTXHHYHQWXDO-
mente puede verse sometido.

Corolarios a la primera premisa

3DUDTXHVHURPSDHOFXHUSRHOSHVRWLHQHTXHH[FHGHUEDVWDQWHVXFDSDFLGDGGH
UHVLVWHQFLDSXHVFXDOTXLHUFXHUSRHVWiSUHSDUDGRSDUDUHVLVWLUSRUHQFLPDGHVXV
posibilidades durante cortos espacios de tiempo, siempre y cuando el exceso
QRVHDPX\JUDQGH KD\GLIHUHQFLDVSDUWLFXODUHVSDUDFDGDFXHUSRHQFXDQWRDO
H[FHVRTXHSXHGHQUHVLVWLUSRUHQFLPDGHVXVSRVLELOLGDGHV 

&XDQWRPD\RUVHDHOH[FHVRGHSUHVLyQRGHSHVRVREUHODFDSDFLGDGGHOFXHUSR
WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHHVWHVHURPSD\WDQWRPD\RUVHUiOD
probabilidad de que se rompa antes.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 244 Manual de teoras emocionales y motivacionales - UJI
&XDQWRPD\RUVHDODIUHFXHQFLDFRQODTXHVRPHWHPRVXQFXHUSRDSUHVLRQHV
que exceden su capacidad de resistencia, aunque los excesos no sean muy ele-
YDGRVWDQWRPD\RUVHUiWDPELpQODSUREDELOLGDGGHTXHHOFXHUSRVHURPSD\
WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHVHURPSDDQWHV

/DFRPELQDFLyQGHORVFRURODULRV\LQFUHPHQWDH[SRQHQFLDOPHQWHHOULHVJR
de rotura. Es decir, cuanto mayor sea la frecuencia con la que sometemos un
FXHUSRDODVSUHVLRQHVPiVDOHMDGDVSRUHQFLPDGHVXFDSDFLGDGGHUHVLVWHQFLD
WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHHOFXHUSRVHURPSD\WDQWRPD\RUVHUi
la probabilidad de que se rompa antes.

Corolarios a la segunda premisa

7RGDSUHVLyQWLHQHHIHFWRVQHJDWLYRVDPHGLR\RODUJRSOD]R,QFOXVRODVSUH-
VLRQHVTXHVHHQFXHQWUDQGHQWURGHORVPiUJHQHVGHUHVLVWHQFLDGHXQFXHUSR
ejercen un efecto que, aunque probablemente no sea perceptible nunca, afectan
DODLQWHJULGDGGHHVHFXHUSR KD\GLIHUHQFLDVSDUWLFXODUHVSDUDFDGDFXHUSRHQ
FXDQWRDODHYHQWXDOYXOQHUDELOLGDGTXHSXHGHQPRVWUDUFRQHOWLHPSR 

&XDQWRPD\RUVHDODSUR[LPLGDGGHOSHVRRGHODSUHVLyQDODFDSDFLGDGPi[LPD
GHUHVLVWHQFLDGHOFXHUSR DPHGLGDTXHDVFHQGHPRVGHVGHODDXVHQFLDGHSHVR
RGHSUHVLyQKDVWDHOPi[LPRSHVRRPi[LPDSUHVLyQTXHSXHGHUHVLVWLUXQFXHU-
SR WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHHVHFXHUSRPDQLHVWHGHIRUPDFLR-
QHV\RGLVIXQFLRQHV\WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHODVPDQLHVWH
antes.

&XDQWRPD\RUVHDODIUHFXHQFLDFRQODTXHVRPHWHPRVXQFXHUSRDSUHVLRQHV
aunque estas se encuentren dentro de las posibilidades de resistencia del cuer-
SRWDQWRPD\RUVHUiODSUREDELOLGDGGHTXHDSDUH]FDQGHIRUPDFLRQHV\RGLV-
IXQFLRQHVHQHVHFXHUSR\WDQWRPD\RUVHUiODSUREDELOLGDGGHTXHDSDUH]FDQ
antes.

/DFRPELQDFLyQGHORVFRURODULRV\LQFUHPHQWDH[SRQHQFLDOPHQWHHOULHVJR
de deformaciones y/o disfunciones. Es decir, cuanto mayor sea la frecuencia
FRQODTXHVRPHWHPRVDXQFXHUSRDODVSUHVLRQHVPiVSUy[LPDVD DXQTXHSRU
GHEDMRGH VXFDSDFLGDGGHUHVLVWHQFLDWDQWRPD\RUVHUiODSUREDELOLGDGGHTXH
DSDUH]FDQGHIRUPDFLRQHV\RGLVIXQFLRQHVHQHVHFXHUSR\WDQWRPD\RUVHUiOD
SUREDELOLGDGGHTXHDSDUH]FDQDQWHV

Corolarios a la tercera premisa

(QWRGRVORVFDVRVFRPHQWDGRVHQORVFRURODULRVDQWHULRUHVODSUREDELOLGDGGH
TXHHOFXHUSRVHURPSDDVtFRPRGHTXHPDQLHVWHGHIRUPDFLRQHV\RGLVIXQ-
FLRQHVHVPD\RUFXDQGRODSUHVLyQVHHMHUFHVREUHHOSXQWRPiVGpELOGHHVH
cuerpo.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 245 Manual de teoras emocionales y motivacionales - UJI
&RQHVWRVDUJXPHQWRVH[SXHVWRVFODUDPHQWHVHDSUHFLDODGLFXOWDGGHHVWXGLDUXQ
IHQyPHQRFRPRHOHVWUpVHQXQiPELWRWDQUHODWLYDPHQWHDVpSWLFR\REMHWLYRFRPR
HOGHODItVLFD0XFKRPiVFRPSOHMDUHVXOWDODHPSUHVDFXDQGRVHLQWHQWDHVWXGLDU
dicho trmino desde disciplinas no tan objetivas y aspticas, como ocurre cuando
VHKDFHGHVGHHOiPELWRGHODVFLHQFLDVGHODVDOXG\GHODFRQGXFWD(QFXDOTXLHU
FDVRHOWpUPLQRSDUHFtDUHOHYDQWHSDUDYHUVXDSOLFDFLyQHQHOiPELWRGHODVFLHQ-
cias mdicas y de la propia psicologa, hecho que se ha podido constatar a lo largo
de los aos.

(OHVWUpVHQSVLFRORJtD
/DXWLOL]DFLyQGHOWpUPLQRHVWUpVHQSVLFRORJtDHVEDVWDQWHGLODWDGD6LWXYLpVHPRV
TXHHVER]DUXQDEUHYHUHVHxDGHGLFKDKLVWRULDKDEUtDTXHHQIDWL]DUODVDSRUWDFLR-
QHVGHDOJXQRVLQYHVWLJDGRUHVTXLHQHVGHVGHORViPELWRVGHODVLRORJtD\ODSVL-
cologa, han sentado las bases para conocer cmo una variable con connotaciones
SVLFROyJLFDV\FRQGXFWXDOHVSXHGHOOHJDUDHMHUFHUWDQGUDPiWLFDVFRQVHFXHQFLDV
sobre la integridad de un organismo.

(OHVWUpVGHVGHHOiPELWRGHODVLRORJtD
/RVSULPHURVLQWHQWRVHQHVWHWLSRGHLQYHVWLJDFLRQHVDQWHFHVRUDVGHODFWXDOHV-
WXGLRHQHOFDPSRGHOHVWUpVGHEHQVHUDWULEXLGRVD&ODXGH%HUQDUG  
GLVFtSXOR\D\XGDQWHGH)UDQoRLV0DJHQGLH  TXLHQMXQWRD&KDUOHV
%HOO  DXQTXHGHPRGRLQGHSHQGLHQWHGHVFXEULyODGLVWLQFLyQHQWUH
nervios sensitivos y nervios motores. Bernard acua la expresin medio interno
SDUD DUJXPHQWDU TXH ORV RUJDQLVPRV PiV HYROXFLRQDGRV VRQ DTXHOORV FDSDFHV
GHPDQWHQHUXQDFLHUWDLQGHSHQGHQFLDGHODVLQXHQFLDVGHVXPHGLRDPELHQWH
externo. Es decir, la integridad de los organismos depende en gran medida de la
integridad de su medio ambiente interno; como quiera que las continuas perturba-
ciones del medio ambiente externo en el que se desenvuelve ese organismo pue-
den afectar de manera importante a su medio ambiente interno, los organismos
PiVHYROXFLRQDGRVVHHQFXHQWUDQSURYLVWRVGHXQFRPSOHMRFRQMXQWRGHVLVWHPDV
VLROyJLFRVFX\DPLVLyQHVDPRUWLJXDUORVHYHQWXDOHVHIHFWRVQRFLYRVGHOPHGLR
ambiente externo sobre el medio ambiente interno. Como puede apreciarse, Ber-
QDUGHVWiKDFLHQGRUHIHUHQFLDLPSOtFLWDDOFRQFHSWRGHhomeostasis, que poste-
ULRUPHQWHDFXxDUi&DQQRQ

(QHIHFWR:DOWHU&DQQRQ  RULHQWDVXVWUDEDMRVLQLFLDOHVKDFLDODQDWX-


UDOH]DDGDSWDWLYDGHODUHVSXHVWDGHHVWUpVSDUDGDUFXPSOLGDFXHQWDGHODVDPHQD]DV\
GHVDItRVDOPHGLRDPELHQWHLQWHUQRGHORVRUJDQLVPRVHVWRHVGHODVDPHQD]DV\GHVD-
ItRVDODKRPHRVWDVLVGHORVRUJDQLVPRV/DUHVSXHVWDGHHVWUpVRrespuesta de lucha-
huida SDUHFtD XQ PHFDQLVPR OyJLFR \ HIHFWLYR (Q DOJXQRV GH VXV PiV FOiVLFRV
WUDEDMRV &DQQRQ GHHQGHTXHODSUHVHQFLDGHXQHVWtPXORVLWXDFLyQ
o agente perturbador en el medio ambiente externo puede provocar, cuando el su-

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 246 Manual de teoras emocionales y motivacionales - UJI
MHWRSHUFLEHHVDVVLWXDFLRQHVFRPRDPHQD]DVGHVDItRVRSHOLJURXQDPRYLOL]DFLyQ
JHQHUDOHQHORUJDQLVPR(VWDPRYLOL]DFLyQRDFWLYDFLyQJHQHUDOL]DGDWLHQHFRPR
QDOLGDGSUHSDUDUDORUJDQLVPRSDUDFRQVHJXLUXQREMHWLYREiVLFRODGHIHQVDGHVX
integridad fsica ante una eventual agresin a su homeostasis o equilibrio interno.
3DUD HOORHORUJDQLVPRGHVSOHJDUiWRGRVVXVUHFXUVRVHMHFXWDQGRXQDGHODVGRV
SRVLELOLGDGHVGHDFFLyQDGDSWDWLYDOXFKDURKXLU/DVFRQVHFXHQFLDVGHFXDOTXLHUD
GHHVWDVGRVFRQGXFWDVHVWiQUHODFLRQDGDVFRQODGHVDSDULFLyQGHODJHQWHRVLWXDFLyQ
perturbadores. Sin embargo, tal como se ha podido conocer en la actualidad, en la
formulacin de Cannon existen, al menos, dos importantes lagunas. Por una parte,
no explica qu ocurre cuando un sujeto no puede luchar contra la situacin de es-
trs porque las exigencias de esta sobrepasan con creces sus habilidades, recursos
\GLVSRQLELOLGDGSURSLDVQLSXHGHKXLUGHODVLWXDFLyQSRUTXHSRURWUDVUD]RQHV
TXL]iPiVSRGHURVDVWLHQHTXHSHUPDQHFHUHQHOOD3RURWUDSDUWHQRH[SOLFDTXp
ocurre cuando, independientemente de los recursos de un sujeto, la respuesta ofre-
cida por este no consigue hacer desaparecer la situacin de estrs, haciendo que
dicha situacin persista y se torne crnica. Esto es, con la formulacin de Cannon
solo se explica la primera respuesta de un organismo ante una situacin de peli-
JURDVXPLHQGRTXHFXDQGRDSDUHFHGLFKDUHVSXHVWDGHVDSDUHFHUiODVLWXDFLyQGH
peligro. A la primera de esas dos preguntas responden los actuales estudiosos
del estrs planteando que en la situacin de estrs existen varias posibilidades de
afrontamiento, entre las cuales, en efecto, se encuentran las de huir y luchar, pero
tambin cabe la posibilidad de resistir en la situacin tratando de mitigar o reducir
los efectos negativos de la situacin de estrs sobre la salud de la persona implica-
da. A la segunda pregunta ya respondi en su momento Selye, esgrimiendo la fase
de resistencia dentro de su modelo de estrs, y se siguen aportando respuestas a
una situacin tan comn en nuestra sociedad, en la que lo bueno no siempre es lo
mejor. No obstante, hay que sealar que la argumentacin de Cannon se centra en
la respuesta de un organismo ante una situacin de estrs agudo, mientras que la
DUJXPHQWDFLyQGH6HO\H TXHDERUGDUHPRVDFRQWLQXDFLyQ VHFHQWUDHQODUHVSXHVWD
del organismo a situaciones de estrs crnico o persistente.

&RPRLQGLFDQDOJXQRVDXWRUHV 6DSROVN\ UHULpQGRVHDODFRQGXFWDREVHU-


vada en un sujeto que se enfrenta a una situacin de estrs agudo, esta respuesta
GHHVWUpVJHQHUDOPHQWHLQWHQVDHVWiGLUHFWDPHQWHUHODFLRQDGDFRQODDFWLYDFLyQGH
ODUDPLFDFLyQVLPSiWLFDGHOVLVWHPDQHUYLRVRDXWyQRPR,PSOLFDXQDFRPSOHMD
VHULHGHFDPELRV\IXQFLRQHVHQORVVLVWHPDVGHORUJDQLVPR/RVPiVVLJQLFD-
tivos son los siguientes: a VHSURGXFHXQLPSRUWDQWHLQFUHPHQWRHQODVHFUHFLyQ
de catecolaminas desde la mdula adrenal fundamentalmente la epinefrina y la
norepinefrina; b VHSURGXFHXQLPSRUWDQWHLQFUHPHQWRHQODVHFUHFLyQGHJOXFR-
FRUWLFRLGHVGHVGHODFRUWH]DDGUHQDOc VHSURGXFHWDPELpQXQDQRWDEOHVHFUHFLyQ
de `HQGRUQDVSURODFWLQD\YDVRSUHVLQDKLSRVDULDVd VHSURGXFHXQDQRWDEOH
VHFUHFLyQGHJOXFDJyQGHVGHHOSiQFUHDVe VHSURGXFHXQDVXSUHVLyQUHODWLYDHQ
OD IXQFLRQDOLGDG GH OD UDPLFDFLyQ SDUDVLPSiWLFD GHO VLVWHPD QHUYLRVR DXWyQR-
mo, hecho este que implica, entre otras diversas manifestaciones, una apreciable
disminucin en la secrecin de hormonas sexuales, as como una reduccin en la
secrecin de la hormona de crecimiento aunque esta ltima circunstancia solo
ocurre en algunas especies, y cuando el estrs es muy prolongado.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 247 Manual de teoras emocionales y motivacionales - UJI
Estos importantes cambios permiten al organismo dar una respuesta adaptativa a
ODVLWXDFLyQGHHVWUpVDJXGR/DVYtDVPHGLDQWHODVTXHFRQVLJXHQGLFKDUHVSXHV-
ta adaptativa son las siguientes: a PRYLOL]DFLyQGHHQHUJtDb LQFUHPHQWRGHOD
actividad cardiovascular y pulmonar; c VXSUHVLyQGHORVSURFHVRVDQDEyOLFRVGH
sntesis y asimilacin; d VXSUHVLyQGHODUHVSXHVWDLQDPDWRULD\RFXUUHQFLDGHOD
analgesia inducida por estrs; e  DOWHUDFLyQ VHOHFWLYD HQ HO IXQFLRQDPLHQWR FRJ-
QLWLYR TXH VH GLULJLUi VHOHFWLYDPHQWH KDFLD DTXHOORV HYHQWRV UHODFLRQDGRV FRQ OD
produccin de estrs. Sin embargo, aunque es bien conocido en la actualidad que es-
tos cambios son imprescindibles para incrementar la probabilidad de adaptacin,
tambin conocemos que estas mismas respuestas pueden llegar a ser peligrosas e
incluso nocivas cuando se producen de una forma crnica y frecuente.

Con tales precedentes, el siguiente paso en esta breve resea se sita en los tra-
EDMRVGH+DQV6HO\H  6HO\HSXHGHVHUFRQVLGHUDGRFRPRXQRGHORV
primeros investigadores en considerar los efectos negativos de la respuesta de es-
trs. Es decir, Selye abre el camino de las investigaciones que consideran que las
respuestas de estrs, aunque positivas en un momento concreto y breve, pueden
llegar a ser claramente negativas si su recurrencia es excesiva.

&RPRFRPHQWiEDPRVDQWHULRUPHQWHODDUJXPHQWDFLyQGH6HO\HRIUHFHXQDUHV-
SXHVWDDOSODQWHDPLHQWRGH&DQQRQHQHOiPELWRGHDTXHOODVVLWXDFLRQHVHQODVTXH
ODUHVSXHVWDGHHVWUpVFRQVLGHUDGDLQWHQVDUiSLGD\DGDSWDWLYDSRU&DQQRQQRHV
VXFLHQWHSDUDKDFHUGHVDSDUHFHUODVLWXDFLyQGHHVWUpV4XHUHPRVGHIHQGHUVLQ
HPEDUJR TXH DPEDV IRUPXODFLRQHV QR VRQ H[FOX\HQWHV QL FRQWUDGLFWRULDV PiV
bien, han de ser consideradas como complementarias, pues, aunque ambos autores
KDEODQGHODUHVSXHVWDGHHVWUpV&DQQRQVHUHHUHDVLWXDFLRQHVGHHVWUpVDJXGR\
Selye a situaciones de estrs sostenido o crnico.

(OSODQWHDPLHQWRFOiVLFRGH6HO\H  VHFHQWUDHQHOGHQRPLQDGR6tQGURPHGH


$GDSWDFLyQ*HQHUDOTXHVHUHHUHDXQSDWUyQQRHVSHFtFRGHUHVSXHVWDHLPSOLFD
XQHVIXHU]RGHORUJDQLVPRSRUDGDSWDUVH\VREUHYLYLU(O6tQGURPHGH$GDSWDFLyQ
*HQHUDOFRQVLVWHHQWUHVIDVHValarma, resistencia y DJRWDPLHQWR Ante cualquier
situacin percibida como estresante por el sujeto, el organismo reacciona con la
inicial reaccin de alarma6HUHHUHHVWDIDVHDOPRPHQWRHQHOTXHVHGHWHFWDOD
presencia del estmulo o evento estresor, y que podra ser considerada como una
forma de respuesta de orientacin. Ahora bien, si no posee la respuesta apropiada
SDUDHVDVLWXDFLyQHVHYLGHQWHTXHODPLVPDSHUPDQHFHUiDPHQD]DQGRODLQWHJUL-
dad fsica y psquica del organismo. As, cuando dichas condiciones estresantes
se mantienen a lo largo del tiempo, aparece la fase de resistenciaTXHVHUHHUH
a la reaccin del organismo para superar la situacin de estrs, y que, en cierta
medida, viene a ser similar a la respuesta de lucha-huida planteada por Cannon,
esto es, la inicial consideracin de la respuesta de estrs. Esta fase consiste en el
mantenimiento de la activacin inicial mientras el organismo trata de encontrar la
respuesta apropiada a la situacin. Si, por cualquier circunstancia, el organismo
VLJXHVLQHQFRQWUDUODUHVSXHVWDDSURSLDGDDODVLWXDFLyQHQWUDHQXQDGLQiPLFDGH
progresivo cansancio y debilitamiento, apareciendo la fase de agotamiento, que se
UHHUHDODVLWXDFLyQHQODTXHHORUJDQLVPR\DQRSXHGHGDUUHVSXHVWDDODVLWXDFLyQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 248 Manual de teoras emocionales y motivacionales - UJI
y que tendra las connotaciones de inicio del riesgo serio de enfermedad. En esta
fase se observa una prdida del precario equilibrio mantenido durante la fase de
resistencia. Se observa que en esta situacin el organismo experimenta una impor-
tante disminucin en la reserva de energa y de recursos adaptativos, por lo que
en este sujeto se incrementa la probabilidad de sufrir desajustes, desequilibrios,
disfunciones, enfermedad e incluso la muerte.

Concretamente, Selye piensa que la enfermedad ocurre porque el agente estresor


produce el dao sobre el organismo cuando este ha agotado sus reservas y se ve
LQFDSD]GHUHVSRQGHUPiVRPHQRVDGDSWDWLYDPHQWH6LJXLHQGRODDUJXPHQWDFLyQ
VLROyJLFDSODQWHDGDDQWHULRUPHQWHVHSURGXFHODHQIHUPHGDGSRUTXHHQHORUJD-
nismo se han agotado las reservas de glucocorticoides, catecolaminas, etc., para
UHVSRQGHUDSURSLDGDPHQWH6LQHPEDUJRFRPRVHxDOD6DSROVN\  HVSRFR
SUREDEOH TXH OD HQIHUPHGDG SURYRFDGD SRU HO HVWUpV RFXUUD GH HVWH PRGR 0iV
bien, parece que el dao, lesin o trastorno procede del propio organismo, de tal
suerte que: a ODVPLVPDVVXVWDQFLDVVHJUHJDGDVSDUDKDFHUIUHQWHDODVLWXDFLyQ
GHHVWUpVVHWRUQDQQRFLYDVVLSHUPDQHFHQHQVDQJUHPiVWLHPSRGHODFRQVHMDEOH
b ODVUHVSXHVWDVLQWHQVDVTXHVRQDGDSWDWLYDVHQXQPRPHQWRSUHFLVR SRUHMHPSOR
ODKLSHUWHQVLyQPRPHQWiQHD OOHJDQDVHUSHOLJURVDV\QRFLYDVFXDQGRVHFURQL-
FDQc FRPRORVSURFHVRVDQDEyOLFRVVRQVXSULPLGRVPLHQWUDVHORUJDQLVPRVH
HQFXHQWUDLQPHUVRHQXQDVLWXDFLyQGHHVWUpVODVDFFLRQHVRUJiQLFDVGLULJLGDVDOD
recuperacin y reparacin tienen que producirse cuando el organismo ha superado
dicha situacin; pero si la situacin de estrs es extremadamente duradera, cabe la
posibilidad de que la postergacin de los procesos de recuperacin sea excesiva y
comiencen a aparecer lesiones y disfunciones.

