Anda di halaman 1dari 106

i

MANAJEMEN DAN PENDOKUMENTASIAN ASUHAN KEBIDANAN IBU NIFAS


PADA NYF DENGAN ANEMIA BERAT DI RUANG DELIMA
RUMAH SAKIT UMUM DAERAH KABUPATEN MUNA
TANGGAL 4 S.D. 7 MEI 2014

Karya Tulis Ilmiah

Diajukan sebagai Salah Satu Syarat dalam Menyelesaikan Pendidikan


di Akademi Kebidanan Paramata Raha Kabupaten Muna

Oleh:

DARMINA
NIM: 2011.IB.0062

YAYASAN PENDIDIKAN SOWITE


AKADEMI KEBIDANAN PARAMATA RAHA
KABUPATEN MUNA
2014

i
ii

LEMBAR PERSETUJUAN

Karya Tulis Ilmiah

Manajemen dan Pendokumentasian Asuhan Kebidanan Ibu Nifas


pada NyF dengan Anemia Berat di Ruang Delima
Rumah Sakit Umum Daerah Kabupaten Muna
Tanggal 4 s.d. 7 Mei 2014

Telah disetujui untuk diseminarkan dihadapan Tim Penguji Karya Tulis Ilmiah
Akademi Kebidanan Paramata Raha Kabupaten Muna

Raha, September 2014


Pembimbing I Pembimbing II

Fitria Ningsih, S.ST Dina Asminatalia, S.Kep.,Ners.

Mengetahui,
Direktur Akbid Paramata Raha
Kabupaten Muna

Rosminah Mansyarif, S.Si.T., M.Kes.

ii
iii

LEMBAR PENGESAHAN

Karya Tulis Ilmiah ini telah diperiksa dan disahkan oleh Tim Penguji Karya TulisIlmiah Akademi
Kebidanan Paramata Raha Kabupaten Muna

TIM PENGUJI

1. Wa Ode Siti Asma, S.ST., M.Kes. (.................................................)

2. Fitria Ningsih, S.ST(.................................................)

3. Dina Asminatalia, S.Kep.Ners. (................................................)

Raha, September 2014


Pembimbing I Pembimbing II

Fitria Ningsih, S.STDina Asminatalia, S.Kep.Ners.

Mengetahui,
Direktur Akbid Paramata Raha
Kabupaten Muna

Rosminah Mansyarif, S.Si.T., M.Kes.