En suma, el hecho de que ocurra una disfuncin, e incluso una enfermedad, como
consecuencia del estrs puede situarse, por una parte, en la imposibilidad del or-
ganismo para iniciar una apropiada respuesta ante una situacin de estrs agudo
FRQVLGHUDGD FRPR SHOLJUR R DPHQD]D R SRU RWUD SDUWH HQ OD LPSRVLELOLGDG GHO
organismo para completar apropiadamente una respuesta en una situacin de es-
WUpVFUyQLFRRGXUDGHURHVWRHVHQXQDVLWXDFLyQTXHVHSURORQJDPiVDOOiGHORV
UHFXUVRVGHORUJDQLVPR(QHOSULPHUFDVRODVFRQVHFXHQFLDVSXHGHQVHUGUDPiWL-
FDVHLQVWDQWiQHDVPLHQWUDVTXHHQHOVHJXQGRFDVRODVFRQVHFXHQFLDVSXHGHQVHU
diversas, difusas, pero en cualquier caso negativas.

(OHVWUpVGHVGHHOiPELWRGHODSVLFRORJtD
/RVGLVWLQWRVWUDEDMRVOOHYDGRVDFDERWLHQHQWDPELpQFRPRSXQWRGHUHIHUHQFLD
ODVLQLFLDOHVLQYHVWLJDFLRQHVGH+DQV6HO\H$OUHVSHFWRODXWLOL]DFLyQGHOWpUPLQR
estrs en psicologa, siendo de una gran utilidad, tal como se ha podido comprobar
a lo largo de los aos, presenta ciertas peculiaridades que no pueden ser obviadas.
3RUXQDSDUWHFRPRHVHYLGHQWHQRHVORPLVPRKDEODUGHHVWUpVHQHOiPELWRGH
ODItVLFDTXHKDFHUORHQHOiPELWRGHODSVLFRORJtD&RQFUHWDPHQWHHQHOiPELWR
de la fsica la presin se ejerce sobre un cuerpo fsico sin vida, mientras que en el
iPELWRGHODSVLFRORJtDODSUHVLyQVHHMHUFHVREUHXQFXHUSRTXHDXQTXHWDPELpQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 249 Manual de teoras emocionales y motivacionales - UJI
SRVHHODVFDUDFWHUtVWLFDVItVLFDVHVWiYLYR(VHVWDXQDGLIHUHQFLDHVHQFLDOSXHVHO
VXMHWRTXHHVWiUHFLELHQGRODSUHVLyQSXHGHFRPXQLFDUORTXHH[SHULPHQWDHQHVRV
momentos, puede enfrentarse a la situacin que provoca el estrs, puede enfren-
tarse directamente al estmulo estresante, puede huir de la situacin en la que se
produce el estmulo estresante, y, puede, cuando la huida y el enfrentamiento son
inviables, protegerse para mitigar, reducir o disminuir los efectos negativos del
DJHQWHHVWUHVRU3RURWUDSDUWHHQHOiPELWRGHODSVLFRORJtDHOHVWUpVQRVLHPSUH
tiene connotaciones negativas, ya que depende de la percepcin de cada persona.
As, cuando esta persona percibe el estrs o la presin como algo positivo, el estrs
se convierte en motivacin para conseguir objetivos.

$XQTXHHVFRQORVWUDEDMRVGH6HO\HFXDQGRVHHPSLH]DDFRQVLGHUDUODUHOHYDQFLD
GHOHVWUpVHQHOiPELWRGHODVFLHQFLDVGHODFRQGXFWDKDEtDKDELGRDOJXQDVDSRU-
taciones previas, como las procedentes de la orientacin psicoanaltica. Concre-
WDPHQWHHQODGpFDGDGHORVVHDUJXPHQWDEDTXHDOJXQRVWUDVWRUQRVFRPRHO
asma, las lceras, la hipertensin, la migraa, etc., genricamente denominados
FRQHOUyWXORGHSVLFRVRPiWLFRVHUDQFRQVLGHUDGRVFRPRODVPDQLIHVWDFLRQHVItVL-
cas de una excesiva tensin psicolgica acumulada.

$UDt]GHODDSDULFLyQGHODWHRUtDGH6HO\HFRPLHQ]DQDSUROLIHUDUORVWUDEDMRV
FHQWUDGRVHQODLQXHQFLDGHOHVWUpVVREUHODVDOXG8QRGHORVPRGHORVPiVUHFR-
QRFLGRVFLHQWtFDPHQWHHQHOSODQRSVLFROyJLFRWLHQHTXHYHUFRQHOSODQWHDPLHQWR
GHOSURIHVRU/D]DUXVTXLHQGHVGHVXVSULPHURVWUDEDMRV /D]DUXV KDYHQL-
GRHQIDWL]DQGRODLPSRUWDQFLDGHORVIDFWRUHVSVLFROyJLFRVHQHOSURFHVRGHHVWUpV
para llegar a establecer que en dicho proceso intervienen las siguientes variables:
a ODVGHPDQGDVH[LJHQFLDVGHVDItRV\DPHQD]DVGHOPHGLRDPELHQWHH[WHUQRHQ
el que se desenvuelve el sujeto; b ODVGHPDQGDV\H[LJHQFLDVTXHOHLPSRQHHOPH-
dio ambiente interno del propio sujeto; c HOEDJDMHGHUHFXUVRVDGLVSRVLFLyQGHO
sujeto, esto es, las habilidades, dominios, estrategias, y respuestas de las que puede
GLVSRQHUHVHVXMHWRSDUDGDUFXPSOLGDFXHQWDGHODSUHVLyQTXHHVWiUHFLELHQGR
d HOJUDGRGHVDWLVIDFFLyQTXHH[SHULPHQWDHVHVXMHWRHQODVLWXDFLyQSURGXFWRUD
de estrs.

Por lo que respecta a las demandas o exigencias externas, hacen referencia a una
serie de variables, entre las que se encuentran las mltiples situaciones cotidia-
nas, para las que el individuo posee una respuesta asociada que, generalmente,
es til y adaptativa. Son situaciones emanadas de la propia normativa social, que
llevan implcitas prohibiciones, recomendaciones, exigencias, etc., para las que se
requieren respuestas apropiadas. Es decir, aunque son situaciones que la persona
SXHGHFRQVLGHUDUFRPRPiVRPHQRVFRVWRVDVVDEHFyPRVROXFLRQDUODV3XHGHQ
implicar un cierto riesgo, pero, en condiciones normales, la persona controla dicho
ULHVJR'HVGHXQSXQWRGHYLVWDVLROyJLFRVHREVHUYDXQDUiSLGDHLQWHQVDUHDFWL-
YLGDGSHURWDPELpQVHSURGXFHXQDUiSLGDUHFXSHUDFLyQGHORVQLYHOHVDQWHULRUHV

/DV GHPDQGDV R H[LJHQFLDV H[WHUQDV WDPELpQ SXHGHQ SURFHGHU GH VLWXDFLRQHV


nuevas para las que la persona no tiene ninguna respuesta previamente asignada.
Son demandas que suelen venir derivadas de las situaciones de interaccin social,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 250 Manual de teoras emocionales y motivacionales - UJI
debiendo resear entre ellas las que se originan como consecuencia de las con-
diciones laborales, del hacinamiento social, del fro o calor excesivos, del ruido
intenso, de las presiones del tiempo, y de todos aquellos eventos que, en general,
VXSRQHQXQDDPHQD]DDODDXWRHVWLPD\DODVHJXULGDGGHODSHUVRQD$SDUHQWH-
mente, estas situaciones son insalvables, pues la persona no sabe cmo responder
para solucionarlas. Pueden implicar un riesgo, que se torna mayor en la medida en
ODTXHQRVHHQFXHQWUDXQDUHVSXHVWDVDWLVIDFWRULD'HVGHXQSXQWRGHYLVWDVLROy-
JLFRVHREVHUYDXQDUiSLGDHLQWHQVDUHDFWLYLGDGSHURHQHVWHFDVRODUHFXSHUDFLyQ
QRHVWDQUiSLGDFRPRHQODVVLWXDFLRQHVFRWLGLDQDVSXHVDKRUDODSHUVRQDWLHQH
que encontrar una respuesta satisfactoria. Consiguientemente, la recuperacin tar-
da un tiempo equivalente al que emplea la persona en encontrar la respuesta ade-
cuada. Cuanto mayor sea el tiempo que la persona tarda en recuperar los valores
anteriores mayor es el riesgo y el potencial dao. Probablemente tengan secuelas
sobre la integridad de la persona si esas situaciones son muy intensas o se repiten
con frecuencia y sin respuesta apropiada.

Por lo que respecta a las demandas o exigencias internasVHUHHUHQDWRGDVDTXH-


llas necesidades ntimas y personales que un individuo tiene que satisfacer peri-
dica y recurrentemente. Estas demandas o exigencias se podran agrupar en las que
SURFHGHQGHOiPELWRFRUSRUDO\ODVTXHSURFHGHQGHOiPELWRFRJQLWLYR\DIHFWLYR
(QWUH ODV GHPDQGDV SURFHGHQWHV GHO FXHUSR GHVWDFDQ ORV IDFWRUHV PiV SULPDULRV
como aquellos que se encuentran estrechamente relacionados con las motivaciones
EiVLFDV FRQGXFWDGHFRPHUFRQGXFWDGHEHEHUFRQGXFWDGHHOLPLQDFLyQFRQGXFWD
GHGRUPLURGHVFDQVDUFRQGXFWDVH[XDO 3RUUHJODJHQHUDOHQQXHVWUDVRFLHGDGQR
supone un gran problema satisfacer dichas necesidades, haciendo que las mismas
se conviertan en algo cotidiano, rutinario, sin llegar a desencadenar grandes pre-
VLRQHVHQODSHUVRQD+DELWXDOPHQWHWRGRV\FDGDXQRGHORVLQGLYLGXRVGHQXHVWUD
sociedad saben cmo responder a esas exigencias, por lo que, desde un punto de
YLVWDVLROyJLFRORPi[LPRTXHSXHGHRFXUULUHVXQDPiVRPHQRVUiSLGDHLQ-
WHQVDUHDFWLYLGDG\XQDUiSLGDUHFXSHUDFLyQ7DPELpQVHSXHGHQLQFOXLUHQWUHODV
demandas procedentes del cuerpo aquellas relacionadas con la experiencia de
algn percance, accidente o enfermedad. En estos casos la repercusin negativa
sobre la persona implicada suele ser mayor, ya que esta solo puede llevar a cabo
acciones secundarias para suprimir el estrs que experimenta. Suelen ser eventos
TXHHQJUDQPHGLGDHVFDSDQDOFRQWUROGHODSHUVRQD'HVGHXQSXQWRGHYLVWD-
VLROyJLFRODUHDFWLYLGDGHVUiSLGDHLQWHQVDSHURJHQHUDOPHQWHODUHFXSHUDFLyQ
VXHOHVHUPiVOHQWDFRQORTXHODVVHFXHODVSXHGHQVHUPD\RUHV

(QWUHODVGHPDQGDVSURFHGHQWHVGHOiPELWRFRJQLWLYR\DIHFWLYRODVPiVLPSRU-
tantes tienen connotaciones de consecucin de objetivos, logros, xito, etc. Parti-
cularmente, una de las caractersticas asociadas a este tipo de exigencias tiene que
ver con la tendencia a conseguir xitos y a evitar fracasos. Representa una variable
innata, pues todos queremos crecer biolgica, psicolgica, social y espiritualmen-
te, al tiempo que intentamos evitar los fracasos, pues estos conllevan experiencias
QHJDWLYDV/RVREMHWLYRVSHUVHJXLGRVVXHOHQVHUEDVWDQWHUHDOLVWDVDMXVWiQGRVHD
las posibilidades reales de cada persona. Son el resultado de la combinacin de la
WHQGHQFLD D FRQVHJXLU HO p[LWR \ OD WHQGHQFLD D HYLWDU HO IUDFDVR /RV REMHWLYRV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 251 Manual de teoras emocionales y motivacionales - UJI
VLHPSUHVXHOHQWHQHUXQDGLFXOWDGPHGLDOLJHUDPHQWHSRUHQFLPDGHODVSRVLEL-
OLGDGHVGHFDGDSHUVRQDSDUDTXHHVWLPXOHQVXPRWLYDFLyQ/RVREMHWLYRVH[FHVL-
YDPHQWHGLItFLOHVQRPRWLYDQDODSHUVRQDSXHVHVWDORVFRQVLGHUDLQDOFDQ]DEOHV
/RVREMHWLYRVH[FHVLYDPHQWHIiFLOHVWDPSRFRPRWLYDQDODSHUVRQDSXHVQRSRVHHQ
ningn atractivo para esta.

Por lo que respecta a las habilidades o recursos de la persona en cuestin, hacen


referencia al bagaje de respuestas adaptativas que esa persona tiene a su disposicin.
6HIXQGDPHQWDQHQODH[SHULHQFLDSUHYLD/DVUHVSXHVWDVTXHVRQ~WLOHVVHUHIXHU]DQ
\VHPDQWLHQHQ/DVUHVSXHVWDVTXHQRVRQ~WLOHVVRQVXSULPLGDVGHOUHSHUWRULR

/DVKDELOLGDGHVRUHFXUVRVWDPELpQKDFHQUHIHUHQFLDDODGHVWUH]DHQODHMHFXFLyQ
GHODVFRQGXFWDVHVSHFtFDVTXHHQ~OWLPDLQVWDQFLDVHDGTXLHUHQPHGLDQWHOD
SUiFWLFDUHSHWLGD2WUDKDELOLGDGRUHFXUVRGHODSHUVRQDWLHQHTXHYHUFRQVXFD-
SDFLGDGGHUHVLVWHQFLDTXHDODVD]yQHVHOUHVXOWDGRGHORVIDFWRUHVELROyJLFRV
\GHORVDSUHQGL]DMHVSUHYLRV2WUDKDELOLGDGVHUHHUHDODFDSDFLGDGGHHVIXHU]R\
SHUVLVWHQFLDTXHHVWiPX\UHODFLRQDGDFRQODPRWLYDFLyQGHODSHUVRQDSDUDFRQ-
VHJXLUREMHWLYRVDPD\RUPRWLYDFLyQPD\RUHVIXHU]R\SHUVLVWHQFLD

Por lo que respecta al grado de satisfaccin asociada a la situacin, hace referen-


FLDDHVDGLPHQVLyQDIHFWLYDEiVLFDTXHSHUPLWHHQWHQGHUSRUTXpXQDSHUVRQDWLHQH
la tendencia a alejarse de una situacin o a aproximarse a la misma. Si la situacin
OHDJUDGDVHSURGXFHDIHFWRSRVLWLYR SURFHVRHPRFLRQDO \VHSURGXFHVDWLVIDF-
FLyQ SURFHVRFRJQLWLYR 6LODVLWXDFLyQOHGHVDJUDGDVHSURGXFHDIHFWRQHJDWLYR
SURFHVRHPRFLRQDO \VHSURGXFHLQVDWLVIDFFLyQ SURFHVRFRJQLWLYR 

Este factor es fundamental, pues hace referencia a cmo la persona percibe la si-
tuacin independientemente del tipo de situacin. Es decir, puede que la situacin
sea objetivamente desagradable, negativa e insatisfactoria, pero si la persona no la
SHUFLEHDVtVXRUJDQLVPRQRUHDFFLRQDUiFRQODWtSLFDUHVSXHVWDGHGLVWUpV

)LQDOPHQWHDSDUWLUGHODSHUFHSFLyQTXHODSHUVRQDWHQJDGHODVLWXDFLyQ SHUFHS-
FLyQGHFRQWURO \WDOFRPR\DHVJULPLy6HO\HSRGUtDPRVHVWDEOHFHUODH[LVWHQFLD
de dos formas de estrs: eustrs y distrs. En la primera posibilidad, hablamos del
estrs con connotaciones positivas para la salud de la persona. Representa una
IRUPDEiVLFDGHPRWLYDFLyQSXHVHOVXMHWRVHVLHQWHLQFHQWLYDGRSDUDFRQVHJXLUXQ
determinado objetivo, y sabe, puede y quiere conseguirlo. En la segunda posibili-
dad, hablamos del estrs con connotaciones negativas para la salud de la persona.
$PHGLR\RODUJRSOD]RSXHGHSURGXFLUGLVIXQFLRQHVWUDVWRUQRVHQIHUPHGDG\OD
muerte. Dicha percepcin de control depende en gran medida de la disponibilidad
de recursos, las habilidades, etc., de esa persona.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 252 Manual de teoras emocionales y motivacionales - UJI
(OHVWUpVFRPRSURFHVR
En nuestro presente trabajo, defendemos que el estrs es un proceso necesario para
la vida. No es sinnimo de enfermedad, ni de trastorno. El estrs, como decamos
anteriormente, es presin, con todo lo que ello implica o puede implicar. El es-
trs es estimulante. Puede hacer progresar a las personas. Puede incrementar el
rendimiento de las personas y el bagaje de respuestas de las mismas. Pero, en un
VHQWLGRHPLQHQWHPHQWHEiVLFRHOHVWUpVHVXQSURFHVRDGDSWDWLYR,PSOLFDODDFWL-
YDFLyQGHXQFRPSOHMRVLVWHPDGHUHVSXHVWDVTXHWLHQHQFRPRREMHWLYRJDUDQWL]DU
la adaptacin ptima del organismo a cualquier situacin que implique un desafo,
DPHQD]DRSHOLJURSDUDVXLQWHJULGDGItVLFDRSVtTXLFD

'HODVP~OWLSOHVGHQLFLRQHVXWLOL]DGDVSDUDGHQLUHOHVWUpVQRVGHFDQWDPRVSRU
la que hace referencia a la presin. Sin embargo, tendramos que hacer alguna
precisin. As, podramos decir, como ha ocurrido en algunas ocasiones, que el
estrs hace referencia a los estmulos o potenciales desencadenantes de esa pre-
sin, pero los estmulos o desencadenantes lo son en la medida en la que existe
alguien que as los percibe. Por lo tanto, los estmulos, internos y/o externos,
DXQTXHQHFHVDULRVSDUDHOSURFHVRGHHVWUpVQRVRQVXFLHQWHVSDUDHOPLVPR
Podramos decir, como tambin ha ocurrido en ocasiones, que el estrs hace refe-
rencia al sistema de respuesta que se activa en un momento concreto, pero sera
XQDUJXPHQWRIDOD]\DTXHODVUHVSXHVWDVORVRQFRQUHODFLyQDDOJ~QHVWtPXORR
desencadenante. A partir de estas consideraciones, estimamos que el estrs debe
incluir unos desencadenantes, estmulos o agentes activadores; debe incluir un
sujeto u organismo receptor que perciba o tome conciencia de esos estmulos;
GHEHLQFOXLUXQVLVWHPDGHUHVSXHVWDTXHVLJXLHQGRORV\DFOiVLFRVSODQWHDPLHQ-
WRVGH/DFH\  LQFOXLUtDWUHVIRUPDVGHUHVSXHVWDODGLPHQVLyQHOHFWURFRUWL-
FDOODGLPHQVLyQVLROyJLFDDXWRQyPLFD\ODGLPHQVLyQPRWRUDREVHUYDEOH1R
REVWDQWHFDEUtDODSRVLELOLGDGGHFRPHQ]DUDGHIHQGHUODH[LVWHQFLDGHXQFXDUWR
VLVWHPDGHUHVSXHVWDUHIHULGRDODGLPHQVLyQLQPXQLWDULD$GHPiVSRUGLYHUVDV
UD]RQHVHQWUHHOODVODUHIHULGDDOKHFKRGHFRQRFHUTXHHOSURFHVRGHHVWUpVVHFRQ-
vierte en el desencadenante de procesos emocionales, queremos plantear que otro
sistema de respuesta se referira a la dimensin afectiva o emocional. En cualquier
caso, y en este momento es lo que nos interesa resear, la respuesta que ofrece el
individuo se encuentra relacionada con la percepcin que dicho individuo tiene de
la situacin o de los estmulos que le afectan, y no con la caracterstica objetiva
de la situacin o los estmulos. Es decir, la percepcin que el individuo posee de
ODVLWXDFLyQOHUHSRUWDUiXQGHWHUPLQDGRJUDGRGHVDWLVIDFFLyQRDJUDGRRGHLQVD-
tisfaccin o desagrado con esa situacin.

$GHPiV\DTXtFDEHKDEODUGHODFRQH[LyQHQWUHHVWUpV\ELHQHVWDUFRPRFRQVH-
FXHQFLDGHODSHUFHSFLyQGHFRQWUROVHSURGXFLUiQHPRFLRQHVSRVLWLYDVVLODSHU-
sona percibe que controla la situacin, o emociones negativas, en el caso de que
la persona no perciba control sobre esa situacin. Esta segunda posibilidad es la
que interesa para establecer de qu forma el estrs se encuentra asociado a la ma-
yor predisposicin de disfuncin, de trastorno, de enfermedad, incluso de muerte.
Esta segunda posibilidad es la relevante para entender la relacin del estrs con el

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 253 Manual de teoras emocionales y motivacionales - UJI
ELHQHVWDUFRQODDXVHQFLDGHELHQHVWDUSDUDVHUPiVH[DFWRV\VHUiUHYLVDGDPiV
DGHODQWH/DVLJXLHQWHJXUDLOXVWUDODLGHD

)LJXUD'LQiPLFDSURFHVDOGHOHVWUpV

/DXWLOL]DFLyQGHOWpUPLQRHVWUpVHQHOiPELWRGHODSVLFRORJtDLPSOLFDODIRUPX-
ODFLyQGHGLYHUVDVSUHJXQWDV(QWUHHOODVKHPRVHVWLPDGRTXHDOJXQDVGHODVPiV
UHOHYDQWHVVHUHHUHQDORVVLJXLHQWHVDVSHFWRVFXiOHVVRQORVGHVHQFDGHQDQWHVGHOHV-
WUpV"FXiOHVODGLIHUHQFLDHQWUHODVUHVSXHVWDVDOHVWUpV\ODVFRQVHFXHQFLDVGHOHVWUpV"
GyQGHVHVLW~DHOXPEUDOTXHGHOLPLWDHOHVWUpVSRVLWLYR\HOHVWUpVQHJDWLYR"FXiO
HVODGLIHUHQFLDHQWUHHVWUpVDJXGR\HVWUpVFUyQLFR"

'HVHQFDGHQDQWHV
En realidad, podramos decir que cualquier estmulo o acontecimiento puede con-
vertirse en desencadenante del proceso de estrs. Es algo lgico. Si sostenemos
que el proceso de estrs hace referencia a la presin o exigencia de respuesta
FXDQGR HO LQGLYLGXR VH VLHQWH LPSOLFDGR HQ HVD VLWXDFLyQ SRGHPRV DUPDU TXH
cada uno de los estmulos que le afecten tiene la capacidad para desencadenar en
pOHOSURFHVRGHHVWUpV&XDOTXLHUIDFWRUTXHVXSRQJDSHOLJURDPHQD]DGHVDItRR
posibilidad de consecucin tiene la capacidad para producir la respuesta de estrs.

En la dimensin funcional, cotidiana, es decir, aquellos acontecimientos con los


que se enfrenta un individuo a diario, nos encontramos con lo que acabamos de
resear: cualquier estmulo tiene capacidad para producir el proceso de estrs.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 254 Manual de teoras emocionales y motivacionales - UJI
/XHJR GHSHQGLHQGR GH OD FDSDFLGDG GH FRQWURO TXH SRVHD HVH LQGLYLGXR VREUH
dicho estmulo, nos encontraremos con la posibilidad de estrs positivo o con la
posibilidad de estrs negativo. Por regla general, estos acontecimientos habituales
suelen encontrarse bajo control por parte de los individuos, dando lugar a la ver-
WLHQWHSRVLWLYDGHOHVWUpVHVWRHVHOHXVWUpV/DVLWXDFLyQHVPiVLPSDFWDQWHFXDQGR
los estmulos o acontecimientos escapan al control de los sujetos.

En la dimensin disfuncional, cualquier estmulo o acontecimiento que implique


XQFDPELRLPSRUWDQWHUHVXOWHDPHQD]DQWHRVHDSHUFLELGRFRPRXQGDxRRSpUGLGD
VLJQLFDWLYDSDUDHOLQGLYLGXRHQFXHVWLyQWLHQHPXFKDSUREDELOLGDGGHGHVHQFD-
denar el proceso de estrs en su vertiente negativa. En este marco de referencia, es
conocido en la actualidad que los desencadenantes de esta forma disfuncional de
estrs pueden ser muy diversos: la enfermedad grave, propia o de un ser querido,
una discusin, el intenso ruido ambiental. Son factores que inciden de forma nota-
ble sobre la salud fsica y psquica de los individuos.

$XQTXHVHKDQSURSXHVWRQXPHURVDVFODVLFDFLRQHVGHORVHVWtPXORVRVLWXDFLR-
nes negativamente estresantes, los mejor conocidos son los denominados sucesos
vitalesORVFXDOHVDVXYH]SXHGHQVHUGHGLVWLQWDPDJQLWXG$VLPLVPRDOJXQDV
FDUDFWHUtVWLFDVGHORVHVWUHVDUHVDPELHQWDOHV SRUHMHPSORGHOWUDEDMR WDPELpQKDQ
sido objeto de estudio.

Sucesos vitales

/DYLGDGHODVSHUVRQDVSXHGHYHUVHVDOSLFDGDSRUDFRQWHFLPLHQWRVHVSHFLDOPHQWH
impactantes y de gran trascendencia, tales como, por ejemplo, la muerte de un ser
querido, la prdida del trabajo, el matrimonio, la maternidad y el divorcio.

Se ha encontrado que estos sucesos suponen un gran cambio vital para las perso-
QDVTXHORVH[SHULPHQWDQDVtFRPRIXHUWHVGHPDQGDVGHDGDSWDFLyQ7HQHUXQKLMR
SRUHMHPSORLPSOLFDXQFDPELRGUiVWLFRHQODYLGDGHODPD\RUtDGHODVSHUVRQDV
6LDGHPiVHVWRVDFRQWHFLPLHQWRVVHVRODSDQXQRVFRQRWURVODDGDSWDFLyQSXHGH
FRPSOLFDUVH+D\QXPHURVRVHVWXGLRVTXHPXHVWUDQTXHFXDQGRODVSHUVRQDVH[-
perimentan muchos sucesos de este tipo en relativamente poco tiempo, aumentan
las probabilidades de sufrir un estrs intenso y de desarrollar enfermedades.

/RVVXFHVRVYLWDOHVVRQH[SHULHQFLDVREMHWLYDVTXHGHVRUJDQL]DQRDPHQD]DQFRQ
GHVRUJDQL]DU ODV DFWLYLGDGHV XVXDOHV GH OD SHUVRQD UHTXLULHQGR FDPELRV LPSRU-
tantes en su conducta 'RKUHQZHQG 3DUDPHGLUORVKDFHYDULDVGpFDGDV
+ROPHV\5DKH  FUHDURQHOSULPHUOLVWDGRGHVXFHVRVYLWDOHVFRQRFLGRFRPR
(VFDODGH5HDMXVWH6RFLDO(VWDHVFDODLQFOXtDVXFHVRVFRPRSRUHMHPSORHO
PDWULPRQLRODPXHUWHGHOFyQ\XJH\ODSpUGLGDGHOWUDEDMR/DWDEODUHFRJHORV
VXFHVRV\HOFDPELRYLWDOSURPHGLRDVRFLDGR

Para calcular el cambio vital total experimentado por una persona, se suman las uni-
dades de cambio vital correspondientes a cada acontecimiento experimentado por

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 255 Manual de teoras emocionales y motivacionales - UJI
GLFKDSHUVRQDGXUDQWHHO~OWLPRDxR/DVXPDUHVXOWDQWHVHFRQVLGHUDXQLQGLFDGRU
de la cantidad de estrs experimentado, y se supone que, a mayor puntuacin,
mayor riesgo de desarrollar problemas de salud fsica y mental. As, por ejemplo,
una mujer que en los ltimos meses se ha casado, ha pedido una hipoteca impor-
WDQWHSDUDODFRPSUDGHOSLVR\VHKDTXHGDGRHPEDUD]DGDVXPDUtDXQLGDGHV
 /DVSXQWXDFLRQHVUHIHULGDVDO~OWLPRDxRLQIHULRUHVDSXQWRV
LQGLFDQXQDSUREDELOLGDGPHQRUGHOGHGHVDUUROODUXQDHQIHUPHGDGUHODFLRQD-
GDFRQHOHVWUpVSXQWXDFLRQHVHQWUH\LQGLFDQXQDSUREDELOLGDGGHO
\SXQWXDFLRQHVVXSHULRUHVDORVSXQWRVWHQGUtDQXQULHVJRGHO

Pequeos sucesos cotidianos

/DPD\RUSDUWHGHORVGtDVQRH[SHULPHQWDPRVDFRQWHFLPLHQWRVWDQLPSRUWDQWHV
como los descritos en el apartado anterior. Sin embargo, a diario ocurren otros
sucesos de mucho menos calibre que, actuando acumulativamente, pueden produ-
cir tambin un intenso desajuste. En este caso, hablamos de demandas irritantes
y frustrantes, relaciones que nos bombardean da tras da. Aspectos tericamente
controlables, como perder un autobs, olvidar en casa algo que necesitamos, reci-
ELUXQDFUtWLFDSRUDOJRTXHKHPRVKHFKRHOPDOWLHPSRXQDWDVFRGHWUiFRXQD
leve discusin, pueden llegar a producir una importante respuesta de estrs cuando
varios de ellos ocurren en el mismo momento, o separados por muy poco espacio
de tiempo.

0XHUWHGHOFyQ\XJH 
'LYRUFLR 
6HSDUDFLyQPDWULPRQLDO 
(QFDUFHODPLHQWR 
)DOOHFLPLHQWRGHXQPLHPEURGHODIDPLOLD 
(QIHUPHGDGRDFFLGHQWHSHUVRQDOJUDYH 
0DWULPRQLR 
'HVSLGRODERUDO 
9. Reconciliacin con el cnyuge 
-XELODFLyQ 
&DPELRLPSRUWDQWHHQHOHVWDGRGHVDOXGRFRQGXFWDGHXQPLHPEURGHODIDPLOLD 
(PEDUD]R 
'LFXOWDGHVVH[XDOHV 
,QFRUSRUDFLyQGHXQQXHYRPLHPEURDODIDPLOLD SRUQDFLPLHQWRDGRSFLyQWUDVODGRHWF 
&DPELRRUHDMXVWHODERUDOLPSRUWDQWH 
&DPELRLPSRUWDQWHHQODVLWXDFLyQHFRQyPLFD 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 256 Manual de teoras emocionales y motivacionales - UJI
0XHUWHGHXQDDPLVWDGFHUFDQD 
&DPELRGHWLSRGHWUDEDMR 
&DPELRLPSRUWDQWHHQHOQ~PHURGHGLVSXWDVFRQ\XJDOHV 
+LSRWHFDRSUpVWDPRGHJUDQFXDQWtD 
&DQFHODFLyQGHXQDKLSRWHFD 
&DPELRLPSRUWDQWHHQODVUHVSRQVDELOLGDGHVODERUDOHV 
(OKLMRRKLMDGHMDQHOKRJDU 
3UREOHPDVFRQORVVXHJURV 
e[LWRSHUVRQDOGHJUDQHQYHUJDGXUD 
(OFyQ\XJHFRPLHQ]DRGHMDGHWUDEDMDUIXHUDGHFDVD 
&RPLHQ]RRQDOL]DFLyQGHHVWXGLRV 
&DPELRLPSRUWDQWHHQODVFRQGLFLRQHVGHYLGD 
&DPELRHQKiELWRVSHUVRQDOHV 
3UREOHPDVFRQHOMHIH 
&DPELRLPSRUWDQWHHQHOKRUDULRRFRQGLFLRQHVODERUDOHV 
&DPELRGHUHVLGHQFLD 
&DPELRGHFHQWURHVFRODU 
&DPELRLPSRUWDQWHHQWLSR\FDQWLGDGGHWLHPSRGHRFLR 
&DPELRLPSRUWDQWHHQDFWLYLGDGHVUHOLJLRVDV 
&DPELRLPSRUWDQWHHQDFWLYLGDGHVVRFLDOHV 
+LSRWHFDRSUpVWDPRGHSHTXHxDFXDQWtD 
&DPELRHQORVKiELWRVGHOVXHxR 
&DPELRHQODIUHFXHQFLDGHUHXQLRQHVIDPLOLDUHV 
&DPELRHQODVFRVWXPEUHVDOLPHQWLFLDV 
9DFDFLRQHVIXHUDGHFDVD 
)LHVWDVLPSRUWDQWHVFRPR1DYLGDG 
3HTXHxDVLQIUDFFLRQHVOHJDOHVFRPRSRUHMHPSORPXOWDVGHWUiFR 

7DEOD$FRQWHFLPLHQWRVUHFRJLGRVHQOD(VFDODGH5HDMXVWH6RFLDO
GH+ROPHV\5DKH 

1RWD(OYDORULQGLFDGRHQODFROXPQDGHUHFKDUHSUHVHQWDODVXQLGDGHVGHFDPELRYLWDO
DVRFLDGDVDFDGDVXFHVR

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 257 Manual de teoras emocionales y motivacionales - UJI
Catstrofes

(QHORWURH[WUHPRGHORVSHTXHxRVVXFHVRVYLWDOHVHVWiQODVJUDQGHVFDWiVWURIHV
como terremotos, inundaciones o huracanes. Estos estresores tienen de particular
TXHDIHFWDQDPXFKDVSHUVRQDVDODYH]FDXVDQGRJUDQGHVVHFXHODVHQVXVDOXG\
circunstancias vitales, e incluso causando muchas muertes.

+D\QXPHURVRVHVWXGLRVTXHPXHVWUDQODVLPSRUWDQWHVFRQVHFXHQFLDVSDUDODVDOXG
PHQWDOGHODVSHUVRQDVTXHVREUHYLYHQDXQDFDWiVWURIH1RVRODPHQWHODVYtFWLPDV
directas experimentan problemas de salud, sino que tambin se ven muy afecta-
dos los familiares de estas, los grupos de personas implicadas en tareas de rescate
ERPEHURVSHUVRQDOVDQLWDULRSROLFtDHWF \ODSREODFLyQHQJHQHUDO(QWUHORV
SUREOHPDVSVLFROyJLFRVPiVIUHFXHQWHVVHHQFXHQWUDQHOWUDVWRUQRSRUHVWUpVSRV-
WUDXPiWLFRODGHSUHVLyQHOWUDVWRUQRGHSiQLFR\FRQGXFWDVUHODFLRQDGDVFRQHO
consumo de alcohol y sustancias.

A los desastres naturales, como huracanes y terremotos, se unen los desastres cau-
sados por los propios seres humanos. Estos pueden adoptar la forma de contami-
QDFLyQUDGLRDFWLYDDWDTXHVWHUURULVWDV\FRQLFWRVEpOLFRVHQWUHRWURV$OSDUHFHU
VXLPSDFWRSXHGHVHUPiVWUDXPDWL]DQWHTXHHOGHORVGHVDVWUHVQDWXUDOHVFDXVDQGR
PiVVHFXHODVSVLFROyJLFDV3RUHMHPSORWUDVORVDWHQWDGRVWHUURULVWDVGHOGHPDU-
]RGHHQ0DGULGTXHFDXVDURQIDOOHFLPLHQWRV\HQWRUQRDKHULGRV
VHHQFRQWUyTXHHQWUHODVYtFWLPDV\IDPLOLDUHVGHHVWDVHOH[SHULPHQWDURQ
DWDTXHVGHSiQLFRHOGHVDUUROOyGHSUHVLyQ\HOWUDVWRUQRSRUHVWUpV
SRVWUDXPiWLFR

Los ambientes humanos

)LQDOPHQWH ODV FDUDFWHUtVWLFDV GHO DPELHQWH R FRQWH[WR GRQGH YLYLPRV WDPELpQ


pueden ser fuentes de estrs. En este sentido, los ambientes laboral y familiar,
GHELGRDVXLPSRUWDQFLDHQQXHVWUDYLGDVRQHVSHFLDOPHQWHUHOHYDQWHV/RVDP-
bientes humanos, al igual que las personas, tienen una serie de rasgos o dimensio-
QHVTXHGHQHQVXSURSLDpersonalidad. Algunas de estas caractersticas, como el
FRQLFWRRODIDOWDGHFODULGDG\FRKHVLyQSXHGHQDIHFWDUDOELHQHVWDU\VDOXGGH
las personas que conviven en dichos ambientes.

(QORV~OWLPRVDxRVHOHVWUpVHQiPELWRVODERUDOHVKDUHFLELGRXQDJUDQDWHQFLyQ\HQ
ODDFWXDOLGDGVHFRQVLGHUDXQRGHORVULHVJRVSVLFRVRFLDOHVPiVLPSRUWDQWHVSDUDODV
SHUVRQDVHQHOWUDEDMR(QODWDEODVHPXHVWUDQDOJXQDVIXHQWHVGHHVWUpVODERUDO

Algunas profesiones, por sus caractersticas y el contexto en que se ejercen, tienen


PiVULHVJRGHVHUHVWUHVDQWHV3RUHMHPSORHOSURIHVRUDGR\HOSHUVRQDOVDQLWDULR
son colectivos profesionales que han suscitado un gran inters. Cuando la expe-
riencia de estrs laboral se prolonga en el tiempo, puede desencadenar lo que
se conoce como Sndrome de Burnout RVtQGURPHGHOTXHPDGR (OSDWUyQGH
reacciones descritas como burnout daa seriamente la habilidad de la persona en

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 258 Manual de teoras emocionales y motivacionales - UJI
su trabajo. Sus sentimientos se vuelven negativos, se desarrolla una actitud de ci-
QLVPRVHSLHUGHODLPSOLFDFLyQFRQORVGHPiVDXPHQWDQODVHQIHUPHGDGHVItVLFDV
y mentales y el absentismo y, en ocasiones, el consumo de drogas y alcohol.

Contenidos del Trabajo

7DUHDVGHVDJUDGDEOHVGHOSXHVWRTXHGHEHQOOHYDUVHDFDER3RUHMHPSORdar malas no-


WLFLDVUHVROYHUGLVSXWDVSUREOHPDVHGLVFLSOLQD
/DHMHFXFLyQHQHOWUDEDMRGHRWURVFRPSDxHURVFXDQGRHOVXMHWRSHUFLEHTXHDIHFWDDO
propio. Por ejemplo: errores, baja calidad, etc.
El ritmo de trabajo, cuando es excesivo o demasiado lento.
Riesgos profesionales. Por ejemplo: agresiones por parte de alumnos violentos en el
caso de profesorado, contagios en el caso de personal sanitario, etc.

Contexto de trabajo

/DVDFWLWXGHV\FRQGXFWDGHRWUDVSHUVRQDVKDFLDHOWUDEDMR\ORVWUDEDMDGRUHV3RUHMHP-
SORODJHQWHTXHQRHVFXFKDIDOWDGHKRQUDGH]QRFXPSOLUORVFRPSURPLVRVHWF
(OWLHPSR3RUHMHPSORQRKD\WLHPSRVXFLHQWHGHPDVLDGRWUDEDMRSUHVLRQHVKRUDV
extraordinarias.
Inhibidores del trabajo. Ejemplos: interrupciones, regulaciones del gobierno, la familia,
reuniones, burocracia, procesos de toma de decisiones, tareas adicionales, etc.
7HPDVGHSRGHU\MXHJRVSROtWLFRV
&RPXQLFDFLyQUHODFLRQDGDFRQODWDUHD3RUHMHPSORLQVXFLHQWHLQIRUPDFLyQIDOWDGH
UHWURDOLPHQWDFLyQ\DPELJHGDGHQODUHVSRQVDELOLGDGGHOSXHVWR
)DOWDGHUHFXUVRV
5HODFLRQHVLQWHUSHUVRQDOHV3RUHMHPSORFRQLFWRVIDOWDGHFRRSHUDFLyQHWF
Condiciones fsicas en que uno trabaja. Por ejemplo: ruido y falta de espacio.

7DEOD$OJXQRVGHVHQFDGHQDQWHVGHHVWUpVHQHOWUDEDMR

5HVSXHVWDV\FRQVHFXHQFLDV
8QRGHORVDVXQWRVTXHPiVQRVOODPDODDWHQFLyQVHUHHUHDODUHOHYDQFLDGHOD
subjetividad en la percepcin de estrs. En efecto, un mismo estmulo puede ser
SHUFLELGRGHIRUPDGLIHUHQWHSRUGLIHUHQWHVLQGLYLGXRV3HURDGHPiVHVHPLVPR
estmulo puede ser percibido de forma diferente por el mismo individuo en distin-
tos momentos. /DVFRVDVQRVRQFRPRVRQVLQRFRPRXQRODVSHUFLEH. Semejante
VHQWHQFLDHQHOPiVSXURHVWLORDULVWRWpOLFRSRQHGHUHOLHYHODLPSRUWDQFLDGHOD
subjetividad: para un individuo, el mundo, las cosas, son tal como las percibe, tal
como las interpreta, tal como las valora. Sin embargo, es un hecho incontrovertible
que, independiente de cmo percibamos y valoremos las cosas, las cosas son como
VRQODVFRVDVVRQORTXHVRQ(VWD~OWLPDDSUHFLDFLyQQRVSHUPLWHHQIDWL]DUOD
objetividad de los acontecimientos.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 259 Manual de teoras emocionales y motivacionales - UJI
(Q~OWLPDLQVWDQFLDWHQHPRVXQDFRQWUDSRVLFLyQ IDOVD HQWUHODVXEMHWLYLGDG\OD
objetividad. Este detalle ha llevado en ocasiones a que algunos confundan lo que
HV OD UHVSXHVWD GH HVWUpV FRQ OR TXH VRQ ODV FRQVHFXHQFLDV GHO HVWUpV Palmero,
%UHYD\(VSLQRVD .