iii
iv

RIWAYAT HIDUP

A. Identitas Diri

1. Nama : DARMINA

2. NIM : 2011.1B.0062

3. Tempat/ tanggal lahir : Bonea, 02 Juni 1993

4. Agama : Islam

5. Suku/ kebangsaan : Muna / Indonesia

6. Alamat : Desa Labone

B. Identitas Orang tua

1. Nama Ayah /Ibu : La Ode Ruma / Wa Ati

2. Pekerjaan : Tani/Tani

3. Alamat : Desa Labone.

C. Pendidikan

1. SD Negeri 1 Napabalano tamat tahun 2005

2. SMP Negeri 2 Napabalano tamat tahun 2008

3. SMA Negeri Khusus Raha tamat tahun 2011

4. Akademi Kebidanan Paramata Raha tahun 2011 sampai sekarang

iv
v

KATA PENGANTAR

Pujisyukur kami panjatkan Kehadirat Allah


SubuhanaWataalaberkatlimpahanRahmatdanKarunia-Nyasehinggapenulisan Karya
Tulis Ilmiah ini denganjudul Manajemen dan Pendokumentasian Asuhan
Kebidanan Ibu Nifas pada Ny F P1A0 Masa Nifas Hari Ke-3 dengan Anemia
Berat di Ruang Nifas Rumah Sakit Umum Daerah Kabupaten Muna Tanggal 4
s.d. 7 Mei 2014 dapat terselesaikan.
PenulismenyadaribahwadalampenyusunanKaryaTulisIlmiahini,
masihbanyakkekurangandankekeliruan,
olehnyaitupenulissangatmengharapkankritikandanmasukandariberbagaipihakgunakes
empurnaanKaryaTulisIlmiah ini. Seiring dengan penulisan ini, penulis
menyampaikan ucapan terima kasih dan penghargaan setinggi-tingginya kepadaFitria
Ningsish,S.ST, selaku pembimbing Idan Dina Asminatalia, S.Kep.Ners. selaku
pembimbing II, dengan penuh kesabaran telah meluangkan waktunya dalam
memberikan bimbingan dan dorongan sehingga Karya Tulis Ilmiah ini dapat
terselesaikan.
Tak lupa pula penulismenyampaikan penghargaan dalam bentuk ucapan
terima kasih ucapanterimakasih yang tak terhingga atas doa dan motivasi dari
berbagai pihak maupun pribadi yang telah memberikan dukungannya dalam bentuk
apapun, diantaranya kepada :
1. La Ode Muhlisi, A.Kep, M.Kes,
selakuKetuaYayasanPendidikanSowiteAkademiKebidananParamataRahaKabupa
tenMuna.
2. RosminahMansyarif, S.Si.T,
M.KesselakuDirekturAkademiKebidananParamataRahaKabupatenMuna.
3. Wa Ode Siti Asma, S.Si. T., M.Kes. selaku Pudir I di Akademi Kebidanan
Paramata Raha sekaligus penguji studi kasus atas keiklasannya dan
bimbingannya yang sangat berharga dan tiada henti.
4. Seluruh jajaran dosen dan para staff Akademi Kebidanan Paramata Raha
Kabupaten Muna yang telah memberikan petunjuk dan bimbingan selama
mengikuti pendidikan dan penyusunan Karya Tulis Ilmiah ini.
5. Kepada kedua orang tuaku yang tercinta, ayahanda LA Ode Ruma, dan Ibuku
Wa Ati serta seluruh saudaraku(Herlina, Ice, Rahmat ) yang telah memberikan
dukungan hingga terselesainya karya tulis ini.
6. Seluruh sohib-sohibku terutama kepada Masir, Darniati, Hasrawati, serta teman-
teman yang tidak bisa saya sebutkan satu persatu yang
telahmemotivasidanmendukungsaya agar selaluoptimis.
Akhirnya penulis hanya bisa berharap, semoga Karya Tulis Ilmiah ini
bermanfaat bagi kita semua. Amin.
Raha, September 2014
Penulis

v
vi

DAFTAR ISI
Halaman Judul ......................................................................................................... i
Lembar Persetujuan ................................................................................................ ii
Lembar Pengesahan .............................................................................................. iii
Riwayat Hidup ...................................................................................................... iv
Kata Pengantar ........................................................................................................v
Daftar Isi ............................................................................................................... vii
Daftar Tabel ............................................................................................................ x
Inti Sari ................................................................................................................... xi
Bab I Pendahuluan ................................................................................................1
A. Latar Belakang ........................................................................................1
B. Ruang Lingkup Pembahasan ..................................................................3
C. Tujuan Telaah .........................................................................................3
1. Tujuan Umum ...................................................................................4
2. Tujuan Khusus ..................................................................................4
D. Manfaat Telaah .......................................................................................5
1. Manfaat Ilmiah .................................................................................5
2. Bagi Penulis ......................................................................................5
3. Bagi Profesi ......................................................................................5
4. Bagi Istitusi .......................................................................................5
E. Metode Telaah ........................................................................................6
1. Studi Kepustakaan ............................................................................6
2. Studi Kasus .......................................................................................6
3. Studi Dokumentasi ...........................................................................7
4. Diskusi ..............................................................................................7
F. Sitematika Penulisan ..............................................................................7
1. Bab I Pendahuluan ............................................................................7
2. Bab II Tinjauan Pustaka ...................................................................7
3. Bab III Studi Kasus ..........................................................................8
4. Bab IV Pembahasan .........................................................................8

vi
vii

5. Bab V Kesimpulan dan Saran ...........................................................9


Bab II Tianjauan Pustaka ....................................................................................9
A. Telaah Pustaka ........................................................................................9
1. Masa Nifas ........................................................................................9
2. Anemia ...........................................................................................20
B. Konsep Manajemen Kebidanan ............................................................29
1. Pengertian .......................................................................................29
2. Pedoman Penerapan Asuhan Kebidanan pada Masa Nifas ............30
3. Langkah Langkah Manajemen Kebidanan ...................................39
4. Dotarkumentasi Asuhan kebidanan ................................................44
Bab III Studi Kasus .............................................................................................46
A. Manajemen ...........................................................................................46
1. Langakah I. Identifikasi Data Dasar ...............................................46
2. Langkah II. Identifikasi Diagnosa/ Masalah Aktual .......................47
3. Langkah III. Identifikasi Diagnosa/Masalah Potensial ...................55
4. Langkah IV. Perlunya Tindakan Segera/Kolaborasi dan Konsultasi .
.........................................................................................................56
5. Langkah V. Rencana Asuhan .........................................................56
6. Langkah VI. Implemantasi .............................................................60
7. Langkah VII. Evaluasi ....................................................................62
B. Pendukumentasian ................................................................................63
C. Catatan Perkembangan .........................................................................67
Bab IV Pembahasan ............................................................................................75
A. Identifikasi Data Dasar .........................................................................75
B. Identifikasi Diagnosa/ Masalah Aktual ................................................76
C. Identifikasi Diagnosa/Masalah Potensial ..............................................77
D. Perlunya Tindakan Segera/Kolaborasi dan Konsultasi ........................78
E. Rencana Asuhan ...................................................................................79
F. Implemantasi ........................................................................................80
G. Evaluasi ................................................................................................80
Bab V Kesimpulan dan Saran ............................................................................81
vii
viii