/D UHVSXHVWD GH HVWUpV HV XQD UHDFFLyQ GLUHFWDPHQWH DVRFLDGD D OD HYDOXDFLyQ \
YDORUDFLyQTXHXQLQGLYLGXRUHDOL]DVREUHXQHVWtPXORRDFRQWHFLPLHQWRVLHQOD
puerta aparece un tigre, pero el individuo percibe, evala y valora que se trata de
XQJDWRVXVUHVSXHVWDVVHUiQFRQFRUGDQWHVFRQHVRVSURFHVRVFRJQLWLYRVTXHDFDED
GHUHDOL]DUHVWRHVUHDFFLRQDUiFRPRVLGHXQJDWRVHWUDWDUD2ORTXHHVORPLVPR
las respuestas de un individuo en una situacin de estrs dependen de cmo perciba
\YDORUHHVHLQGLYLGXRGLFKDVLWXDFLyQ/DVUHVSXHVWDVGHSHQGHQGHODVXEMHWLYLGDG

/DVFRQVHFXHQFLDVGHOHVWUpVVHHQFXHQWUDQGLUHFWDPHQWHDVRFLDGDVDODQDWXUDOH]D
del estmulo que afecta a un individuo. Podramos plantear que se trata de la capa-
cidad objetiva de los agentes estresores para producir aquellos efectos que les son
inherentes. Si retomamos el anterior ejemplo del tigre que es percibido como un
JDWRYHPRVFyPRLQGHSHQGLHQWHPHQWHGHODSHUFHSFLyQ\YDORUDFLyQTXHUHDOL]D
HOVXMHWR\TXHGHWHUPLQDQODUHVSXHVWDTXHHVWHRIUHFHUiODSURSLDQDWXUDOH]DGHO
estmulo en cuestin posee una capacidad inherente para producir unos efectos o
consecuencias determinadas. Es decir, las consecuencias de una situacin de estrs
SDUDXQLQGLYLGXRGHSHQGHQGHODQDWXUDOH]DGHOHVWtPXORTXHSURGXFHHVWUpV

&RPRSDUHFHREYLRORPiVDGDSWDWLYR\VDOXGDEOHSDUDXQLQGLYLGXRFRQVLVWHHQ
SHUFLELU\YDORUDUORPiVDFHUWDGDPHQWHSRVLEOHORVGLYHUVRVDFRQWHFLPLHQWRVFX-
DQWR PiV VH DSUR[LPH OD VXEMHWLYLGDG D OD REMHWLYLGDG PiV FRUUHFWDV VHUiQ ODV
conductas que lleve a cabo un individuo.

(VHVWHXQKHFKRVLVWHPiWLFDPHQWHUHOHJDGR\DTXHVHKDIRFDOL]DGRODDWHQFLyQ
FLHQWtFDHQODVYDULDEOHVVXEMHWLYDVUHODFLRQDGDVFRQODSHUFHSFLyQ\YDORUDFLyQ
TXHXQLQGLYLGXRUHDOL]DFDGDYH]TXHVHHQIUHQWDDXQDVLWXDFLyQGHHVWUpV/D
consideracin de la importancia de la percepcin del sujeto a la hora de entender
si una situacin generadora de estrs puede desencadenar consecuencias negativas
ha tenido como consecuencia que la percepcin sea entendida como una especie
GHOWURRYDULDEOHPRGXODGRUDTXHSHUPLWHHQWHQGHUa FyPRGLVWLQWRVVXMHWRV
VRPHWLGRVDXQDPLVPDVLWXDFLyQGHHVWUpVFRQFHSWXDOL]DQHVWDGHPRGRGLVWLQWR
atribuyndole a dicha situacin distintas connotaciones de presin; b FyPRLQ-
cluso, un mismo sujeto puede considerar una misma situacin con distintas con-
notaciones de presin en distintos momentos; c FyPRDPHGLR\RODUJRSOD]R
los sujetos que perciben esa situacin como estresante tienen una mayor proba-
bilidad de enfermar o de desarrollar trastornos que los sujetos que no perciben la
situacin como estresante. Sin embargo, creemos que habra que considerar tam-
bin la eventual capacidad objetiva de ciertas situaciones estresantes para producir
GLVIXQFLRQHVOHVLRQHVRWUDVWRUQRVDPHGLR\RODUJRSOD]RPiVDOOiLQFOXVRGHOD
percepcin que el sujeto tenga de dichas situaciones. Esto es, puede ocurrir que
una persona no perciba como estresante una situacin, pero esa situacin tiene una
capacidad objetiva para producir dao. Se estara produciendo una disociacin de

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 260 Manual de teoras emocionales y motivacionales - UJI
respuesta: la reactividad subjetiva-cognitiva del sujeto sera baja, pero la reactivi-
GDGVLROyJLFDDXWRQyPLFDVHUtDHOHYDGD(QHVWDVVLWXDFLRQHVHOVXMHWRQRVHUtD
FRQVFLHQWHGHODH[FHVLYDUHDFWLYLGDGVLROyJLFD\VLIXHUDFRQVFLHQWHGHHOODQR
ODDWULEXLUtDDODVLWXDFLyQTXHGHVHQFDGHQDHVDLPSRUWDQWHUHVSXHVWDVLROyJLFD
\DTXHVLIXHVHFRQVFLHQWHGHODUHDFWLYLGDGVLROyJLFDRODDWULEX\HVHDHVDVLWX-
acin, subjetiva y cognitivamente tambin habra una importante reactividad. As
pues, hay situaciones capaces de producir una disociacin entre repuesta cogni-
WLYDVXEMHWLYD\UHVSXHVWDVLROyJLFD(VWHKHFKRHVLPSRUWDQWHGHVGHORVSODQRV
metodolgico y conceptual, pero tambin es importante desde el punto de vista del
equilibrio, la homeostasis, la integridad y la salud de la persona en cuestin.

8PEUDOSVLFROyJLFRGHHVWUpV
Se trata tambin de un asunto de inters. Defendemos la existencia de un umbral
de estrs o umbral psicolgico de estrs, que permitira entender cmo una deter-
minada situacin es percibida como distrs por una persona y como eustrs por
otra persona, e incluso cmo en una misma persona la misma situacin podra
VHUSHUFLELGDHQXQDRFDVLyQFRPRGLVWUpV\HQRWUDRFDVLyQFRPRHXVWUpV9HD-
mos cmo es posible esta circunstancia. Por umbral psicolgico de estrs entendemos
aquel margen hipottico que separa las situaciones susceptibles de control de aquellas
otras que escapan al control de una persona. Es decir, el umbral psicolgico de
estrs hara referencia a una eventual barrera de proteccin; cuando la intensidad
del estmulo o situacin a la que se enfrenta el sujeto supera esa barrera, el sujeto
pierde el control de la situacin y se produce distrs, mientras que, si la intensidad
GHOHVWtPXORQRVXSHUDHVDEDUUHUDGHSURWHFFLyQHOVXMHWRVHUiFDSD]GHFRQWURODU
la situacin, producindose en este caso eustrs. Desde el punto de vista de la salud
fsica y psquica de un sujeto, lo ideal sera que este umbral psicolgico de estrs fuera
ORPiVHOHYDGRSRVLEOH\DTXHGHHVHPRGRPD\RUWHQGUtDTXHVHUODLQWHQVLGDGGHORV
estmulos para superar ese umbral.

Es importante resear que el umbral psicolgico de estrs evoluciona con el tiem-


po, de tal suerte que en los primeros momentos de vida de cualquier persona dicho
umbral es muy bajo, pues este individuo apenas tiene estrategias de respuesta para
poder solucionar los mltiples problemas que se le presentan; consiguientemente,
FXDOTXLHUHVWtPXORSRULQVLJQLFDQWHTXHVHDHVFDSD]GHVXSHUDUHOLQFLSLHQWHXP-
EUDOSVLFROyJLFRGHHVWUpVGHHVWDSHUVRQDSURYRFiQGROHGLVWUpV&RQIRUPHDXPHQWD
ODHGDGGHOLQGLYLGXRHOQ~PHURGHHVWUDWHJLDVGHUHVSXHVWDDGTXLULGDVVHUiPD\RU
SRUORTXHVHUiPiVGLItFLOTXHORVHVWtPXORVSUHVHQWDGRVVXSHUHQGLFKRXPEUDO
GHHVWUpV3RUORWDQWRHVWHXPEUDOVHGHVSOD]DDVFHQGHQWHPHQWHDPHGLGDTXHHO
VXMHWRDGTXLHUHPiVHVWUDWHJLDVGHUHVSXHVWD

+D\TXHUHFDOFDUTXHHVWHXPEUDOQRVHSXHGHXELFDUHQXQSXQWRFRQFUHWRSDUD
una edad concreta, sino que es particular, y depende de las experiencias que anteri-
RUPHQWHKD\DWHQLGRHOVXMHWR3RUHMHPSORXQLQGLYLGXRGHDxRVGHEHUtDWHQHU
XQXPEUDOPiVEDMRTXHRWURGH\DTXHVHVXSRQHTXHHOGHKDWHQLGRPiV
tiempo para experimentar sobre posibles respuestas de adaptacin; no obstante,

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 261 Manual de teoras emocionales y motivacionales - UJI
esto no tiene por qu ser as, ya que las circunstancias propias del primer sujeto
SXHGHQKDEHUKHFKRTXHDGTXLHUDPiVHVWUDWHJLDVGHUHVSXHVWDTXHHORWURDQWHODV
PLVPDVVLWXDFLRQHVORTXHLPSOLFDUtDTXHSRVHHXQXPEUDOPiVHOHYDGRGHHVWUpV
$GHPiVHVQHFHVDULRWHQHUHQFXHQWDODVGLIHUHQFLDVVLROyJLFDVLQGLYLGXDOHVDVt
como la situacin actual, y no solo hay que considerar las experiencias anteriores.

Este umbral se eleva con la experiencia del sujeto, pero tiene un momento en el
TXHVHHVWDELOL]DSRUTXHGLFKRLQGLYLGXRWLHQHPXFKDVHVWUDWHJLDV\KDDGTXLULGR
muchas respuestas, y porque la mayor parte de los estmulos y situaciones a los
que se enfrenta ya le son conocidos y posee las habilidades y recursos apropiados.
A partir de este momento, el umbral va disminuyendo. Esto no quiere decir que el
individuo pierda estrategias o que las haya olvidado, sino que fsica o biolgica-
mente hay un desgaste, dejando al individuo incapacitado para dar una respuesta
DGDSWDWLYDDGHFXDGDHVGHFLUVLJXHWHQLHQGRODVHVWUDWHJLDVSHURHVLQFDSD]GH
XWLOL]DUODVFRUUHFWDPHQWH

Podramos plantear que existe un umbral psicolgico de estrs para cada actividad
TXHUHDOL]DXQVXMHWR(VWRVXPEUDOHVHVSHFtFRVGHHVWUpVQRVHHQFXHQWUDQFRU-
relacionados, por lo que puede ocurrir que una persona posea un elevado umbral
de estrs para un tipo de actividades y un muy reducido umbral de estrs para otras
actividades.

En cualquier caso, se trata de una variable personal, subjetiva. Solo el individuo


FRQRFHKDVWDGyQGHSXHGHOOHJDUHQFDGDRFDVLyQFRQRFHFXiOHVVRQORVOtPLWHV
que le llevan desde la percepcin de control hasta la prdida de ese control.

(VWUpVDJXGR\HVWUpVFUyQLFR
Podramos decir que la diferencia esencial entre el estrs agudo y el estrs crni-
co radica en la duracin del acontecimiento estresante. El estrs agudo, tambin
GHQRPLQDGRHVWUpVIiVLFRKDFHUHIHUHQFLDDXQDVLWXDFLyQGHSUHVLyQSDVDMHUDGH
corta duracin, pudiendo ser muy intensa y con capacidad para producir efectos
irreversibles. Por su parte, el estrs crnico, tambin denominado estrs tnico,
hace referencia a una situacin de presin que se prolonga en el tiempo. El grado o
intensidad de dicha presin puede ser tambin muy intensa, ocasionando tambin
efectos devastadores en el individuo que la experimenta.

8QRGHORVSURFHGLPLHQWRVPiVXVDGRVSDUDHVWDEOHFHUHOWLSRGHHVWUpV DJXGRR
FUyQLFR TXHH[SHULPHQWDHOLQGLYLGXRFRQVLVWHHQHVWDEOHFHUHOYDORUGHFLHUWRV
SDUiPHWURVVLROyJLFRVFRQFUHWDPHQWHDTXHOORVUHIHULGRVDOIXQFLRQDPLHQWRFDU-
GLRYDVFXODU'HKHFKRORVtQGLFHVFDUGLDFRV\YDVFXODUHVVRQXQHOUHHMRGHOD
activacin, respuesta y reactividad del organismo ante situaciones de estrs. De
HQWUH ORV GLVWLQWRV SDUiPHWURV FDUGLRYDVFXODUHV VH KD SRGLGR FRPSUREDU HQ ORV
ltimos tiempos que la reactividad es el que mejores pronsticos ofrecen a la hora
de entender los efectos negativos del estrs.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 262 Manual de teoras emocionales y motivacionales - UJI
As, conocemos hoy que la reactividad cardiaca no presenta un patrn comn a
todos los organismos cuando estos se hallan inmersos en una situacin estresante,
PRVWUiQGRVHXQDYDULDELOLGDGTXHVHSXHGHHQFXDGUDUHQWUHVSDWURQHVJHQHUDOHV

Un primer patrn en el que la reactividad se incrementa inicialmente, producin-


dose una progresiva disminucin de dicha reactividad si el individuo permanece
en la situacin durante algn tiempo.

Un segundo patrn, en el que, tras un incremento inicial de la reactividad, se ob-


serva que esta se mantiene constante durante todo el periodo de permanencia del
individuo en dicha situacin.

Un tercer patrn, en el que el individuo responde ante la situacin estresante con


XQDHOHYDGDUHDFWLYLGDGFDUGLRYDVFXODUTXHFRQWLQ~DLQFUHPHQWiQGRVHSDXODWLQD-
mente durante todo el episodio estresante.

Estos diferentes patrones de reactividad cardiovascular pueden estar asociados a


distintas probabilidades de sufrir trastornos en general, puesto que sus repercusio-
nes para la homeostasis del organismo se muestran distintas. As, el primero de los
SDWURQHVSUHVHQWDGRVSDUHFHPRVWUDUVHFRPRHOPiVDGDSWDWLYRSDUDHORUJDQLVPR
SXHVWRTXHDODVHQVLELOL]DFLyQLQLFLDOTXHSUHSDUDUtDDOLQGLYLGXRSDUDXQDIURQ-
tamiento de la situacin, le sigue una habituacin gradual a esta, hecho necesario
para no daar al organismo. Sin embargo, el segundo y tercero de los patrones
podran implicar efectos perniciosos para la homeostasis del organismo al mos-
trar, respectivamente, una falta de habituacin y un incremento continuado de la
DFWLYDFLyQ 3DOPHUR%UHYD\(VSLQRVD3DOPHUR(VSLQRVD\%UHYD 

$QXHVWURHQWHQGHUFDEHUHDOL]DUDOJXQDVPDWL]DFLRQHV3RUXQODGRUHVSHFWRDO
PHFDQLVPR VLROyJLFR TXH XQH FLHUWRV DVSHFWRV SVLFRVRFLDOHV HQWUH HOORV HO UH-
IHULGR DO iPELWR ODERUDO  \ ODV HQIHUPHGDGHV FDUGLRYDVFXODUHV \ SRU RWUR ODGR
UHVSHFWRDORVHVWtPXORVRVLWXDFLRQHVHVWUHVDQWHVTXHVHOOHYDQXWLOL]DQGRHQOD
investigacin.

a 5HVSHFWRDOPHFDQLVPRVLROyJLFRGHXQLyQHQWUHIDFWRUHVVRFLDOHV\ODSUR-
babilidad de disfuncin o enfermedad, la reactividad cardiovascular parece la
YDULDEOH LPSOLFDGD 6LVWHPiWLFDPHQWH HQ ODV LQYHVWLJDFLRQHV OOHYDGDV D FDER
se ha tenido en cuenta la magnitud del cambio ocurrido tras la aparicin de un
estresor, dejando de lado la relevancia de la consideracin del tiempo que el
RUJDQLVPRWDUGDHQUHFXSHUDUVHWUDVHOHQIUHQWDPLHQWR 3DOPHUR\*DUFtD/HyQ
 3DOPHUR &RGLQD \ 5RVHO   (Q OD PHGLGD HQ TXH XQ RUJDQLVPR
HVWiVRPHWLGRDXQDDFWLYDFLyQH[FHVLYDGXUDQWHSHULRGRVGHWLHPSRGHPDVLDGR
SURORQJDGRVORVHIHFWRVGHHVHHVIXHU]RFDUGLRYDVFXODUSXHGHQUHVXOWDUSHUMX-
diciales para el organismo.

$GHPiVODUHDFWLYLGDGVXHOHGLVPLQXLU IHQyPHQRGHKDELWXDFLyQ FXDQGRHOHSL-


VRGLRHVWUHVDQWHVHSURORQJD .HOVH\ 6LQHPEDUJRWDPELpQHVLPSRUWDQWH
en este punto considerar el factor tiempo. Aquellos individuos que precisen de un

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 263 Manual de teoras emocionales y motivacionales - UJI
mayor periodo de tiempo para recuperar sus niveles basales de activacin, es decir,
QHFHVLWHQPD\RUWLHPSRSDUDKDELWXDUVHDOHVWUpVHVWDUiQVRPHWLHQGRDVXVLVWHPD
cardiovascular a una activacin prolongada, pudiendo producir esta, de nuevo,
efectos negativos para la salud. Es decir, un patrn de habituacin, aparentemente
DGDSWDWLYRSXHGHQRVHUORVLWHQHPRVHQFXHQWDVXGXUDFLyQHQHOWLHPSR 3DOPHUR
\FROV3DOPHUR%UHYD\FROV3DOPHUR(VSLQRVD\FROV 

b (QFXDQWRDOWLSRGHVLWXDFLRQHVXWLOL]DGDVQRSRGHPRVROYLGDUTXHHOJUDGRGH
HVWUpVSHUFLELGRGHSHQGHUiGHODHYDOXDFLyQ\YDORUDFLyQVXEMHWLYDVGHOLQGLYL-
GXRSXGLHQGRHVDVVLWXDFLRQHVVHUFRQVLGHUDGDVFRPRGHGDxRDPHQD]DQWHVR
GHVDDQWHV$QWHDTXHOODVVLWXDFLRQHVSRWHQFLDOPHQWHPiVDPHQD]DQWHVSDUDHO
LQGLYLGXRVXDFWLYDFLyQVHUiPD\RU /D]DUXV\)RONPDQ $HVWRKD\TXH
DxDGLUTXHORVLQGLYLGXRV7LSR$VXHOHQHYDOXDU\YDORUDUODVVLWXDFLRQHVFRPR
PiVDPHQD]DQWHV

(QHOiPELWRGHODSURSHQVLyQDODVGLVIXQFLRQHVRDOWHUDFLRQHVWDOFRPRKHPRV
VHxDODGRHQXQWUDEDMRDQWHULRU 3DOPHUR\FROV KDH[LVWLGRXQDWHQGHQFLD
VLVWHPiWLFDDFRQVLGHUDUFRPRLQGLFDGRUGHOULHVJRGHHQIHUPHGDGODPD\RUUHDF-
WLYLGDGFDUGLDFDHQVLWXDFLRQHVGHHVWUpV2GLFKRFRQRWUDVSDODEUDVORVVXMHWRV
que muestran mayor reactividad cardiaca en las situaciones de estrs son los que
mayor probabilidad tienen de sufrir una lesin o enfermedad.

(QHVWHPDUFRGHUHIHUHQFLDHQXQRGHORVWUDEDMRVPiVLQWHUHVDQWHVHQHOiPELWR
GH OD UHDFWLYLGDG FDUGLRYDVFXODU .HOVH\   DQDOL]D ORV GLVWLQWRV SDWURQHV R
SHUOHVGHUHVSXHVWDHQVLWXDFLRQHVGHHVWUpV7RPDQGRFRPRDUJXPHQWRGHSDU-
tida la teora del proceso dualHQODTXHVHGHHQGHTXHORVSURFHVRVGHVHQVLELOL-
]DFLyQ\GHKDELWXDFLyQVRQLQGHSHQGLHQWHVSHURTXHLQWHUDFW~DQSDUDGHWHUPLQDU
la respuesta de un organismo en una situacin de estrs crnico o estrs repetido,
.HOVH\KDEODGHWUHVSHUOHVGHUHVSXHVWDFDUGLRYDVFXODUKDELWXDFLyQPDQWHQL-
PLHQWR\VHQVLELOL]DFLyQ5HFRUGHPRVTXHHQODDUJXPHQWDFLyQGH.HOVH\VHKDFH
referencia a una situacin de estrs crnico, tnico, de estrs sostenido, porque lo
que interesa apreciar es cmo evoluciona la respuesta cardiovascular a lo largo de
un periodo dilatado de estrs.

En nuestra modesta opinin, creemos que, para determinar los distintos patrones
de reactividad cardiovascular en una situacin de estrs, habra dos posibilidades:
JHQHUDUXQDVLWXDFLyQGHHVWUpVDJXGRRIiVLFR\JHQHUDUXQDVLWXDFLyQGHHVWUpV
crnico, o tnico.

/DVLWXDFLyQGHHVWUpVIiVLFRLPSOLFDODSUHVHQWDFLyQGHGLVWLQWDVDFWLYLGDGHVDODV
que el sujeto tiene que ir respondiendo de forma inmediata. En esta situacin de
estrs presentamos varios estmulos concretos, que exigen una sola respuesta para
cada uno de ellos. El objetivo es que el sujeto vaya respondiendo a cada uno de los
HVWtPXORV ORVHVWtPXORVKDQGHHVWDUORVXFLHQWHPHQWHVHSDUDGRVWHPSRUDOPHQWH
SDUDSRGHUHVWDEOHFHUODUHVSXHVWDSXQWXDO\FRQFUHWDGHOVXMHWRDFDGDXQRGHHOORV 
'HHVWHPRGRSRGHPRVREVHUYDUFXiOHVODUHVSXHVWDFDUGLRYDVFXODUGHOVXMHWRD
cada estmulo, lo que nos permite calcular la reactividad particular asociada a cada

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 264 Manual de teoras emocionales y motivacionales - UJI
XQRGHHOORV\HVWDEOHFHUHOSHUOGHUHDFWLYLGDGDORODUJRGHWRGDODIDVHGHWDUHD
(QHVWHFDVRFRQFUHWRHVWDPRVPLGLHQGRODUHDFWLYLGDGIiVLFD

/DVLWXDFLyQGHHVWUpVFUyQLFRLPSOLFDODSUHVHQWDFLyQGHXQDVRODDFWLYLGDGTXH
exige al sujeto una respuesta larga, elaborada; que exige al sujeto una concentra-
FLyQ \ GHGLFDFLyQ VRVWHQLGDV D OR ODUJR GH XQ SHULRGR PiV R PHQRV H[WHQVR GH
tiempo. En este tipo de diseo, no nos interesa observar ni medir la respuesta car-
diovascular puntual y concreta del sujeto, pues el estmulo administrado es nico.
/RTXHVtQRVLQWHUHVDHVREVHUYDU\FXDQWLFDUODUHVSXHVWDFDUGLRYDVFXODUDOR
ODUJRGHOWLHPSRTXHGXUDODIDVHGHWDUHD DVXPLPRVTXHDORODUJRGHGLFKDIDVH
el sujeto va a estar en situacin de estrs, pues se encuentra tratando de resolver
OD DFWLYLGDG SUHVHQWDGD  2EVHUYDPRV FyPR UHDFFLRQD HO VXMHWR D HVWD DFWLYLGDG
sostenida, calculando la frecuencia cardiaca en distintos momentos a lo largo de
ODIDVHGHWDUHDORTXHQRVSHUPLWHHVWDEOHFHUHOSHUOGHGLFKDIDVH(QHVWHFDVR
estamos midiendo la reactividad tnica.

(QODVGRVSRVLELOLGDGHVVLWXDFLyQGHHVWUpVIiVLFR\VLWXDFLyQGHHVWUpVFUyQLFR
obtenemos una informacin fundamental para entender el patrn de reactividad
cardiovascular del sujeto cuando es sometido a una situacin de estrs. En ambos
casos, podemos obtener una informacin bastante real de la acomodacin del or-
ganismo, de su sistema cardiovascular en particular, a esa situacin de estrs. Esa
LQIRUPDFLyQVHSODVPDUiHQXQRGHORVWUHVVLJXLHQWHVSHUOHVRSDWURQHVTXH\D
HVER]DPRVDOSULQFLSLRGHHVWHDSDUWDGR

3RUXQDSDUWHSXHGHSURGXFLUVHXQSHUORSDWUyQFDUDFWHUL]DGRSRUODSURJUHVLYD
habituacin de la respuesta cardiovascular. Concretamente, se observa cmo al
inicio de la tarea se produce un incremento en la respuesta cardiovascular, como
consecuencia de la novedad del estmulo, pero a medida que transcurre la tarea
se aprecia una disminucin progresiva y sostenida de la respuesta cardiovascular,
FRPRFRQVHFXHQFLDGHODIDPLOLDUL]DFLyQFRQHOHVWtPXOR

3RURWUDSDUWHSXHGHREVHUYDUVHXQSHUORSDWUyQFDUDFWHUL]DGRSRUHOPDQWHQL-
PLHQWRPiVRPHQRVFRQVWDQWHGHODUHVSXHVWDFDUGLRYDVFXODU$VtDOSULQFLSLR
de la tarea, cuando aparece el estmulo, se produce el consabido incremento por
ODQRYHGDGGHOHYHQWR6LQHPEDUJRVHDSUHFLDTXHFRQSHTXHxDVXFWXDFLRQHVOD
respuesta cardiovascular se mantiene en los mismos niveles. No hay habituacin
cardiovascular.

3RU~OWLPRSXHGHDSDUHFHUXQSHUORSDWUyQFDUDFWHUL]DGRSRUHOSURJUHVLYRLQ-
FUHPHQWR VHQVLELOL]DFLyQ GHODUHVSXHVWDFDUGLRYDVFXODU(QHVWHFDVRWDPELpQ
se produce el importante incremento de la respuesta cardiovascular cuando ocurre
el estmulo al principio de la fase de tarea. A partir de ese momento la respuesta
FDUGLRYDVFXODU QL GLVPLQX\H KDELWXDFLyQ  QL VH HVWDELOL]D PDQWHQLPLHQWR  VH
LQFUHPHQWDSURJUHVLYDPHQWH&DGDQXHYRHVWtPXOR RODSURSLDVLWXDFLyQVLVHWUDWD
de una tarea de estrs crnico en la que solo se presenta un estmulo para que el su-
MHWRLQLFLHXQDDFWLYLGDGPiVRPHQRVODUJD SRVHHFRQQRWDFLRQHVGHQRYHGDGSDUD
HOVXMHWRSURYRFDQGRHQHVWHUHVSXHVWDVFDUGLRYDVFXODUHVFDGDYH]PiVLQWHQVDV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 265 Manual de teoras emocionales y motivacionales - UJI
/DOyJLFD\HOFRQRFLPLHQWRGHOSDSHOTXHMXHJDQODVFDWHFRODPLQDV\HOFRUWLVRO
sobre la homeostasis y el funcionamiento general del organismo, hacen pensar
TXHGHORVWUHVSRVLEOHVSHUOHVRSDWURQHVGHUHVSXHVWDFDUGLRYDVFXODUVRORHOSUL-
PHURGHHOORV SHUOGHKDELWXDFLyQ SDUHFHVDOXGDEOHSXHVODUHVSXHVWDTXHRIUHFH
HORUJDQLVPRDXQTXHVHDLQWHQVDUiSLGDPHQWHLQLFLDXQDUHFXSHUDFLyQGHORVYDORUHV
EDVDOHVSUHYLRVDODVLWXDFLyQGHHVWUpV/RVRWURVGRVSHUOHV HOGHPDQWHQLPLHQWR\
HOGHVHQVLELOL]DFLyQ SXHGHQWHQHUFRQVHFXHQFLDVQHJDWLYDVSDUDODVDOXGGHOLQGL-
viduo, ya que el organismo se ve sometido a unos niveles de actividad que superan
VXVUHFXUVRVSURGXFLpQGRVHXQUiSLGRGHVJDVWHHLQFUHPHQWDQGRODSUREDELOLGDG
GHTXHODVVXVWDQFLDVTXHWLHQHQFRPRQDOLGDGSURWHJHUDORUJDQLVPRVHWRUQHQ
nocivas.

No obstante, hay un aspecto que suele pasar desapercibido. Concretamente, nos


referimos al tiempo que tarda un organismo en recuperar sus valores basales pre-
YLRVDODVLWXDFLyQGHHVWUpV$VtDXQTXHHOSHUOGHUHVSXHVWDFDUGLRYDVFXODUSXH-
da ser considerado como adaptativo, pues se aprecia un claro descenso en los
YDORUHVGHOSDUiPHWURFDUGLRYDVFXODUHVWXGLDGRHVWRHVVHDSUHFLDXQFODURSUR-
ceso de habituacin, hay que tener en consideracin la variable tiempo. El tiempo
que tarda un organismo en recuperar sus valores basales previos a la situacin de
estrs es el tiempo de actuacin de las catecolaminas y el cortisol sobre ese orga-
QLVPR6LHOWLHPSRGHUHFXSHUDFLyQHVDPSOLRDPSOLRVVHUiQWDPELpQORVHIHFWRV
de dichas sustancias. Estas consideraciones nos llevan a concluir que, con bastante
SUREDELOLGDGODPiVGLODWDGDSUHVHQFLDGHHVWDVVXVWDQFLDVHQHORUJDQLVPRSRVHH
potenciales efectos nocivos para la integridad general del mismo; particularmente,
la recurrencia frecuente y la extensa duracin de estas sustancias producen efectos
nocivos sobre el sistema cardiovascular.

/RTXHWUDWDPRVGHSODQWHDUHVTXHDXQTXHGHPRGRVLVWHPiWLFRVHKDDOXGLGRD
la reactividad cardiovascular como el mecanismo que permite entender el riesgo
de enfermedad, creemos que, sin restarle importancia a dicho mecanismo, hay que
considerar otro que tambin es de suma relevancia: el tiempo de recuperacin. En
HOPDUFRGHUHIHUHQFLDTXHVXSRQHHOHVWXGLRGHODGLPHQVLyQSVLFRVLROyJLFDHO
YHUGDGHURULHVJRGHHQIHUPHGDGYHQGUiGHWHUPLQDGRSRUODFRPELQDFLyQGHODV
WUHVYDULDEOHV\DFOiVLFDVHQSVLFRVLRORJtDDVDEHUODIUHFXHQFLDODLQWHQVLGDG\
ODGXUDFLyQ/RKDELWXDOKDVLGRFRQVLGHUDUODIUHFXHQFLD\ODLQWHQVLGDG6HKDGH-
IHQGLGRTXHODDSDULFLyQIUHFXHQWHGHHSLVRGLRVGHLQWHQVDUHDFWLYLGDGSVLFRVLROy-
gica era el factor de riesgo por excelencia para la enfermedad en general, y para los
trastornos cardiovasculares en particular. Ahora bien, aunque el factor clave pare-
ce ser la intensidad, cuando se combinan la intensidad y la duracin se incrementa
exponencialmente el riesgo. Una elevada intensidad con una muy corta duracin
supone un instante muy breve de desequilibrio; pero, cuando el desequilibrio se di-
lata en el tiempo, la vulnerabilidad del organismo es mucho mayor. Creemos que,
DOPHQRVHQHOiPELWRGHODUHDFWLYLGDGFDUGLRYDVFXODUHQVLWXDFLRQHVGHHVWUpVOR
pertinente es considerar la combinacin de las tres variables antedichas, esto es,
IUHFXHQFLD LQWHQVLGDG \ GXUDFLyQ DVXPLHQGR TXH HO Pi[LPR ULHVJR VH SURGXFH
FXDQGRODVWUHVPXHVWUDQYDORUHVHOHYDGRV/DFRQVLGHUDFLyQDLVODGDGHFXDOTXLHUD
de ellas aporta una informacin parcial, sesgada, e incluso irreal.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 266 Manual de teoras emocionales y motivacionales - UJI
(VWUpV\ELHQHVWDU
En esta parte del captulo expondremos algunas aplicaciones concretas referidas al
proceso de estrs, de manera que puedan dominarlo mejor, tanto de forma terica
como aplicada, en sus vidas cotidianas, y as reconocer su presencia, sus factores
desencadenantes y su posibilidad de manejarlo y controlarlo.

El estrs se instala en la vida de las personas de diferentes maneras, adquiriendo


WDPELpQGLIHUHQWHVLQWHQVLGDGHVRPDJQLWXGHVGHH[SUHVLyQ&RPRVHxDOiEDPRV
anteriormente, puede ser que ocurra algn estmulo repentino de elevada intensi-
dad que provoque estrs; o bien puede ocurrir que varios acontecimientos menores
y aislados, que por s mismos cada uno de ellos no posee capacidad para producir
estrs, coincidan en el tiempo y, de forma conjunta, consigan una intensidad que
desborda la capacidad de control del individuo en cuestin.

3RUWDQWRHOHVWUpVSXHGHQRVHUIiFLOPHQWHUHFRQRFLGRHVSHFLDOPHQWHFXDQGRVX
DSDULFLyQHVOHQWD\SURJUHVLYD(VSRUHVWRTXHORVH[SHUWRVFODVLFDQHOHVWUpVHQ
diferentes niveles.

Es fundamental recordar siempre que la acumulacin de seales es un indicativo


GHODJUDYDPLHQWRGHOFXDGURGHHVWUpV(VGHFLUFXDQWDVPiVVHxDOHV DXQTXHVHDQGH
SRFDPDJQLWXG PiVLQWHQVRRPiVIXHUWHVHUiHOQLYHOGHHVWUpV$VtXQDDFWLWXG
LPSRUWDQWHSDUDHOFRQWUROGHOHVWUpVHVDTXHOODTXHWUDWDGHLGHQWLFDUODVSULPHUDV
VHxDOHVDQWHVGHTXHHVWpFRPSOHWDPHQWHLQVWDODGRHOFXDGURGHHVWUpVPiVJUDYH
/DVVHxDOHVGHODDSDULFLyQ\SUHVHQFLDGHOHVWUpVSXHGHQRFXUULUHQGLYHUVRVQLYH-
les, tal como se describe a continuacin.

Por lo que respecta a la LGHQWLFDFLyQGHIDFWRUHVGHVHQFDGHQDQWHVGHOHVWUpV, sa-


EHPRVTXHDGHPiVGHVDEHULGHQWLFDUODVVHxDOHVGHHVWUpVSDUDGHHVHPRGR
SRGHU DIURQWDUODV GH XQD IRUPD PiV HFD] HV LPSRUWDQWH ORFDOL]DU OD IXHQWH GH
esas seales. Debemos mirar, en primer lugar, hacia nosotros mismos, e intentar
LGHQWLFDUDTXHOORVDVSHFWRVGHQXHVWURVSHQVDPLHQWRVRGHQXHVWUDFRJQLFLyQTXH
pueden estar implicados en la aparicin de estrs.

Aspectos cognitivos. Nuestra propia cognicin puede, por si sola, atraparnos en


situaciones de percepcin alterada de la realidad y convertirse en un factor desen-
cadenante de estrs. Por ejemplo: alguien puede tener una percepcin de s mismo
en trminos de persona no preparada, incompetente, o con peores recursos y/o ha-
ELOLGDGHVTXHORVGHPiV6LHVWDDXWRSHUFHSFLyQQRVHFRUUHVSRQGHFRQODUHDOLGDG
de la situacin, esta persona posee una autopercepcin inadecuada, impropia, que
lo devala ante los otros y ante s mismo. Si esto ocurre, la persona en cuestin
WHQGHUiDGHYDOXDUVXVDFFLRQHVDSHQVDUVLHPSUHTXHORTXHKDFHQRHVFRUUHFWR
\TXHORVGHPiVYDQDWHQHUXQRVMXLFLRVSH\RUDWLYRVDFHUFDGHVXSHUVRQD(VWD
VLWXDFLyQHPSH]DUiDJHQHUDUXQDFRJQLFLyQLQDSURSLDGDLUUDFLRQDO$ORODUJRGHO
WLHPSRHVWDFLUFXQVWDQFLDJHQHUDUiHVWUpVHQODSHUVRQDDOSULQFLSLRFRQPHQRU
intensidad, pero, con el paso del tiempo y la repeticin de estas percepciones, el
HVWUpVVHUiFDGDYH]PD\RU3RUORWDQWRVLDVXPLPRVTXHQXHVWUDVFRJQLFLRQHV

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 267 Manual de teoras emocionales y motivacionales - UJI
RSHQVDPLHQWRVSXHGHQSURGXFLUQRVHVWUpVHOKHFKRGHLGHQWLFDUODVFRJQLFLR-
nes que tenemos sobre nosotros mismos, as como la evaluacin que hacemos de
nuestra capacidad y de nuestros actos, se convierte en una herramienta muy til e
LPSRUWDQWHSDUDODORFDOL]DFLyQGHODVSRVLEOHVHVWUDWHJLDVGHDIURQWDPLHQWR

Aspectos afectivos&XDQGRQRVHQFRQWUDPRVHQXQHVWDGRGHSUHVLYRVLQiQLPR
SDUDUHDOL]DUWDUHDVFXDQGRHVWDPRVPX\DQVLRVRVRSUHRFXSDGRVSRUDOJ~QDVXQ-
to, cuando estamos inquietos por algo que va a ocurrir, estamos en un estado de
agitacin interna que desencadena las reacciones corporales de estrs. Esto nos
lleva a un estado de insatisfaccin personal, de malestar, no encontramos placer
en lo que hacemos, incluso, en cosas que antes nos producan mucho placer, nos
sentimos desmotivados: nos encontramos en una situacin de estrs.

Aspectos sociales8QDFDUDFWHUtVWLFDGHOVHUKXPDQRHVTXHVRPRVJUHJDULRV9LYL-
mos en grupo, necesitamos de la presencia de otras personas en nuestras vidas, de-
seamos sentirnos queridos por, y necesarios para, otras personas en sus vidas. Cuando
alguien tiene relaciones sociales escasas o nulas, es una persona retrada, con pocos
DPLJRVFRQSRFRFRQWDFWRVRFLDO&RQVLJXLHQWHPHQWHHVWDSHUVRQDQRREWHQGUiODV
FRQVHFXHQFLDVSRVLWLYDVGHULYDGDVGHHVWDEOHFHUGLFKDVUHODFLRQHVVHVHQWLUiDLVODGR
VLQRSRUWXQLGDGHVGHLQWHUDFFLyQVRFLDOWHQGUiWDPELpQXQDJUDQVHQVDFLyQGHDLVOD-
miento social, lo que es tambin un generador de estrs.

Nuestras conductas. Cuando estamos estresados, nuestras conductas se alteran,


QRVHQFRQWUDPRVPiVDFWLYRVUHDFFLRQDPRVPiVUiSLGDHLQWHQVDPHQWHDORVHYHQ-
WRV(VWRHVUHVSXHVWDVTXHDQWHVVHSURGXFtDQHQXQWRQRQRUPDOVRQDKRUDPiV
LQWHQVDVPiVH[DOWDGDV3RGHPRVREVHUYDUORVP~VFXORVGHOFXHUSR\SHUFLELUH-
PRVXQLQFUHPHQWRHQVXWRQLFLGDGKD\XQDWHQGHQFLDDTXHORVWHQJDPRVPiVHQ-
durecidos cuando estamos estresados. Nuestra respuesta verbal tambin se altera:
WHQGHPRVDKDEODUPiVDOWRFRQXQDHQWRQDFLyQDOWHUDGDHQHOWLPEUHGHODYR]7HQ-
GHPRVWDPELpQDKDFHUWRGRORTXHXVXDOPHQWHKDFHPRVSHURFRQPiVUDSLGH]FRQ
mayor intensidad. De nuevo, tenemos el organismo preparado para la lucha, y de
QXHYRVLHVWDVLWXDFLyQVHPDQWLHQHGXUDQWHXQODUJRSHULRGRGHWLHPSRDFDUUHDUi
daos al organismo. Atendamos por lo tanto a las seales corporales para percibir
FXiQGRHVWDPRVHVWUHVDGRV

Funcionamiento corporal. (OVLJXLHQWHIDFWRUTXHWHQHPRVTXHLGHQWLFDUHVQXHV-


WURSURSLRIXQFLRQDPLHQWRFRUSRUDOHQVXVDVSHFWRVItVLFRV\VLROyJLFRV&XDQGR
estamos relajados, nuestra frecuencia cardiaca es lenta, acompasada, casi no la
percibimos si no le prestamos una atencin importante. En cuanto a la sudoracin,
ocurre lo mismo, no la percibimos. El color de nuestra cara es tambin normal,
nadie percibe ninguna alteracin. Es decir, cuando no estamos estresados, el fun-
cionamiento de nuestro cuerpo es tranquilo, normal. Pero, por el contrario, cuando
HPSH]DPRVDVHQWLUQRVHVWUHVDGRVWRGRFDPELD8QDGHODVSULPHUDVVHxDOHVTXH
YDPRVDSHUFLELUHVTXHODIUHFXHQFLDFDUGLDFDVHLQFUHPHQWD7DPELpQSRGHPRV
SHUFLELUTXHVXGDPRVPiVGHORQRUPDO(OFRORUGHQXHVWUDFDUDFDPELDKDFLDXQ
FRORUPiVURML]R7RGRVHVWRVFDPELRVUHHMDQORTXHRFXUUHLQWHUQDPHQWHHQQXHV-
tro organismo; es una respuesta de preparacin para enfrentarnos a las posibles

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 268 Manual de teoras emocionales y motivacionales - UJI
DPHQD]DV6LHVWXYLpUDPRVHQXQDVLWXDFLyQGHOXFKDItVLFDUHDOWRGDVHVWDVUHDF-
ciones seran muy apropiadas. Pero, en general, en nuestra sociedad, las luchas no
son fsicas, sino que son solo luchas de tipo verbal o social. Si bien la reaccin
GHHVWUpVSXHGHVHUEHQHFLRVDHQDOJXQDVRFDVLRQHVVLRFXUUHGHIRUPDFUyQLFD
puede llegar a hacernos dao y convertirse en perjudicial para nuestra salud. Por
tanto, como consecuencia de un continuo estado de preparacin corporal para la
OXFKD SRGHPRV OOHJDU D GHVDUUROODU GRORUHV JHQHUDOL]DGRV HQ WRGR HO FXHUSR R
GRORUHVPiVORFDOL]DGRVFRPRGRORUGHFXHOORGHHVSDOGDGHFDEH]DHWF7RGDV
estas reacciones corporales incrementan nuestra predisposicin a la hora de sufrir
futuras enfermedades fsicas. El hecho de prestar atencin a nuestras reacciones
FRUSRUDOHVHVPX\LPSRUWDQWHSDUDTXHVHSDPRV\UHFRQR]FDPRVFXiQGRHVWDPRV
entrando en un estado de estrs y podamos prevenirlo.

Alimentacin/DPDQHUDGHDOLPHQWDUQRVWDPELpQHVXQLQGLFDWLYRGHVLQRVHQ-
contramos o no en un estado de estrs. Cuando percibimos que ha habido un cam-
bio en la manera de comer, y en el tipo de alimentos que tomamos, tenemos que
LQYHVWLJDU\SUHJXQWDUQRVVLVHHVWiKDFLHQGRFRPRFRQVHFXHQFLDGHXQHVWDGRGH
HVWUpV/DVSHUVRQDVTXHYDUtDQPXFKRODFDQWLGDGRODFXDOLGDGGHDOLPHQWRVLQJH-
ridos podran estar bajo los efectos de un estado de estrs.