A. Kesimpulan ...........................................................................................81
B. Saran .....................................................................................................82
Daftar Pustaka .....................................................................................................84
Lampiran-Lampiran

viii
ix

INTISARI
Darmina (2011.IB.0062) Manajemen dan Pendokumentasian Asuhan
Kebidanan Pada Ny F P1A0 Masa Nifas Hari Ke-3 dengan Anemia Berat di
Ruang Nifas RSUD Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014 Dibawah
BimbinganIbu Fitria Ningsih dan bapak Dina Asminatalia.

Latar Belakang : Baik di Negara maju dan Negara berkembang seseorang di katakan
anemia bila kadar hemoglobin (Hb) kurang dari 10gr%, disebut anemia berat dan
bila kurang dari 6 gr%, disebut anemia gravis. Wanita tidak dapat hamil bila tidak
mempunyai nilai normal hemoglobin 12-15 gr% dan hematokrit 35-54%. Penyakit
anemia yang menyerang ibu hamil, berpengaruh terhadap kehamilan, persalinan, dan
saat masa nifas.
Tujuan Penilitian Terlaksananya Asuhan Kebidanan Ibu Nifas pada Ny. F dengan
Anemia Berat di Rumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei
2014 dengan menggunakan pendekatan manajemen kebidanan 7 langkah Varney dan
pendokumentasian.
Metode Telaah : Studi kasus ini menggunakan metode Studi Kepustakaan, Studi
Kasus, Studi Dokumentasi dan Diskusi.
Hasil Penilitian :Setelah mendapatkan asuhan selama 3 hari, dari tanggal 4 sampai 7
Mei 2014 didapatkan hasil keadaan umum ibu baik dan kesadaran kompesmentis,
tanda-tanda vital yaitu Tekanan darah 120/80 mmHg, Nadi 80 kali/ menit, Suhu 36,5
0
C dan Pernapasan 20 kali/ menit, konjungtiva merah muda dan sklera tidak ikterus,
wajah dan ekstermitas tidak pucat serta kadat Hb Ny. F meningkat menj adi 7,0 gr/dl.

Kesimpulan :Dari pengkajian, interpretasi data, diagnosa potensial, perlunya


tindakan segera/kolaborasi, rencana tindakan, pelaksanaan sampai dengan evaluasi
tidak ada kesenjangan yang berarti dan semua permasalahan mengalami peningkatan
Kata Kunci : Masa Nifas dan Anemia Berat
Daftar Pustaka : 24 ( 2008-2013 )

ix
1

BAB I

PENDAHULUAN

A. Latar Belakang

Masa nifas atau puerperium dimulai dari 1 jam setelah lahirnya plasenta

sampai dengan 6 minggu (42 hari) setelah itu. Pelayanan paska persalinan harus

terselenggara pada masa itu untuk memenuhi kebutuhan ibu dan bayi, yang meliputi

upaya pencegahan, deteksi dini dan pengobatan komplikasi dan penyakit yang

mungkin terjadi, serta penyediaan pelayanan pemberian ASI, cara menjarangkan

kehamilan, imunisasi, dan nutrisi bagi ibu (Sarwono, 2010).

Perdarahan pervaginam yang melebihi 500 ml setelah bersalin didefinisikan

sebagai perdarahan pasca persalinan. Penilaian resiko pada saat antenatal tidak dapat

memperkirakan terjadinya perdarahan pasca persalinan. Penanganan aktif kala III

sebaiknya dilakukan pada semua wanita yang bersalin. Hal ini dapat menurunkan

insiden perdarahan pasca persalinan akibat atonia uteri (Bahiyatun, 2009).

Anemia adalah suatu kondisi medis dimana jumlah sel darah merah atau

hemoglobin kurang dari normal. Kadar hemoglobin normal umumnya berbeda pada

laki-laki dan perempuan. Untuk pria, anemia didefinisikan sebagai kadar hemoglobin

kurang dari 13,5 gr/100ml dan pada wanita sebagai kadar hemoglobin kurang dari

12,0 gr/100 ml (Atikah, 2011).

Masih banyak kematian ibu terjadi di negara berkembang termasuk Indonesia,

walaupun upaya untuk menurunkan Angka Kematian Ibu (AKI) sudah banyak

dilakukan tetapi hasilnya belum optimal. Sebab utama lambatnyapenurunan angka

kematian ibu, antara lain terlalu banyaknya kegiatan yang dilaksanakan dengan
1
2

sumber daya yang terbatas dan belum optimalnya kualitas pelayanan yang disediakan

baik oleh fasilitas kesehatan pemerintah maupun swasta. Sehingga dimasa mendatang

perlu ditetapkan dan dilaksanakan kegiatan prioritas yang mempunyai dampak

langsung terhadap penurunan kematian ibu berdasarkan permasalahan yang ada

(Sarwono, 2009).

Berdasarkan data yang di miliki oleh WHO, Indonesia berada di peringkat ke

tiga tertinggi untuk kematian ibu di Negara ASEAN. Angka kematian ibu di

Indonesia mencapai 9.900 orang dari 4,5 juta keseluruhan kelahiran pada tahun 2012.

Baik di Negara maju dan Negara berkembang seseorang di katakan anemia

bila kadar hemoglobin (Hb) kurang dari 10gr%, disebut anemia berat dan bila kurang

dari 6 gr%, disebut anemia gravis. Wanita tidak dapat hamil bila tidak mempunyai

nilai normal hemoglobin 12-15 gr% dan hematokrit 35-54%. Penyakit anemia yang

menyerang ibu hamil, berpengaruh terhadap kehamilan, persalinan, dan saat masa

nifas.

Diberbagai Negara paling sedikit dari seluruh kematian ibu disebabkan oleh

perdarahan, proporsinya berkisar antara 10% sampai dengan 60%. Menurut WHO

40% kematian ibu dinegara berkembang berkaitan dengan anemia pada kehamilan

dan kebanyakan anemia pada kehamilan disebabkan oleh defisiensi besi dan

perdarahan akut, bahkan tidak jarang keduanya saling berinteraksi. Walaupun

perempuan bertahan hidup setelah mengalami perdarahan pasca salin. Namun akibat

perdarahan tersebut pasien akan menderita kekurangan darah yang berat (anemia

berat) dan akan mengalami masalah kesehatan yang berkepanjangan terutama pada

masa nifas. (WHO, 2009).


3

Data khusus yang diperoleh dari Medical Record (Rekam Medis) di kantor

Dinas Kesehatan Kabupaten Muna, pada tahun 2011 dari bulan Januari sampai

Desember tercatat jumlah ibu nifas berkisar 5.704 orang, yang beresiko tinggi

mengalami komplikasi masa nifas berkisar 1.224 ( 21,45% ) orang.Pada tahun 2012

dari bulan Januari sampai Desember tercatat jumlah ibu nifas berkisar 6.012 orang,

yang beresiko tinggi mengalami komplikasi masa nifas berkisar 1.263 ( 21% ) orang

dan pada tahun 2013 dari bulan Januari sampai Desember jumlah ibu nifas berkisar

5.936 orang, yang beresiko tinggi mepngalami komplikasi masa nifas berkisar 1.276

(21,49% ) orang.

Data di RSUD Kabupaten Muna di ruangan Delima pada tahun 2011 dari

bulan Januari sampai Desember yang terdiagnosa mengalami anemia berjumlah 31

orang dan yang anemia pada masa nifas sekitar 19 ( 61,29% ) orang , pada tahun

2012 dari bulan Januari sampai Desember yang mengalami anemia berjumlah 66

orang dan yang anemia pada masa nifas sebeanyak 31 (41,96% ) orang, tahun

2013dari bulan Januari sampai Desember yang mengalami anemia berjumlah 61

orang dengan yang anemia pada masa nifas berjumlah 37 ( 60,65% ) orang dan pada

tahun 2014 dari bulan Januari sampai April yang mengalami anemia berjumlah 42

orang dengan yang anemia pada masa nifas sebanyak 20 (47,61% ) orang.

Berdasarkan data yang ada, maka penulis terdorong untuk mengambil studi

kasus dengan judul Manajemen dan Pendokumentasian Asuhan Kebidanan

Postpartum Patologi Pada Ny. F PIA0Postpartum Hari Ke-3dengan Anemia berat

diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014.
4

B. Ruang Lingkup Pembahasan

Ruang lingkup pembahasan karya tulis ilmiah ini adalahManajemen dan

Pendokumentasian Asuhan Kebidanan Ibu Nifas Pada Ny. Fdengan Anemia Berat

diRumah Sakit Umum DaerahKabupaten Muna Tanggal 4 s.d. 7 Mei 2014.