Sueo/DFDQWLGDGGHKRUDVTXHGRUPLPRV\ODFDOLGDGGHQXHVWURVXHxRHVRWUR
indicativo de la presencia o no de estrs en nuestras vidas. Si dormimos muchas
PHQRVKRUDV LQVRPQLR RPXFKDVPiVKRUDVGHEHPRVHVWDUDWHQWRVDHOOR\DTXH
podemos estar entrando en un estado de estrs. De la misma forma, es importante
tener en cuenta y evaluar la calidad de nuestro sueo. Un sueo con pesadillas, un
VXHxRDJLWDGRODVGLFXOWDGHVSDUDFRQFLOLDUHOVXHxRODVGLFXOWDGHVSDUDPDQWH-
QHUHOVXHxRODVGLFXOWDGHVSDUDOHYDQWDUVHGHODFDPDVRQWDPELpQVHxDOHVDODV
que debemos prestar atencin como posibles indicativos de la presencia de estrs.

Por lo que respecta a la aplicacin de estrategias para controlar el estrs, es im-


SUHVFLQGLEOHDFWXDUSURQWRXWLOL]DUORVUHFXUVRVDSURSLDGRVVDEHUFyPRHQIRFDU
la solucin, y protegerse de los potenciales efectos nocivos que entraa la propia
situacin de estrs.

En cuanto a la cognicin, cuando percibimos que tenemos una cognicin distor-


sionada de la realidad, que lo que pensamos de nosotros no es compatible con lo
que los otros piensan, que la manera de autoevaluarnos no es acorde con la rea-
lidad, tenemos que intentar conocernos mejor, evaluar adecuadamente nuestras
FDSDFLGDGHVQXHVWURVOtPLWHVHVWDEOHFHUPHWDVPiVUHDOLVWDVHQQXHVWUDVYLGDV\
VDEHUDSUHFLDUORVp[LWRVTXHREWHQHPRV$OJXQDVYHFHVHVVXFLHQWHFRQUHDOL-
]DUDOJXQRVHMHUFLFLRVGHSHQVDPLHQWRGLULJLGRHVWHDORVKHFKRVFRQFUHWRVFRQ-
IURQWiQGRORFRQQXHVWURVSHQVDPLHQWRVKDELWXDOHVRWUDVYHFHVSRGHPRVLQWHQWDU
aprender a hacer ejercicios de meditacin, que es un buen calmante para el estrs.
Puede ser que, para esta actividad, necesitemos de la ayuda de una persona amiga,
RGHXQSURIHVLRQDOGHOiUHD&XDQGRXQRHVFDSD]GHFDPELDUORVSHQVDPLHQWRV
LUUDFLRQDOHVTXHWLHQHYDDFRQVHJXLUPiVp[LWRHQVXVDFFLRQHV\FRQVHFXHQWH-
PHQWHYDDWHQHUXQVHQWLPLHQWRLQWHUQRGHPD\RUUHDOL]DFLyQSHUVRQDO

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 269 Manual de teoras emocionales y motivacionales - UJI
En cuanto a los aspectos afectivos, si detectamos la presencia de ansiedad, de-
SUHVLyQRDJLWDFLyQLQWHUQDGHEHPRVDSUHQGHUDXWLOL]DUWpFQLFDVGHDXWRFRQWURO\
PDQHMRGHGLFKDVYDULDEOHVSHUWXUEDGRUDV9DULRVDVSHFWRVSXHGHQDTXtHVWDULP-
SOLFDGRVFRJQLWLYRVDIHFWLYRV\RFRQGXFWXDOHV/RTXHVHQHFHVLWDHVGHDOJXLHQ
sea un amigo, un familiar o un profesional, dependiendo de la gravedad de lo que
le ocurre, para que nos ensee y nos ayude a manejar las tcnicas de autocontrol,
hacer ejercicios de relajacin, meditacin, etc. Como consecuencia de un manejo
apropiado de tales tcnicas, conseguiremos un equilibrio emocional y vivir en un
estado interno de tranquilidad.

En cuanto a los aspectos sociales, si se encuentran alterados, hasta el punto de pro-


vocarnos reacciones de estrs, debemos evaluar nuestras habilidades sociales y, si
es necesario, aprender nuevas habilidades tales como la asertividad. Si poseemos
las habilidades necesarias, se puede buscar establecer nuevos contactos sociales,
SDUDUHFLELUPiVDWHQFLyQDSR\RVRFLDOHOFXLGDGR\HODIHFWRGHODVSHUVRQDVFRQ
las cuales nos relacionamos, y, de este modo, poseer un sentimiento de bienestar
social, que reduce el estrs y previene su futura ocurrencia.

En cuanto al funcionamiento corporalHVXQDGHODViUHDVGRQGHPiVVXIULPRVODV


FRQVHFXHQFLDVGHOHVWUpVSHURWDPELpQXQDGHODViUHDVGRQGHPiVSRGHPRVDFWXDU
Cuando se perciben las alteraciones corporales indeseables derivadas de la presen-
cia del estrs, se puede, por ejemplo, caminar como forma de combatirlas. Cami-
nar es un ejercicio sencillo, que no precisa de aparatos especiales, no depende de
RWUDVSHUVRQDVQLGHKRUDULR3RGHPRVKDFHUORVLHPSUHTXHTXHUDPRV$GHPiVGHFD-
minar, se puede tambin iniciar e incrementar progresivamente las actividades fsi-
FDVFRPRRWUDIRUPDGHFRPEDWLUHOHVWUpV8QHMHUFLFLRPiVSDVLYRSHURDOWDPHQWH
HFLHQWHSDUDFRPEDWLU\SUHYHQLUHOHVWUpVHVODUHODMDFLyQPXVFXODUSUHFHGLGDGHO
XVRGHWpFQLFDVGHUHVSLUDFLyQSURIXQGD\UtWPLFD/DFRPELQDFLyQGHHVWDVDFFLRQHV
UHVSLUDFLyQUtWPLFDUHODMDFLyQ\HMHUFLFLRVItVLFRV WLHQHHOSRGHUGHPRGLFDUOD
produccin interna de las hormonas que se producen en los estados de estrs. Con
todo ello vamos a aumentar la resistencia corporal e inmunolgica, previniendo y
protegindonos as de los perjuicios del estrs excesivo.

En cuanto a la dimensin de nuestra propia conducta, cuando existen situaciones


TXHQRVSURGXFHQFDQVDQFLR\GHVRUJDQL]DFLyQGHEHPRVHPSH]DUDFRPEDWLUHO
HVWUpVFRQXQDSODQLFDFLyQGHODVWDUHDVDUHDOL]DURUJDQL]iQGRODVHVWDEOHFLHQGR
SULRULGDGHV(VWDQXHYDIRUPDGHREUDUQRVWUDHUiFRPRFRQVHFXHQFLDTXHVHDPRV
FDSDFHVGHFXPSOLUORVSOD]RVDFRUGDGRVRTXHQRKDEtDPRVSUHYLVWRUHFLELHQGR
ODVFRQVHFXHQFLDVSRVLWLYDVSRUODVWDUHDVQDOL]DGDV(VWDVSRVLWLYDVFRQVHFXHQ-
FLDVVRQFDSDFHVGHUHGXFLUHOHVWUpVDGHPiVGHIXQFLRQDUFRPRDQWtGRWRVSDUD
futuras ocasiones.

En cuanto a la alimentacinVLSHUFLELPRVTXHHOHVWUpVQRVHVWiSURGXFLHQGRXQD
DOWHUDFLyQGHOEXHQSDWUyQDOLPHQWDULRSRGHPRVHPSH]DUSRURUJDQL]DUQXHVWURV
KRUDULRV GH DOLPHQWDFLyQ KDFLpQGRORV PiV UHJODGRV SURFXUDQGR WHQHU XQ ULWPR
PiVOHQWRHQODYHORFLGDGGHLQJHVWDDXPHQWDUHOQ~PHURGHYHFHVTXHPDVWLFDPRV
cada bocado, reducir el tamao de los bocados, incrementar la ingesta de frutas y

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 270 Manual de teoras emocionales y motivacionales - UJI
YHUGXUDVTXHFRQWLHQHQPiVEUDV\UHGXFLHQGRDVtODLQJHVWDGHDOLPHQWRVFRQ
JUDVD\VLQEUDV$GHPiVGHUHGXFLUHOHVWUpVHVWRVFDPELRVGHKiELWRVQRVSUR-
SRUFLRQDUiQXQIXQFLRQDPLHQWRLQWHVWLQDOUHJXODU\XQLQFUHPHQWRGHODUHVLVWHQFLD
RUJiQLFDSUHYLQLHQGRODRFXUUHQFLDIXWXUDGHHVWUpV

En cuanto al sueo, es un hecho evidente que el estrs excesivo produce pertur-


baciones. Podemos combatir dichos trastornos siguiendo una regla estricta en los
KiELWRVGHGRUPLU3RUHMHPSORQRGRUPLUGXUDQWHHOGtDSURFXUDUGRUPLUVROD-
PHQWHHQQXHVWUDFDPDQXQFDHQORVVRIiVRVLOODVFRQIRUWDEOHVSODQHDU\VHJXLU
una regla que nos impongamos respecto a un horario para dormir. Siguiendo estas
SDXWDVREVHUYDUHPRVFyPRORVEHQHFLRVDVRFLDGRVKDFHQVXDSDULFLyQSDVDQGR
a tener un sueo reparador y productivo. Consiguientemente, tambin nuestra eta-
SDGHYLJLOLDVHUiPiVJUDWLFDQWH\SURGXFWLYD

9.5. Algunas manifestaciones especiales del estrs


(QHVWHDSDUWDGRQRVFHQWUDUHPRVHQGRVGHODVPDQLIHVWDFLRQHVRiPELWRVHQORV
TXHFRQPD\RUIUHFXHQFLD\QLWLGH]VHDSUHFLDQORVSRWHQFLDOHVHIHFWRVGHYDVWDGR-
res que pueden encontrarse asociados a una situacin de estrs. Es evidente que son
PXFKRVORVHMHPSORVRiPELWRVGHDSOLFDFLyQHQORVTXHHPHUJHQVLWXDFLRQHVSHUIHF-
WDPHQWHSHUODGDVFRPRVLWXDFLRQHVGHHVWUpVFRQHIHFWRVQHJDWLYRV+HPRVVHOHFFLR-
nado los dos siguientes por representar ejemplos ntidos de situaciones frecuentes en
nuestra sociedad.

7UDVWRUQRGHHVWUpVSRVWUDXPiWLFR
Se trata de una situacin especial a la que tenemos que prestar atencin es el estrs
SRVWUDXPiWLFR(QHVWHFDVRDSUHFLDPRVTXHODSHUVRQDQRWLHQHXQLQFUHPHQWR
SURJUHVLYRGHHVWUpVHQVXYLGDQLWDPSRFRWLHQHXQHYHQWRDPHQD]DGRUHQHOIX-
turo inmediato que la ponga en estado de alerta para prevenir el estrs, pero s que
ha vivido una situacin impactante en el pasado reciente. Una situacin que, por su
H[WUDRUGLQDULDLQWHQVLGDG\FUXGH]DKDGHMDGRXQDKXHOODGLItFLOGHERUUDUKDFLHQ-
do que el simple recuerdo de esa situacin lleve al individuo, de forma inmediata,
DUHYLYLUGLFKRVDFRQWHFLPLHQWRVSURYRFiQGROHODVUHDFFLRQHVWtSLFDVGHXQDVLWXD-
FLyQGHHVWUpVLQWHQVR(VDH[SHULHQFLDUHFLEHHOQRPEUHGHHVWUpVSRVWUDXPiWLFR

(O7UDVWRUQRGH(VWUpV3RVWUDXPiWLFRHVHQUHDOLGDGXQDHQIHUPHGDGUHFRQRFLGD
FRPR WDO SRU OD &ODVLFDFLyQ ,QWHUQDFLRQDO GH ODV (QIHUPHGDGHV CIE  GH OD 2U-
JDQL]DFLyQ 0XQGLDO GH OD 6DOXG OMS  2FXUUH HQ DOJXQDV SHUVRQDV GHVSXpV GH
experimentar o presenciar un acontecimiento peligroso, como un terremoto, el fa-
llecimiento de alguien especial, un accidente, etc. A partir de ese acontecimiento,
ODDSDULFLyQGHHVWtPXORVLGpQWLFRVRVLPLODUHVOOHYDQDOVXMHWRDYLYLU UHYLYLU ODV
experiencias del pasado.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 271 Manual de teoras emocionales y motivacionales - UJI
Pensemos, por ejemplo, en un individuo que ha sufrido un accidente laboral mien-
WUDVPDQHMDEDXQDPiTXLQD/DKXHOODGHHVHDFRQWHFLPLHQWRLPSDFWDQWHSXHGHVHU
WDQLQWHQVDTXHFDGDYH]TXHHOVXMHWRSHUFLEHGLFKDPiTXLQDRUHFXHUGDHODFRQ-
tecimiento pasado, siente las mismas experiencias aversivas que cuando ocurri el
accidente. Incluso, puede ser tan desmesurado ese sentimiento aversivo que llegue
DSURGXFLUHQHVHLQGLYLGXRXQDDYHUVLyQJHQHUDOL]DGDKDFLDHVDPiTXLQD LQFOXVR
KDFLDWRGRWLSRGHPiTXLQDV TXHOHLQFDSDFLWHHQHOIXWXURSDUDGHVDUUROODUDFWLYL-
GDGHVHQODVTXHHVWpLPSOLFDGDGLFKDPiTXLQDRFXDOHVTXLHUDRWUDV

4XHUHPRVHQIDWL]DUXQDVSHFWR\HVHOUHIHULGRDOKHFKRGHTXHQRHVQHFHVDULR
TXHODH[SHULHQFLDWUDXPiWLFDSDVDGDKD\DOOHJDGRDSURGXFLUGDxRVItVLFRVHQOD
SHUVRQDHQFXHVWLyQ/DH[SHULHQFLDHVWUDXPiWLFDSRUORTXHVLJQLFDSDUDHOLQGL-
viduo, aunque no llegue a producir los efectos que poda haber llegado a producir.
'HKHFKRWDOFRPRVHSURSRQHHQHO,QVWLWXWR1DFLRQDOGH6DOXG0HQWDOGHORV(V-
WDGRV8QLGRV 1DWLRQDO,QVWLWXWHRI0HQWDO+HDOWKNIMH ODVFDXVDVGHO7UDVWRUQR
GH(VWUpV3RVWUDXPiWLFRVHUHHUHQDOKHFKRGHH[SHULPHQWDURSUHVHQFLDUXQD
situacin perturbadora y peligrosa. Entre dichas causas se pueden incluir las si-
guientes: ser vctima de violencia o presenciarla, la muerte o enfermedad grave de
un ser querido, guerra o combate, accidentes automovilsticos, areos, laborales,
etc., huracanes, tornados e incendios, delitos violentos, como un robo o tiroteo.

/RV VtQWRPDV GH OD SUHVHQFLD GH HVWD HQIHUPHGDG DGHPiV GH OR \D FRPHQWDGR
incluyen manifestaciones y signos como los siguientes: pesadillas, recuerdo del
DFRQWHFLPLHQWRPLHGRSiQLFRDTXHYXHOYDDRFXUULUHYLWDFLyQGHVLWXDFLRQHVVL-
milares a la de aquella en la que ocurri el acontecimiento impactante, preocupa-
FLyQWULVWH]DLUDWUDVWRUQRVGHVXHxRHQWUHRWURV

(OWUDVWRUQRGHHVWUpVSRVWUDXPiWLFRSXHGHRFXUULUWDQWRHQDGXOWRVFRPRHQQL-
xRV\FXDQWRPiVSURQWRVHLGHQWLTXHGLFKDGLVIXQFLyQ\VHEXVTXHD\XGDSDUD
VROXFLRQDUODWDQWRPiVUiSLGD\HFLHQWHVHUiODVROXFLyQ/DVFRQVHFXHQFLDVGH
la torpeza referida al manejo y control adecuados de la situacin de estrs pueden
implicar la aparicin de alteraciones en el estado psicolgico del individuo en
FXHVWLyQ$SOLFDGDVDOiPELWRODERUDOHVWDVDOWHUDFLRQHVSXHGHQGHVHQFDGHQDUHO
estado de burnout, o agotamiento, situacin extrema en la cual se encuentran los
individuos que tienen mucho estrs, trabajan demasiado, y, como consecuencia, no
tienen motivacin para el trabajo. Esto los va a inducir a cometer errores en sus ta-
UHDVDQRREWHQHURQRDFHSWDUFRPRWDOHVODVJUDWLFDFLRQHVQDWXUDOHVGHXQDWDUHD
completada, a rebajar su umbral de tolerancia en sus relaciones con sus compa-
eros de trabajo, a explosiones de temperamento, degradando as la cualidad de
su trabajo y de su vida. Es seguro que estas reacciones y sus consecuencias van a
repercutir en la vida personal de esta persona.

Siempre que estamos en un estado de estrs, especialmente si este estado es pro-


ORQJDGR VXIULPRV GHWHUPLQDGRV GHVDMXVWHV /D UHSHWLFLyQ \ FRQWLQXDFLyQGH ODV
UHDFFLRQHVVLROyJLFDVDVRFLDGDVDOHVWUpVSXHGHQSURGXFLUDOWHUDFLRQHVHQHOIXQ-
FLRQDPLHQWRGHORVyUJDQRV7RGRVORVyUJDQRVGHOFXHUSRSXHGHQVXIULUODLQXHQFLD
QHJDWLYDGHOHVWUpVSURORQJDGR/DUHODFLyQHQWUHXQHVWDGRGHHVWUpVSURORQJDGR\HO

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 272 Manual de teoras emocionales y motivacionales - UJI
IXQFLRQDPLHQWRFDUGLRYDVFXODUHVPX\ELHQFRQRFLGD/DVSHUVRQDVTXHVHHQFXHQ-
tran en un estado de estrs prolongado experimentan un incremento de la presin
arterial y de la frecuencia cardiaca, lo que puede inducir o agravar enfermedades
FDUGLRYDVFXODUHV7DPELpQHVPX\FRQRFLGDODUHODFLyQHQWUHHOHVWUpVQRFRQWUROD-
GR\ODVHQIHUPHGDGHVGHOVLVWHPDJDVWURLQWHVWLQDO/DV~OFHUDVGHHVWyPDJR\ORV
clicos son enfermedades que popularmente se sabe que se encuentran asociadas
al estrs. De una manera general, el estado de estrs prolongado e indeseable va a
producir una disminucin de la capacidad defensiva del organismo, una reduccin
de la resistencia inmunolgica, propiciando as la ocurrencia de enfermedades.

(VWUpVODERUDO
(OWUDEDMRHVXQDGHODViUHDVLPSRUWDQWHVGHQXHVWUDYLGDSXHVWRTXHHQHODPELHQ-
WHGHWUDEDMRODVSHUVRQDVSDVDQ DOPHQRVWHQGUtDQTXHSDVDU XQDJUDQSDUWHGH
VXWLHPSRGLDULR$GHPiVGHSURSRUFLRQDUUHFXUVRVHFRQyPLFRVDORVWUDEDMDGRUHV
lo conveniente es que el ambiente de trabajo proporcione tambin consecuencias
GHVDWLVIDFFLyQSHUVRQDODORVWUDEDMDGRUHVSRUODDFWLYLGDGUHDOL]DGD&XDQGRHQ
su actividad laboral, cualquiera que sea esta, el trabajador encuentra las dos con-
secuencias positivas, dicho individuo se encuentra en una situacin de equilibrio
que le proporciona bienestar, salud y calidad de vida. Por el contrario cuando el
WUDEDMRQRWLHQHFRQVHFXHQFLDVQDQFLHUDVDGHFXDGDVGHQWURGHODHYDOXDFLyQR
HQHOiPELWRGHODVQHFHVLGDGHVGHOWUDEDMDGRURFXDQGRHOWUDEDMR\VXVH[LJHQ-
FLDVVXSHUDQODVFDSDFLGDGHVGHPDQHMRGHOWUDEDMDGRUHVWHVHHQFRQWUDUiHQXQD
situacin de estrs laboral, con consecuencias peligrosas para su salud personal y
SDUDVXSURGXFWLYLGDGFRQH[WHQVLyQGHHVWDVFRQVHFXHQFLDVDODVDOXGQDQFLHUD
GHODHPSUHVD$VtHOHVWUpVODERUDOHVGHQLGRSRUHO&HQWHUVIRU'LVHDVH&RQWURO
 GHORV(VWDGRV8QLGRVGH$PpULFDFRPRODVQRFLYDVUHDFFLRQHVItVLFDV\
emocionales que ocurren cuando las exigencias del trabajo no igualan las capaci-
dades, los recursos, o las necesidades del trabajador.

En este orden de cosas, desde la Agencia Europea para la Seguridad y la Salud


HQHO7UDEDMRVHSURSRQHTXHHOHVWUpVHVXQRGHORVSULQFLSDOHVSUREOHPDVSDUDOD
salud y la seguridad a los que nos enfrentamos en Europa. Se estima que la cuarta
SDUWHGHORVWUDEDMDGRUHVVXIUHHVWUpV\TXHPiVGHODPLWDGGHODVEDMDVODERUDOHV
tiene como causa una situacin de estrs.