C. Tujuan Telaah

1. Tujuan Umum

Terlaksananya Asuhan Kebidanan Ibu Nifas padaNy. F dengan Anemia Berat

diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014

dengan menggunakan pendekatan manajemen kebidanan 7 langkah Varney dan

pendokumentasian.

2. Tujuan Khusus

a. Terlaksananya identifikasi data secara lengkap dengan mengumpulkan semua

data yang meliputi data subyektif dan obyektif terhadap Ny. Fdengan Anemia

Berat diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei

2014.

b. Terlaksananya interpretasi data yang meliputi diagnosa kebidanan, masalah

aktual, dan kemungkinan yang dapat terjaditerhadap Ny. F dengan Anemia

Berat diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei

2014.

c. Terumuskannya diagnosa/masalah potensial yang dapat terjadi terhadap Ny.

Fdengan Anemia Berat di Rumah Sakit Umum Daerah Kabupaten Muna

Tanggal 4 s.d. 7 Mei 2014.


5

d. Terlaksananya identifikasi dan menetapkan kebutuhan yang memerlukan

penanganan segera terhadap Ibu Nifas padaNy. F dengan Anemia Berat

diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014.

e. Tertetapkannya rencana asuhan yang menyeluruh sesuai dengan pengkajian

terhadap Ibu Nifas pada Ny. F dengan Anemia Berat diRumah Sakit Umum

Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014.

f. Terlaksananya asuhan kebidanan yang telah direncanakan secara efektif dan

efisien terhadap Ibu Nifas padaNy. F dengan Anemia Berat diRumah Sakit

Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei 2014.

g. Terlaksananya evaluasi hasil tindakan asuhan kebidanan terhadap Ibu Nifas

padaNy. F dengan Anemia Berat diRumah Sakit Umum Daerah Kabupaten

Muna Tanggal 4 s.d. 7 Mei 2014.

h. Terdokumentasikan hasil asuhan kebidanan terhadap Ibu NIfas padaNy. F

dengan Anemia Berat diRumah Sakit Umum Daerah Kabupaten Muna Tanggal

4 s.d. 7 Mei 2014.

D. Manfaat Telaah

1. Manfaat Ilmiah

Hasil penelitian ini diharapkan menjadi salah satu sumber informasi dalam

memperkaya wawasan ilmu pengetahuan dan bahan kepustakaan sekaligus dapat

dijadikan acuan.

2. Bagi Penulis
Meningkatkan pengetahuan dan mendapatkan pengalaman nyata dalam asuhan

kebidanan pada ibu nifas dengan anemia berat.


6

3. Bagi Profesi

Untuk menambah informasi bagi bidan dan tenaga kesehatan lainnya dalam

memberikan asuhan kepada nifas dengan anemia berat sesuai dengan manajemen

atau prosedur yang sudah ada.

4. Bagi Institusi

a. RSUD Kabupaten Muna

Untuk menambahkan informasi dan referensi bidan dalam memberikan asuhan

kebidanan pada ibu nifas khususnya dengan anemia berat dan memberikan KIE

untuk pencegahan terjadinya anemia.

b. Pendidikan

Digunakan sebagai standar bacaan atau referensi dalam asuhan peningkatan

kualitas pendidikan khususnya asuhan kebidanan pada ibu nifas dengan anemia

berat.

E. Metode Telaah

Dalam penyusunan studi kasus ini, berdasarkan teori ilmiah yang dipadukan

dengan praktek dan pengalaman, penulis memerlukan data yang objektif dan relevan

dengan teori-teori yang dijadikan dasar analisa dalam pemecahan masalah. Untuk itu

penulis menggunakan metode sebagai berikut:

1. Studi Kepustakaan

Bahan pustaka merupakan hal yang sangat penting dalam menunjang teoritis

penelitian, di dalamnya tersimpan bahan bacaan dan informasi yang dapat

mengarahkan kita dalam menciptakan pemahaman yang tepat tentang kasus yang

dibahas.
7

2. Studi Kasus

Dengan menggunakan pendekatan proses manajemen kebidanankomprehensif,

data yang dihimpun hingga evaluasi yang didapatkan denganmenggunakan

metode:

a. Wawancara

Penulis mengadakan tanya jawab dengan klien yang dapat memberikan

informasi yang dibutuhkan.

b. Observasi

Observasi meliputi status emosional, respon terhadap kondisi yang dialami dan

pola interaksi klien terhadap keluarga, petugas kesehatan, dan lingkungannya

serta pengetahuan tentang kesehatan.

c. Pemeriksaan Fisik

Pemerisaan fisik dilakukan secara sistematis yaitu inspeksi, palpasi, perkusi,

auskultasi.

d. Pemeriksaan penunjang

Dilakukan sesuai kebutuhan klien dengan menggunakan format pengkajian.

Pemeriksaan ini di lakukan untuk menunjang hasil pengkajian data dan hasil

pemeriksaan fisik, untuk membantu menegakan diagnosa.

3. Studi Dokumentasi

Studi ini dilakukan dengan mempelajari status kesehatan klien yangbersumber dari

catatan dokter, bidan maupun sumber lain yang menunjangyaitu hasil pemeriksaan

diagnostik.
8

4. Diskusi

Penulis mengadakan tanya jawab dengan tenaga kesehatan yaitu bidan

yangmenangani langsung klien tersebut serta berdiskusi dengan dosen

pembimbingStudi Kasus.

F. Sistematika Penulisan
Untuk memperoleh gambaran pengetahuan umum tentang Studi Kasus ini,

yang terdiri dari lima bab sebagai titik tolak pembahasan. Dalam karya tulis ini dapat

dilihat secara garis besar tentang sistematika penulisan sebagai berikut :

1. Bab I Pendahuluan

Pendahuluan berisi tentang latar belakang, ruang lingkup pembahasan, tujuan

telaah, manfaat telaah, metode telaah dan sistematika penulisan.

2. Bab II Tinjauan Pustaka

Tinjauan pustaka berisi tentang telaah pustaka dan konsep manajemen kebidanan,

untuk lebih jelasnya akan diuraikan sebagai berikut:

a. Telaah Pustaka yang berisi tentang masa nifas meliputi pengertian masa nifas,

tahapan masa nifas, fisiologi masa nifas, kebutuhan dasar masa nifas, laktasi,

deteksi dini pada masa nifas, kebijakan pemerintah pada masa nifas, peran dan

tanggung jawab bidan pada masa nifas. Anemia berisi tentang pengertian

anemia, klasifikasi anemia, tanda dan gejala anemia, penyebab anemia,

komplikasi anemia, penatalaksanaan anemia. Kemudian anemia postpartun

berisi tentang penyebab anemia postpartum, patofisiologi, dan pengobatan

anemia postpartum.
9

b. Konsep manajemen kebidanan meliputi pengertian dan prinsip-prinsip

manajemen.

c. Langkah-langkah manajemen kebidanan.

d. Dokumentasi asuhan kebidanan meliputi pengertian dan unsur-unsur

dokumentasi.

3. Bab III Studi Kasus

Studi kasus berisi tentang manajemen yang meliputi identifikasi data dasar,

identifikasi diagnosa/ masalah aktual, identifikasi diagnosa/ masalah potensial,

perlunya tindakan segera/ kolaborasi dan konsultasi, rencana asuhan, implementasi

dan evaluasi. Kemudian berisi tentang pendokumentasian dan catatan

perkembangan.

4. Bab IV Pembahasan

Pembahasan menjelaskan tentang hasil telaah yang dilakukan pada sasaran lalu

membandingkannya dengan teori yang ada. Penjelasan harus dibuat bukan hanya

jika hasil telaah tidak sesuai dengan teori, bahkan jika sesuaipun harus dibuat

penjelasannya termasuk hal-hal yang mendukung kondisi yang ada. Uraian

tersebut memuat penjelasan secara teoritik tentang mekanisme mengapa hasilnya

demikian. Penjelasan mengapa hasil telaah yang dilakukan seperti itu, dapat

dilakukan dengan fokus pada aspek teoritik dan aspek telaah.

5. Bab V Penutup

Bab ini berisi tentang kesimpulan dan saran.

6. Daftar Pustaka

Pada daftar pustaka terdiri dari 24 kepustakaan.


10

BAB II

TINJAUAN PUSTAKA

A. Telaah Pustaka

1. Masa Nifas

a. Pengertian Masa Nifas

1) Masa nifas adalah masa dimulai beberapa jam sesudah lahirnya plasenta

sampai 6 minggu setelah melahirkan. Masa nifas dimulai setelah kelahiran

plasenta dan berakhir ketika alat-alat kandungan kembali seperti keadaan

sebelum hamil yang berlangsung kira-kira 6 minggu. Masa nifas merupakan

masa selama persalinan dan segera setelah kelahiran yang meliputi minggu-

minggu berikutnya pada saluran reproduksi kembali ke keadaan tidak hamil

yang normal. Masa nifas adalah masa setelah seorang ibu melahirkan bayi

yang dipergunakan untuk memulihkan kesehatannya kembali yang

umumnya memerlukan waktu 6-12 minggu (Marmi, 2012).