(QHOPLVPRVHQWLGRGHVGHHO,QVWLWXWR9DOHQFLDQRGH6HJXULGDG\6DOXGHQHO
7UDEDMRVHDUPDTXHODFDUJDPHQWDOLPSOtFLWDHQHOGHVHPSHxRGHXQDDFWLYL-
dad laboral parece ser uno de los factores importantes para entender el deterioro
y disminucin de la productividad en la empresa, as como la disminucin de la
calidad de vida del trabajador. Entre los signos, sntomas o seales de que el tra-
bajo puede estar comprometiendo la salud del trabajador encontramos las mismas
manifestaciones que se producen en una situacin de estrs general: irritabilidad,
GHSUHVLyQIDOWDGHHQHUJtDRYROXQWDGSDUDWUDEDMDUGRORUHVGHFDEH]DLQVRPQLR
entre otros.
En ltima instancia, casi todos los organismos nacionales o internacionales que

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 273 Manual de teoras emocionales y motivacionales - UJI
VH RFXSDQ GHO WHPDGHO HVWUpV ODERUDOXWLOL]DQXQ FRQFHSWR FRP~Q \ HV HO UHIH-
ULGRDOKHFKRGHTXHODDSDULFLyQGHOHVWUpVHQHOiPELWRODERUDOREHGHFHDXQD
LQWHUDFFLyQHQWUHORVIDFWRUHVGHOWUDEDMRHQVtPLVPRV HVIXHU]RItVLFRH[FHVLYR
condiciones ergonmicas, acsticas o posturales inapropiadas, trabajar bajo fuerte
GHPDQGDSVLFROyJLFDGHVRUJDQL]DFLyQDGPLQLVWUDWLYDWXUQRVGHWUDEDMRH[FHVLYD-
PHQWHODUJRVGHVFDQVRVLQDGHFXDGRVHWF \ORVIDFWRUHVSHUVRQDOHVGHOWUDEDMDGRU
FXDOLFDFLyQ SDUD OD WDUHD KDELOLGDGHV GH UHVLVWHQFLD SHUVRQDO D ODV GHPDQGDV
KDELOLGDGHVSDUDODVUHODFLRQHVLQWHUSHUVRQDOHVHWF 

Como cualquier situacin de estrs excesivo, el estrs laboral puede afectar a la


VDOXGGHORVWUDEDMDGRUHVDGHPiVGHDIHFWDUWDPELpQVXSURGXFWLYLGDG\ODSURGXF-
FLyQGHODSURSLDHPSUHVD/RVULHVJRVSDUDODVDOXGYDQDWUDHUFRPRFRQVHFXHQFLD
los absentismos, que pueden perjudicar a la empresa, y los daos fsicos o emo-
cionales, que perjudican al propio trabajador. Entre estos ltimos, cabe resear las
DOWHUDFLRQHVItVLFDVFRPRGRORUHVGHFDEH]DHVWyPDJRHVSDOGD\ODVDOWHUDFLRQHV
emocionales, como prdida de motivacin para el trabajo, moral baja, alteracin
en las relaciones personales y familiares. En casos extremos, podremos tener in-
FOXVRGHSUHVLyQ\DJRWDPLHQWR~OFHUDVFiQFHULQWHQWRVGHVXLFLGLR\IXQFLRQHV
LQPXQROyJLFDVDIHFWDGDV 1DWLRQDO,QVWLWXWHVRI0HQWDO+HDOWK 

+D\DOJXQDVSURIHVLRQHVTXHSRUODHOHYDGDGHPDQGDTXHWLHQHQFRPRFDUDFWHUtVWLFD
de su propio desarrollo, aaden una presin elevada sobre los trabajadores, produ-
FLHQGRGHIRUPDLQGHIHFWLEOHHVWUpVODERUDO3RUHMHPSORWUDEDMDGRUHVHQHOiPELWR
GHODVDOXGWUDEDMDGRUHVHQFDUJDGRVGHODVHJXULGDGHQFXDOTXLHUDGHORViPELWRVD
los que se pueda aplicar, trabajadores cuya continuidad laboral depende del rendi-
miento obtenido en un periodo de tiempo, etc.

En la actualidad, teniendo en cuenta que la economa mundial pasa por tiempos


GLItFLOHV HVSHFLDOPHQWHODHFRQRPtDGHQXHVWURTXHULGRSDtV(VSDxD WHQLHQGR
HQFXHQWDTXHHOGHVHPSOHRVHKDLQFUHPHQWDGRHQPXFKRVSDtVHV HVSHFLDOPHQ-
WHHQQXHVWURTXHULGRSDtV(VSDxD DSDUHFHXQIDFWRUDGLFLRQDOSDUDODSURGXF-
FLyQ GH HVWUpV HQWUH ORV WUDEDMDGRUHV /D SRVLELOLGDG GH TXH VHDQ GHVSHGLGRV OD
SRVLELOLGDGGHTXHVXVXHOGRVHDUHGXFLGRODGLFXOWDGSDUDHQFRQWUDUXQQXHYR
trabajo por parte de los millones de personas que se encuentran en desempleo, la
SUHRFXSDFLyQSRUODHFRQRPtDPXQGLDO\FyPRHVWDSXHGHLQXLUHQVXYLGDSHU-
VRQDOVHVXPDQFRPRIDFWRUHVSURGXFWRUHVGHHVWUpV/D$PHULFDQ$VVRFLDWLRQRI
Psychology, despus del inicio de la crisis econmica internacional, que tambin
ha tenido un gran impacto en la economa americana, prepar una publicacin con
sugerencias de cmo manejar el estrs durante los tiempos difciles de la econo-
PtD $PHULFDQ3V\FKRORJLFDO$VVRFLDWLRQ /RTXHSDUHFHHYLGHQWHHVTXH
en situaciones de crisis econmica como la que vivimos en estos momentos, el ni-
vel de formacin, y de educacin, en general, de los individuos representa uno de
los mejores recursos para afrontar dicha situacin crtica, afectando positivamente
a todas las dimensiones de la esfera vital de los individuos, y, entre ellas, qu duda
cabe, se encuentra tambin la esfera o dimensin laboral.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 274 Manual de teoras emocionales y motivacionales - UJI
Bibliografa
CANON, W. B.  %RGLO\&KDQJHVLQ3DLQ+XQJHU)HDUDQG5DJHBrandford,
Boston.
  6WUHVVHV DQG VWUDLQV RI KRPHRVWDVLV American Journal of Medical
6FLHQFH
SAPOLSKI, R. M.  6WUHVVWKH$JLQJ%UDLQDQGWKH0HFKDQLVPVRI1HXURQ
'HDWK7KH0LW3UHVV/RQGUHV
SELYE, H.  The Stress of Life0F*UDZ+LOO1XHYD<RUN
LAZARUS, R.  6WRU\WHOOLQJDQGWKHPHDVXUHPHQWRIPRWLYDWLRQ7KHGLUHFW
versus substitutive controversy, -RXUQDORI&RQVXOWLQJ3V\FKRORJ\
LACEY, J. I  6RPDWLFUHVSRQVHSDWWHUQLQJDQGVWUHVV6RPHUHYLVLRQVRI
DFWLYDWLRQWKHRU\HQ0+$SSOH\\57UXPEXOO HGV 3V\FKRORJLFDO6WUHVV
,VVXHVLQ5HVHDUFK SS $SSOHWRQ&HQWXU\&URIWV1XHYD<RUN
DOHRENWEND, B. P.  ,QYHQWRU\LQJVWUHVVIXOOLIHHYHQWVDVULVNIDFWRUVIRU
SV\FKRSDWKRORJ\7RZDUGUHVROXWLRQRIWKHSUREOHPRILQWUDFDWHJRU\YDULDELO-
ity, 3V\FKRORJLFDO%XOOHWLQ  
HOLMES, T. H. y RAHE, R. H   7KH VRFLDO UHDGMXVWPHQW UDWLQJ VFDOH
-RXUQDORISV\FKRVRPDWLFUHVHDUFK
PALMERO, F., A. BREVA y M. ESPINOSA  (IHFWRVSVLFRVLROyJLFRVGHOHVWUpV
UHDO\FWLFLRHQVXMHWRV7LSR$\VXMHWRV7LSR%Anales de Psicologa

PALMERO, F., M. ESPINOSA y A. BREVA   3VLFRORJtD \ VDOXG FRURQDULD
+LVWRULDGHXQWUD\HFWRHPRFLRQDO$QVLHGDG\(VWUpV
PALMERO, F. y A. GARCA-LEN   3DWUyQ $ GH FRQGXFWD \ HQIHUPHGDG
coronaria: Relevancia de los aspectos psicobiolgicos,$QiOLVLV\0RGLFDFLyQ
de Conducta  
PALMERO, F.; V. CODINA y J. ROSEL   3V\FKRSK\VLRORJLFDO DFWLYDWLRQ
UHDFWLYLW\ DQG UHFRYHU\ LQ 7\SH $ DQG 7\SH % VFRUHV ZKHQ LQ D VWUHVVIXO
laboratory situation,3V\FKRORJLFDO5HSRUWV
LAZARUS, R. S. y S. FOLKMAN   6WUHVV $SSUDLVDO DQG &RSLQJ. Springer,
1XHYD<RUN
KELSEY, R. M.  +DELWXDWLRQRIFDUGLRYDVFXODUUHDFWLYLW\WRSV\FKRORJLFDO
VWUHVV (YLGHQFH DQG LPSOLFDWLRQV HQ - %ODVFRYLFK \ ( 6 .DWNLQ HGV 
&DUGLRYDVFXODU5HDFWLYLW\WR3V\FKRORJLFDO6WUHVVDQG'LVHDVH SS 
$PHULFDQ3V\FKRORJLFDO$VVRFLDWLRQ:DVKLQJWRQ'&

2WUDVIXHQWHVGHUHOHYDQFLD
$JHQFLD (XURSHD SDUD OD 6HJXULGDG \ OD 6DOXG HQ HO 7UDEDMR  KWWSRVKD
HXURSDHXHVWRSLFVVWUHVVDVHVDGRHQ

American Psychological Association, APA/RVGLVWLQWRVWLSRVGHHVWUpVKWWSZZZ


DSDRUJFHQWURGHDSR\RWLSRVDVS[DVHVDGRHQ

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 275 Manual de teoras emocionales y motivacionales - UJI
American Psychological Association, APA(VWUpV&XiQGR\FyPRUHFLELUD\XGD
KWWSZZZDSDRUJFHQWURGHDSR\RHVWUHVD\XGDDVS[DVHVDGRHQ

American Psychological Association, APA0DQHMDQGRHOHVWUpVGXUDQWHORVWLHP-


pos difciles de la economa http://www.apa.org/centrodeapoyo/tiempos.aspx,
DVHVDGRHQ

$PHULFDQ 3V\FKRORJLFDO $VVRFLDWLRQ  KWWSZZZDSDRUJFHQWURGHDSR\R


WLHPSRVDVS[DVHVDGRHQ

&HQWHUV IRU 'LVHDVH &RQWURO  ([SRVLFLyQ DO HVWUpV ULHVJRV RFXSDFLRQDOHV
HQORVKRVSLWDOHVKWWSZZZFGFJRYVSDQLVKQLRVKGRFVBVSDVHVDGRHQ


)DPLO\'RFWRU(VWUpV&yPRDIURQWDUORVUHWRVGHODYLGD http://familydoctor.org/
RQOLQHIDPGRFHVKRPHFRPPRQPHQWDOKHDOWKVWUHVVSULQWHUYLHZKWPODVHVDGR
HQ

,QVWLWXWR 1DFLRQDO SDUD OD 6HJXULGDG \ 6DOXG 2FXSDFLRQDO ([SRVLFLyQ DO HV-
trs: riesgos ocupacionales en los hospitales http://www.cdc.gov/spanish/niosh/
GRFVBVSDVHVDGRHQ

,QVWLWXWR 9DOHQFLDQR GH 6HJXULWDG \ 6DOXG HQ HO 7UDEDMR  KWWSZZZLQ-
YDVVDWJYDHVLQGH[SKS"RSWLRQ FRPBUHPRVLWRU\ ,WHPLG  IXQF OHLQIR
LG DVHVDGRHQ

0HQWDO+HDOWK$PHULFD)DFWVKHHW/LVWDGH5HIHUHQFLDSDUDHO(VWUpV http://www.
mentalhealthamerica.net/go/information/get-info/en-espanol/lista-de-referencia-
SDUDHOHVWUpVDVHVDGRHQ

1DWLRQDO ,QVWLWXWH RI 0HQWDO +HDOWK (O HVWUpV HQ HO WUDEDMR KWWSZZZFGFJRY
VSDQLVKQLRVKGRFVVSKWPODVHVDGRHQ

1DWLRQDO,QVWLWXWHRI0HQWDO+HDOWKNIMH7UDVWRUQRGH(VWUpV3RVWUDXPiWLFR http://
ZZZQLPKQLKJRYKHDVHVDGR HQ DOWKSXEOLFDWLRQVHVSDQROWUDVWRUQR
GHHVWUHVSRVWUDXPDWLFRIDFLOGHOHHULQGH[VKWPODVHVDGRHQ

1DWLRQDO ,QVWLWXWHV RI +HDOWK NIH  (VWUpV http://www.nlm.nih.gov/medlineplus/


VSDQLVKVWUHVVKWPODVHVDGRHQ

1DWLRQDO,QVWLWXWHVRI+HDOWK NIH 0DQHMRGHOHVWUpV http://www.nlm.nih.gov/me-


GOLQHSOXVVSDQLVKHQF\DUWLFOHKWPDVHVDGRHQ

2UJDQL]DFLyQ0XQGLDOGHOD6DOXG&ODVLFDFLyQHVWDGtVWLFDLQWHUQDFLRQDOGHHQ-
IHUPHGDGHV \ SUREOHPDV UHODFLRQDGRV FRQ OD VDOXG  D UHYLVLyQ Y  /LVWD
WDEXODU:DVKLQJWRQ'&236 SXEOLFDFLyQFLHQWtFD 

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 276 Manual de teoras emocionales y motivacionales - UJI
1DWLRQDO,QVWLWXWHVRI+HDOWK NIH  NIH;3ODLQ&RQWURODQGRHOHVWUpV0DQHMDU
HO(VWUpV7XWRULDO,QWHUDFWLYRKWWSZZZQOPQLKJRYPHGOLQHSOXVVSDQLVKWXWR-
ULDOVPDQDJLQJVWUHVVVSDQLVKKWPLQGH[KWPDVHVDGRHQ

7HHQV +HDOWK /D 7HQVLyQ HPRFLRQDO HVWUpV KWWSNLGVKHDOWKRUJWHHQHQBHVSD-


QROPHQWHVWUHVVBHVSKWPODVHVDGRHQ

7HHQV +HDOWK 6tQGURPH GH IDWLJD FUyQLFD KWWSNLGVKHDOWKRUJWHHQHQBHVSDQRO


HQIHUPHGDGHVFIVBHVSKWPODVHVDGRHQ

7KH&OHYHODQG&OLQLF0DQHMDWXHVWUpV'LH]PDQHUDVGHDOLYLDUWXHVWUpV http://
P\FOHYHODQGFOLQLFRUJHVBKHDOWK\BOLYLQJVWUHVVBPDQDJHPHQWKLFBBZD\VBWRB
HDVHBVWUHVVDVS[DVHVDGRHQ

7KH+RUPRQH)RXQGDWLRQ/DVKRUPRQDV\XVWHG(OHVWUpV\VXVDOXGKWWSZZZ
KRUPRQHRUJ6SDQLVK)DFWVKHHWVB6SDQLVKXSORDGVSDQLVKBVWUHVVSGI DVHVDGR HQ


F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 277 Manual de teoras emocionales y motivacionales - UJI
Conclusiones generales
A lo largo de los diferentes captulos que conforman este manual se ha intentado
mostrar al lector una visin general de lo que son los procesos de motivacin y
(PRFLyQFHQWUiQGRQRVHQODVSULQFLSDOHVWHRUtDVVHJ~QWUHVJUDQGHVRULHQWDFLRQHV
a saber: la biolgica, la conductual y la cognitiva. En este ltimo apartado nos gus-
tara, a modo de cierre, exponer cmo se halla la situacin en el momento actual,
teniendo en cuenta esas tres grandes orientaciones.

Respecto a la orientacin biolgica, tanto en motivacin como en emocin, hemos


de sealar que, si bien en nuestros das son los modelos cognitivistas los que pre-
dominan, aquella sigue teniendo un importante peso. Partiendo de la indiscutible
QHFHVLGDGGHVHJXLUDYDQ]DQGRHQHOFRQRFLPLHQWRGHODVHVWUXFWXUDV\ORVPHFD-
QLVPRVELROyJLFRVLPSOLFDGRVHQODPRWLYDFLyQ\HQODHPRFLyQSRGHPRVDUPDU
que estos constituyen aspectos de los cuales no podemos prescindir en una ciencia
como la psicolgica.

Por ello, consideramos que la dimensin neurobiolgica es imprescindible para


FRQRFHU \ FRPSUHQGHU ORV SURFHVRV HPRFLRQDOHV \ PRWLYDFLRQDOHV 3DOPHUR
 &RPR\DVHKDVHxDODGRHQFDStWXORVDQWHULRUHVDFWXDOPHQWHODRULHQWD-
cin centrada en la neurociencia cognitiva nos aporta soluciones de relevancia a
la hora de entender los procesos de la motivacin y la emocin, ya que combina
argumentos e hiptesis procedentes de las aproximaciones neurobiolgica y cog-
nitivista. As pues, en nuestros das, la estrategia que se va imponiendo de forma
progresiva para abordar las variables referentes a la motivacin, la emocin y
la cognicin, es la de la sntesis. Desde esta perspectiva, lo que se pretende es
considerar dichas variables de una forma conjunta y combinada, es decir, de una
forma interactiva.

)LQDOPHQWHHQORTXHDODRULHQWDFLyQELROyJLFDUHVSHFWDVHKDQGHGHVWDFDUORV
LPSRUWDQWHVDYDQFHVFRQVHJXLGRVJUDFLDVDODXWLOL]DFLyQGHODVPRGHUQDVWpFQLFDV
GHQHXURLPDJHQFRQHOQ~OWLPRGHSRGHUORFDOL]DUHOVXVWUDWRQHXURELROyJLFR
LPSOLFDGRHQFDGDXQDGHODVRSHUDFLRQHVPHQWDOHVPiVHOHPHQWDOHVGHODHPRFLyQ
y de la motivacin.

Respecto a la orientacin conductualVXPi[LPRDSRJHRVHSURGXMRDSDUWLUGH


ORVDxRV\GXUDQWHODVGpFDGDV\GHOVLJORXX, conviviendo con el plantea-
PLHQWRELRORJLFLVWD\ORVSUHFXUVRUHVGHODRULHQWDFLyQFRJQLWLYD SHM7ROPDQ\
+XOO (VWDDSUR[LPDFLyQWHyULFDHQIDWL]DODLPSRUWDQFLDGHORVIDFWRUHVDPELHQWD-
OHVHQORVSURFHVRVPRWLYDFLRQDOHV\HPRFLRQDOHVDXQTXHVLQROYLGDUODLQXHQFLD
de los factores biolgicos.

Son dignas de destacar las distintas aportaciones surgidas desde el campo del
DSUHQGL]DMHTXHHQVXVGLVWLQWDVPRGDOLGDGHVVHKDQFHQWUDGRHQODVGLPHQVLR-
QHVGHUHVSXHVWDVLROyJLFD\PRWRUDFRQGXFWXDOH[SUHVLYDSRUFRQVLGHUDUODVUHV-

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 278 Manual de teoras emocionales y motivacionales - UJI
SXHVWDVREMHWLYDVGLUHFWDPHQWHREVHUYDEOHV(OLQWHUpVVHIRFDOL]DHQORVFDPELRV
observables, tanto de la conducta como del ambiente.

8QDGHODVJXUDVPiVUHSUHVHQWDWLYDVGHOFRQGXFWLVPRUDGLFDOIXH6NLQQHUTXLHQ
GHVWDFDORVHIHFWRVGHODPELHQWHVREUHODFRQGXFWDFRQVLGHUDQGRVLHPSUHODLQXHQ-
cia de la herencia gentica. Distingui dos tipos de conducta: la conducta respon-
diente, provocada por estmulos, y la conducta operante, que se produce libremente y
SURGXFHFRQVHFXHQFLDV/DVFRQGXFWDVGHPD\RUFRPSOHMLGDGVHDGTXLHUHQPHGLDQWH
el moldeamiento. Por lo que respecta a los estados internos, referidos a los pensa-
mientos y sentimientos, los consideraba como efectos de la conducta y no como las
SRVLEOHVFDXVDVGHODVPLVPDV/DDSRUWDFLyQPiVUHOHYDQWHGHODLQYHVWLJDFLyQGH
6NLQQHUIXHHOFRQRFLPLHQWRGHORVIDFWRUHVDPELHQWDOHVHQODFRQGXFWDGHORVVXMHWRV
KXPDQRV\QRKXPDQRV \XQDPHWRGRORJtDGHHVWXGLRGHODGHVFULSFLyQODH[SOLFD-
cin, la prediccin y el control de la conducta.

3RURWUDSDUWHODPRWLYDFLyQGHLQFHQWLYRHQVXVGLYHUVDVDFHSFLRQHV JHQHUDGRUHV
GHHQHUJtDJHQHUDGRUHVGHHPRFLyQ\SRUWDGRUHVGHLQIRUPDFLyQ HVXQIDFWRUPH-
diador entre las caractersticas de la meta y la conducta motivada dirigida hacia su
FRQVHFXFLyQ/RVLQFHQWLYRVUHSUHVHQWDGRVSRUORVHVWtPXORVDPELHQWDOHVDVRFLD-
dos con la recompensa, as como las propiedades hednicas de la misma, actan
como factores reguladores de la ejecucin de la conducta motivada.

En la actualidad, el papel desempeado por los incentivos constituye uno de los


HMHVFHQWUDOHVGHODVWHRUtDVH[SOLFDWLYDVGHORVSURFHVRVDGLFWLYRV /ySH] 
en los que coexisten de forma combinada los factores motivacionales y afectivos.

'HO PLVPR PRGR HQ ORV ~OWLPRV WLHPSRV ODV WHRUtDV GHO DSUHQGL]DMH YDQ DVX-
miendo los planteamientos del procesamiento de la informacin surgidos en la
GpFDGDGHLQX\HQGRHQODUHFRQFHSWXDOL]DFLyQGHORVWpUPLQRVXWLOL]DGRV
HQHOFDPSRGHODSUHQGL]DMHFRQXQDLQWHUSUHWDFLyQFRJQLWLYLVWDPiVDFRUGHFRQ
ORVSODQWHDPLHQWRVDFWXDOHV SHMHOHVWtPXORGLVFULPLQDWLYRFRPRH[SHFWDWLYD 

Respecto a la orientacin cognitiva acerca del funcionamiento de los procesos


TXHQRVRFXSDQORVGLVWLQWRVHVWXGLRVUHDOL]DGRVGHVGHODVGLYHUVDVSHUVSHFWLYDV
tericas constatan la relevancia que presentan en la manifestacin de la conducta.
6LELHQFDGDXQRGHORVSURFHVRVSVLFROyJLFRVUHTXLHUHODFRQXHQFLDGHIDFWRUHV
biolgicos y ambientales, en muchas ocasiones estos no llegan a elicitar una con-
GXFWD\DTXHODYDORUDFLyQUHDOL]DGDGHORVHVWtPXORVSUHVHQWHVGHODRSRUWXQLGDG
RQRGHUHDOL]DUXQDDFFLyQGHODYDORUDFLyQGHODVFRQVHFXHQFLDVTXHVHHVSHUD
DOFDQ]DUHQWUHRWURVDVSHFWRVFRQWULEX\HQDGHWHUPLQDUHQTXpPRPHQWRHVPiV
RSRUWXQROOHYDUDFDERODFRQGXFWD3RURWUDSDUWHFXDQGRVHSUHVHQWDQGLFXO-
tades en la toma de una decisin, en determinados casos, la consecuente activa-
FLyQVLROyJLFDSHUFLELGDFRQWULEXLUiDHPSOHDUUHFXUVRVFRJQLWLYRVFHQWUDGRVHQ
HOFRQWUROGHGLFKDDFWLYDFLyQDSOD]DQGRODVDFFLRQHVGLULJLGDVDODFRQVHFXFLyQGH
XQREMHWLYR(VGHFLUORVIDFWRUHVFRJQLWLYRVJXLDUiQODGHFLVLyQGHUHDOL]DURQR
la conducta.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 279 Manual de teoras emocionales y motivacionales - UJI
No obstante, como hemos sealado anteriormente, a pesar de la destacada relevan-
cia que poseen en la actualidad los modelos cognitivistas en el desarrollo de los
SURFHVRVPRWLYDFLRQDOHV\HPRFLRQDOHVQRVHUHFKD]DODFRQXHQFLDHLQWHUDFFLyQ
FRQODVYDULDEOHVVLROyJLFDV\HVWLPXODUHV/DLQWHUDFFLyQHQWUHFRJQLFLyQELR-
loga y ambiente es constante, contribuyendo a explicar la complejidad del com-
portamiento. Dicha interaccin es fundamental si tenemos en cuenta que las bases
biolgicas, entendidas estas como el conjunto de comunicacin interneuronal, son
necesarias para que tengan lugar los distintos procesos cognitivos y conductuales.

En otro orden de cosas, queremos sealar tambin que, aunque determinados


acontecimientos emocionales no implican siempre cognicin consciente, debido
DOSURFHVDPLHQWRDXWRPiWLFRTXHVHSURGXFHHQPXFKDVRFDVLRQHVSURGXFLHQGRXQD
UHVSXHVWDDXWRPiWLFDDODVLWXDFLyQHQODDFWXDOLGDGH[LVWHQSRFDVGXGDVGHTXH
los factores afectivos, en toda su magnitud biolgica y modulacin ambiental,
LQX\HQ HQ ORV SURFHVRV FRJQLWLYRV DWHQFLyQ PHPRULD HYDOXDFLyQYDORUDFLyQ
PRWLYDFLyQ DOPLVPRWLHPSRTXHORVSURFHVRVFRJQLWLYRVWLHQHQXQDJUDQUHOH-
YDQFLDDODKRUDGHHQWHQGHUFyPR\GHTXpWLSRHVRVHUiODUHVSXHVWDDIHFWLYDHQ
general, o emocional en particular, sabiendo que esa respuesta ofrecida siempre es
HOUHVXOWDGRGHOSURFHVRGHYDORUDFLyQTXHHOLQGLYLGXRUHDOL]DVREUHHOHVWtPXORR
situacin que le afecta.

En suma, pensamos que el sistema cognitivo puede ser considerado como un me-
FDQLVPRFRPSOHMR\DYDQ]DGRFDSD]GHSURFHVDUH[KDXVWLYDPHQWHWRGDODLQIRU-
PDFLyQUHFLELGDWDQWRLQWHUQDFRPRH[WHUQDSHUPLWLHQGRODSODQLFDFLyQGHHV-
trategias y formas concretas de conducta con las que hacer frente a las situaciones
complejas en las que las personas llegan a encontrarse. As, el sistema cognitivo
WLHQHXQDIRUPDGHDFWXDFLyQPiVHODERUDGDPiVFRQWURODGD\PiVPLQXFLRVDGH
la informacin, seleccionando aquellas estrategias que son percibidas como las
PiVDSURSLDGDVDFDGDVLWXDFLyQDODTXHVHHQIUHQWDHOLQGLYLGXR/DFRPSUHQVLyQ
de tal compleja actuacin es aportada por los avances de los estudios que desde la
neurociencia se llevan a cabo.

F. Palmero / C. Guerrero / C. Gmiz / A. Carpi / R. Gorayeb - ISBN: 978-84-694-2087-4 280 Manual de teoras emocionales y motivacionales - UJI
A Parte Rei 47, Septiembre 2006

Un breve recorrido por la concepcin de las emociones


en la Filosofa Occidental.

Cristina Casado y Ricardo Colomo


Universidad Complutense de Madrid y Universidad Carlos III de Madrid.

Introduccin

El estudio de las emociones y pasiones humanas constituye un tema clsico en


la historia del pensamiento filosfico. Disciplinas como la Psicologa, heredera de la
Filosofa, ha aceptado, entre otros, el legado de la exploracin de los sentimientos y
las emociones. Dicha herencia ha sido y es muy relevante para el desarrollo de las
teoras psicolgicas sobre emocin, sin embargo es una herencia que, en su mayor
parte, se desconoce. Por esa razn, los psiclogos interesados en las emociones no
slo debemos conocer el pasado filosfico sino entenderlo como una permanente
fuente de inspiracin para el presente y futuro desarrollo de la psicologa de las
emociones.
El presente artculo representa un breve recorrido por las aportaciones de los
mximos exponentes del pensamiento occidental, haciendo hincapi en aquellos
pensadores que han tenido una especial influencia en el desarrollo posterior de teoras
psicolgicas sobre la emocin.
En una primera aproximacin advertimos que los preceptos filosficos sobre las
emociones/pasiones ha sido muy amplia: Algunos han proclamado que debe buscarse
una armona de las emociones; otros consideran que deben cultivarse solamente
aquellas emociones que causan alegra o placer; otros, por su parte, afirman que
cualesquiera que sean las emociones, stas han de experimentarse con moderacin y
otros plantean que es mejor negar o descartar las emociones 1. A grandes rasgos y
como seala Abbagnano 2, el planteamiento de los filsofos a lo largo de la historia del
pensamiento se puede dividir en dos grandes orientaciones: la primera de ellas se
correspondera con las doctrinas que dotan de significado a las emociones; y la
segunda estara representada por aquellas que niegan dicho significado.
Las teoras que reconocen un significado a las emociones, consideran a stas
como los valores de las situaciones con referencia a las posibilidades de conservacin,
de desarrollo, de realizacin de los intereses o deberes que ofrecen al individuo.
Desde esta orientacin, por tanto, se reconoce que el significado de las emociones se
liga por sistema con la negacin, implcita o explcita, de la naturaleza necesariamente
racional del mundo en el que el hombre vive.
Por otra parte, aquellas doctrinas que niegan el significado de las emociones,
consideran que el mundo es una totalidad perfecta, que garantiza de modo absoluto la
existencia del individuo y la realizacin de sus intereses legtimos, es decir, de la parte
racional del hombre. Desde esta perspectiva la nocin de pensamiento confuso
aplicada a las emociones aparece en autores como Spinoza, Leibniz, Wolff, entre
otros. Un pensamiento confuso es equivalente a la nocin de opinin vana

1
Ferrater Mora, J. Diccionario de Filosofa. Barcelona: Ariel Referencia, 1994.
2
Abbagnano, N. Diccionario de Filosofa. FCE. Mxico-Buenos Aires. 1963.

http://serbal.pntic.mec.es/AParteRei/ 1
Cristina Casado y Ricardo Colomo

perteneciente a la filosofa estoica. Un pensamiento confuso es un pensamiento que


no es tal en verdad y, por tanto, est destinado a desaparecer como una opinin falaz
o un error provisional frente a la verdad. El mundo, al ser racional no contiene
amenaza alguna para el hombre, con lo que no tienen sentido las experiencias
emocionales que conduzcan a la superacin de esa amenaza.
Desde esta misma perspectiva algunos filsofos reducen las emociones a
accidentalidades empricas, a particularidades insignificantes, es el caso de Hegel.
Es un concepto igualmente basado en la idea de que el mundo no representa una
amenaza real para el hombre.
Sin embargo, estos pensadores que consideran que el mundo es
racionalmente perfecto, no explican por qu el ser humano que constituye la parte ms
racional del mundo, se caracteriza por la manifestacin de errores, de estereotipos,
prejuicios, en definitiva, determinaciones capaces de perturbar dicha racionalidad.
En la actualidad, tanto el pensamiento filosfico, como el psicolgico,
sociolgico o biolgico asumen que para aprehender la conducta y existencia del
hombre es imprescindible la exploracin y conocimiento de las emociones. De hecho,
en los ltimos aos el inters e importancia de las emociones se ha dejado sentir
igualmente en el mbito aplicado.

Lo que cuenta la Historia: De Platn a Sartre.

Ser un viaje fugaz por la historia del pensamiento occidental, pero esperamos
clarificador. Nuestro itinerario comienza, como es lgico, por la filosofa griega clsica.
La primera teora de la emocin fue enunciada por Platn en el Filebo3
contraponiendo en el dilogo entre Scrates y Protarco el dolor y el placer. Dividi la
mente o alma en los dominios cognitivo, afectivo y apetitivo, la triloga bsica de Platn
es razn, apetito y espritu, que en actualidad se corresponde en Psicologa con la
cognicin, motivacin y emocin. Platn utiliza la metfora del auriga que representa el
componente racional, y los dos caballos que ste debe conducir, simbolizan los
componentes afectivo y apetitivo. Un caballo es bueno (componente afectivo),
mientras que el otro es malo (el aspecto apetitivo).
Pero quiz la teora clsica ms completa es la desarrollada por Aristteles en
su obra Retrica4. Para Aristteles la emocin es toda afeccin del alma
acompaada de placer o de dolor, y en la que el placer y el dolor son la advertencia
del valor que tiene para la vida el hecho o la situacin a la que se refiere la afeccin
misma. As las emociones pueden considerarse como la reaccin inmediata del ser
vivo a una situacin que le es favorable o desfavorable; inmediata en el sentido de que
est condensada y, por as decirlo, resumida en la tonalidad sentimental, placentera o
dolorosa, la cual basta para poner en alarma al ser vivo y disponerlo para afrontar la
situacin con los medios a su alcance.
A su vez Aristteles, al considerar el placer relacionado con la realizacin de
un hbito o de un deseo natural le atribuy la misma funcin de restitucin de una
condicin natural y, en consecuencia, consider doloroso lo que aleja violentamente la
condicin natural y, por lo tanto, es contrario a la necesidad y a los deseos del ser
vivo. As pues, para Aristteles al contrario que Platn, las dos dimensiones del alma,
racional e irracional, forman una unidad y entiende que las emociones poseen
elementos racionales como creencias y expectativas, razn por la que es considerado

3
Platon, Dilogos, VI: Filebo, Timeo, Critias, Gredos, Madrid 1992.
4
Aristteles, Retrica, Gredos, Madrid 1999.

http://serbal.pntic.mec.es/AParteRei/ 2
Un breve recorrido por la concepcin de las emociones en la Filosofa Occidental

un precursor de las teoras cognitivas de la emocin, como pone de manifiesto Magda


Arnold en su obra Emotion and Personality5
Platn y Aristteles mantienen una concepcin funcionalista de las
emociones. Sin embargo, para los estoicos las emociones no tienen significado ni
funcin alguna. Segn ellos, la naturaleza ha provedo de modo perfecto a la
conservacin y al bien de los seres vivos, dando a los animales el instinto y al hombre
la razn. Las emociones son consideradas como perturbaciones del nimo, como
opuestas a la razn. Las emociones no son provocadas por ninguna fuerza natural,
son opiniones o juicios dictados a la ligera y, por tanto, fenmenos de estulticia y de
ignorancia.
Los estoicos distinguen cuatro emociones fundamentales: el anhelo de los
bienes futuros y la alegra por los bienes presentes (originadas por bienes presuntos);
y el temor a los males futuros y la afliccin por los males presentes (originadas por
males presuntos). A tres de estas emociones, el anhelo, la alegra y el temor, les
correspondan tres estados normales propios del sabio, es decir, la voluntad, la alegra
y la precaucin, respectivamente, todos ellos estados de calma y de equilibrio racional.
Los estoicos reducan las dems emociones a las cuatro fundamentales, consideradas
todas como enfermedades crnicas, capaces a su vez de generar otras emociones de
aversin y de deseo. Para estos filsofos, el hombre sabio no puede ms que tomar
conocimiento y vivir conforme a la razn, es el ser racionalmente perfecto, el mundo
como orden racional no puede amenazar al sabio. Por consiguiente, la afliccin o el
temor, tanto como el anhelo o la alegra constituyen un bien fuera de la razn o un
mal que pueda amenazar a la razn. Por lo tanto, para el estoicismo, las emociones
son juicios errados, opiniones vacas y privadas de sentido.
El pensamiento cristiano vuelve a dotar de importancia a las emociones. San
Agustn subraya el carcter activo y responsable de las emociones, cobrando
importancia la nocin de voluntad. Dice al respecto en su obra La ciudad de Dios6:

La voluntad se halla en todos los movimientos del alma (...) qu son la


codicia y la alegra sino consciente voluntad por las cosas deseadas? Y qu otra
cosa sino la voluntad que rechaza las cosas no queridas, el miedo y la tristeza? (...) la
voluntad humana ora atrada ora rechazante, se cambia y se transforma en esta o en
aquella emocin

Por su parte, Santo Toms restablece el concepto de la emocin como


afeccin, es decir, modificacin sbita, y la refiere a ese aspecto del alma por el cual
sta es potencialidad y puede recibir o padecer una accin. Para este autor, y en
especial en su obra Suma Teolgica7 (en la que en su parte segunda y en las
cuestiones 22 a 48 se analizan las pasiones del alma, utilizando un encabezamiento
idntico al que posteriormente utilizara Descartes) las emociones pertenecen ms a
la parte apetitiva del alma que a la aprehensiva y especficamente al apetito sensible
ms que al apetito espiritual, ya que a menudo estn unidas a mutaciones corporales.
Para Santo Toms hay emociones que se refieren a la parte irascible y otras que se
refieren a la parte concupiscible. Las emociones que se refieren al bien y al mal
tomados por si pertenecen a la facultad concupiscible, por ejemplo, la alegra, la
tristeza, el amor, el odio, etc. En cambio, las emociones que pertenecen al bien o al
mal en cuanto stos son difciles de conseguir o evitar respectivamente, pertenecen a
la facultad irascible, por ejemplo, la audacia, el temor, la esperanza, la desesperacin,
etc.

5
Arnold, M. Emotion and Personality, Nueva York: Columbia University Press, 1960.
6
San Agustn, Obras completas, 41 volmenes; Editorial BAC: Madrid.
7
Aquino, T., Suma Teolgica. Biblioteca de Autores Cristianos. Madrid. 1969.

http://serbal.pntic.mec.es/AParteRei/ 3
Cristina Casado y Ricardo Colomo

Las emociones que pertenecen a la parte concupiscible se refieren al


movimiento por el cual se obtiene un bien o se aleja un mal, las que pertenecen a la
parte irascible condicionan la realizacin de emociones concupiscentes. As, en un
mundo donde el bien es difcil de obtener y el mal difcil de evitar, la anticipacin de
bien o del mal y el esfuerzo para conseguirlo o evitarlo respectivamente median para
las otras emociones.
Este mismo planteamiento funcionalista de las emociones es defendido por las
doctrinas naturalistas (Telesio, Patrizzi, Giordano Bruno) formuladas en los siglos
XVI y XVII. Un ejemplo de ello lo constituye Telesio que reconoce la funcin biolgica
del placer y del dolor. Al cuerpo y al espritu vital aportan dolor las cosas, que dotadas
de fuerzas prepotentes y contrarias, los sacan de su posicin y los corrompen y, en
cambio, llevan placer las cosas que dotadas de fuerzas similares y afines los
favorecen, los vivifican y les restituyen a la propia disposicin.
De este modo, las emociones nacen de la situacin difcil en que el espritu vital
y el cuerpo se encuentran en el mundo. En efecto, el espritu se encuentra situado en
un lugar extrao y en medio de acontecimientos contrarios, de los cuales el cuerpo no
llega a protegerlo a punto de evitar que se canse o que disminuya, y el cuerpo mismo,
que lo reviste y protege, es continuamente modificado y corrompido no solamente por
las fuerzas ambientales sino tambin por su mismo calor, ya que en breve tiempo
perecera si no se reparara mediante el alimento.
En esta situacin el espritu vital, para poder sobrevivir, necesita percibir y
entender las fuerzas de todas las otras cosas y desear y perseguir a aquellas que le
dan la manera y la facultad de protegerse del calor excesivo, del fro intenso y de
nutrirse y reponerse nuevamente y que en general, lo conmuevan y lo lleven a su
nueva operacin. Al tener estas cosas a su disposicin las goce y que quiera y sienta
veneracin por los que se las procuran, en tanto que, por el contrario, se entristezca
cuando le faltan y sienta odio e intente destruir a los que intentan privarle de ellas. De
tal manera se generan las emociones fundamentales, el amor y el odio, que por lo
tanto tienen su origen en la situacin en que el espritu humano llega a encontrarse
ante el mundo natural.
El hombre es llevado a la convivencia, no slo por la necesidad de satisfacer
los deseos que no podra satisfacer por si mismo, sino tambin por la tendencia a
gozar de la compaa de sus semejantes, y por esta tendencia es llevado a las
relaciones sociales y a desear la familiaridad y la benevolencia. Tales relaciones
determinan, por lo tanto, otro grupo de emociones, como temor, dolor, placer,
satisfacciones inherentes al comportamiento recproco de los hombres. As pues,
Telesio establece una interesante categora de emociones sociales.
Por fin, un tercer grupo de emociones nace del sentimiento de orgullo y de
satisfaccin que el espritu prueba al sentirse ntegro y al reconocer en los otros la
integridad y la pureza que para si mismo desea. Se determina as el sentimiento del
honor y su contrario, que es el de desprecio y otros semejantes, todos los cuales se
relacionan tambin con la situacin natural del espritu humano en el mundo. En la
Psicologa la emocin de desprecio es considerada por parte del modelo neurocultural
o universalista8, una de las emociones bsicas.
El planteamiento de Telesio es similar al de Hobbes. Para ste ltimo, las
emociones constituyen una de las cuatro facultades humanas fundamentales, junto a
la fuerza fsica, la experiencia y la razn. Hobbes relaciona en su obra cumbre
Leviathan9 las emociones con los principios invisibles del movimiento del cuerpo
humano que preceden a las acciones visibles y que por lo comn se denominan

8
Ekman, P. Basic emotions. En Dalgleish, Tim (Ed); Power, Mick J. (Ed). (1999). Handbook of
cognition and emotion. (pp. 45-60). New York, NY, US: John Wiley & Sons Ltd.
9
Hobbes, T., Leviatn, Madrid, Alianza, 1989.

http://serbal.pntic.mec.es/AParteRei/ 4
Un breve recorrido por la concepcin de las emociones en la Filosofa Occidental

tendencias. Las tendencias se llaman deseos o apetitos, o bien aversiones respecto a


los objetos que las producen y que como tales son los integrantes de todas las
emociones humanas. As, deseo y amor, aversin y odio, son lo mismo excepto que
las palabras deseo y aversin implican la ausencia del objeto, en tanto las palabras
odio y amor, implican la presencia.
Lo que no se desea ni se odia se dice que se desprecia, y el desprecio es una
especie de inmovilidad del corazn, retraerse a sufrir la accin de determinadas cosas.
La tonalidad placentera o dolorosa de una emocin garantiza su funcin vital. Hobbes
dice que las emociones que causan deleite ayudan a fortalecer la mocin vital y las
emociones molestas y ofensivas obstaculizan y perturban dicha mocin vital.
Entendidas as, las emociones controlan la total conducta del hombre y la voluntad
misma.
Por su parte, David Hume efecta uno de los anlisis de las emociones ms
transgresores planteados hasta el momento porque aboga por la exploracin y
medicin de los sentimientos en la misma forma que pueden medirse los fenmenos
fsicos: el origen y juego de las pasiones estn sometidos a un mec