2) Masa nifas atau puerperium dimulai dari 1 jam setelah lahirnya plasenta

sampai dengan 6 minggu (42 hari) setelah itu. Pelayanan paska persalinan

harus terselenggara pada masa itu untuk memenuhi kebutuhan ibu dan bayi,

yang meliputi upaya pencegahan, deteksi dini dan pengobatan komplikasi

dan penyakit yang mungkin terjadi, serta penyediaan pelayanan pemberian

ASI, cara menjarangkan kehamilan, imunisasi, dan nutrisi bagi ibu

(Sarwono, 2010).

10
11

3) Masa nifas adalah masa yang dimulai setelah plasenta lahir dengan lengkap

dan berakhir ketika alat-alat kandungan seperti keadaan sebelum hamil.

Masa nifas berlangsung selama kira-kira 6 minggu (Bahiyatun, 2009).

4) Masa nifas (puerperium) dimulai setelah plasenta lahir dan berakhir ketika

alat-alat kandungan kembali seperti keadaan sebelu hamil. Masa nifas

berlangsung selama kira-kira 6 minggu. Wanita yang melalui periode

puerperium disebut puerpura. Puerperium (nifas) berlangsung selama 6

minggu atau 42 hari, merupakan waktu yang diperlukan untuk pulihnya alat

kandungan pada keadaan yang normal (Wulandari, 2011).

5) Masa nifas (peurperium) adalah masa pulih kembali, mulai dari persalinan

selesai sampai alat-alat kandungan kembali seperti pra hamil (Rahmawati,

2011).

Dari teori-teori yang dikemukakan para ahli, penulis dapat

menyimpulkan masa nifas adalah masa pemulihan dimana berawal dari

keluarnya plasenta hingga kembalinya alat-alat reproduksi ke keadaan seperti

sebelum hamil.

b. Tahapan Masa Nifas

Masa nifas terbagi menjadi 3 tahapan yaitu:

1) Puerperium dini merupakan suatu masa kepulihan dimana ibu diperbolehkan

untuk berdiri dan berjalan-jalan.

2) Puerperium intermedial merupakan suatu masa kepulihan menyeluruh dari

organ-organ reproduksi selama kurang lebih 6-8 minggu.


12

3) Remote puerperium merupakan waktu yang diperlukan untuk pulih dan sehat

kembali dalam keadaan sempurna terutama apabila ibu selama hamil dan

waktu persalinan mengalami komplikasi (Wulandari, 2011).

c. Laktasi

Laktasi adalah keseluruhan proses menyusui mulai dari ASI diproduksi

sampai proses bayi mengisap dan menelan ASI. Laktasi merupakan bagian

integral dan siklus reproduksi mamalia termasuk manusia. Masa laktasi

memiliki tujuan meningkatkan pemberian ASI eksklusif dan meneruskan

pemberian ASI sampai anak umur 2 tahun secara baik dan benar serta anak

mendapatkan kekebalan tubuh secara alami (Wulandari, 2011).

Menyususi adalah salah satu komponen sari proses reproduksi yang

terdiri atas haid, kehamilan, persalinan, menyususi dan penyapihan. Jika semua

komponen berlangsung dengan baik, proses menyusui akan berhasil (Sarwono,

2009).

1) Pembentukan Air Susu

Pada seorang ibuyang menyususi dikenai 2 refleks yang masing-masing

berperan sebagai pembentukan dan pengeluaran air susu yaitu:

a) Refleks Prolaktin.

Pada akhir kehamilan hoemon prolaktin memegang peranan untuk

membuat kolostrum, namun jumlahnya terbatas karena aktivitas prolaktin

terhambat oleh estrogen dan progesteron. Setelah lahirnya plasenta dan

berkurangnya fungsi korpus luteum maka estrogen dan progesteron

berkurang ditambah degan adanya isapan bayi sehingga merangsang


13

ujung-ujung saraf sensoris yang berfungsi sebagai reseptor mekanik.

Akibat rangsangan ini, faktor-faktor yang memicu sekresi prolaktin akan

merangsang hipofisis anterior sehingga prolaktin keluar.Hormone ini

merangsang sel-sel alveoli yang berfungsi untuk membuat air susu.

b) Refleks Letdown.

Bersamaan dengan pembentukan prolaktin, rangsangan yang berasal dari

isapan bayi ada yang dilanjutkan ke hipofisis posterior yang kemudian

dikeluarkan oksitosin melaui aliran darah, hormon ini diangkat menuju

uterus yang menimbulkan kontraksi pada uterus sehingga terjadi involusi

dari organ tersebut. Kontraksi dari sel akan peperas air susu yang telah

terbuat keluar dari alveoli dan menuju ke sistem duktus dan selanjutnya

mengalir melalui duktus lactiferous masuk ke mulut bayi (Sukarni,2013).

2) Manfaat Pemberian ASI

a) Bagi bayi, ASI berfungsi sebagai:

(1) Dapat membantu memulai kehidupannya dengan baik, dimana bayi

yang mendapatkan ASI mempunyai kenaikan berat badan yang baik

stelah lahir

(2) Membendung antibody

(3) ASI mengandung komposisi yang tepat, yaitu terdiri dari proporsi

yang seimbang dan cukup kuantitas semua zat gizi yang diperlukan

untuk kehidupan 6 bulan pertama.


14

(4) Mengirang kejadian karies dentis, dimana insiden karies dentis pada

bayi yang mendapat susu formul jauh lebih tinggi dibanding yang

mendapatkan ASI.

(5) Memberi rasa aman dan nyaman pada bayi dan adanya ikatan antara

ibu dan bayi

(6) Terhindar dari alergi

(7) ASI meningkatkan kecerdasan pada bayi, lemak pada ASI adalah

lemak tak jenuh yang mengandung omega 3 untuk pematangan sel-

sel otak.

(8) Membantu perkembagan rahang dan merangsang pertumbuhan gigi

karena gerakan mengisap mulut nayi pada payudara (Wulandari,

2011).

b) Bagi Ibu

(1) Aspek kontrasepsi, hisapan bayi pada putting susu merangsang

pengeluaran hormon prolaktin yang dikeluarkan oleh post anterior

hipofise. Dimana prolaktin ini masuk ke indung telur dan menekan

produksi estrogen sehingga tidak ada ovulasi.

(2) Aspek kesehatan ibu, isapan bayi pada payudara merangsang

pembentukan oksitosin oleh kelenjar hipofisis. Oksitosin membantu

involusi uterus dan mencegah perdarahan.

(3) Aspek penurunan berat badan, ibu yang menyususi eksklusif lebih

mudah dan cepat kembali keberatbadan semula seperti sebelum

hamil.
15

c) Bagi Negara, ASI berguna sebagai aspek ekonomi, aspek psikologi, dan

aspek kemudahan

d) Bagi Negara, ASI berguna untuk menurunkan angka kesakitan dan

kematian, menghemat devisa Negara, mengurangi subsidi untuk rumah

sakit dan peningkatan kualitas generasi penerus (Wulandari,2011).

3) Komposisi Gizi dalam ASI

ASI adalah suatu emulsi lemak dalam larutan protein laktose dan

garam organik yang disekresi oleh kedua kelenjar payudara ibu, sebagai

makan utama bagi bayi. Komposisi ASI dibedakan menjadi 3 stadium yaitu:

a) Kolostrum

Kolostrum adalah air susu yang pertama keluar. Kolostrum disekresi oleh

kelenjar payudara pada hari pertama sampai hari ke 4 pasca

persalinan.kolostrum merupakan cairan dengan viskositas kental,lengket

dan berwarna kekuningan. Kolostrum banyak mengandung

protein,mineral, garam, vitamin A, nitrogen, sel darah putih dan anti bodi

yang tinggi dari pada ASI matur. Selain itu, kolostrum masih

mengandung rendah lemak dan laktosa. Protein utama pada kolostrum

adalah immunoglobulin (IgG, IgA, dan IgM), yang digunakan sebagai zat

anti bodi untuk mencegah dan menetralisir bakteri, virus, jamur dan

parasit (Marmi,2010).

b) ASI transisi atau peralihan

ASI peralihan adalah ASI yang keluar setelah kolostrum sampai sebelum

ASI matang, yaitu sejak hari ke 4 sampai hari ke 10 selama 2 minggu,


16

volume air susu bertambah banyak dan berubah warna serta

komposisinya. Kadar imunoglobulin dan protein menurun sedangkan

kadar lemak dan kolostrum meningkat (Marmi,2012).

c) ASI matur

ASI matur disekresi hari ke 10 dan seterusnya. ASI matur tampak

berwarna putih. Kandungan ASI matur relaiv konstan, tidak menggumpal

bisa dipisahkan. Di bawah ini bisa kita lihat perbedaan komposisi antara

kolostrum, ASI transisi dan ASI matur, yang disajikan pada tabel 1.

Tabel 1. PERBEDAAN KANDUNGAN KOLOSTRUM,


ASI TRANSISI, DAN ASI MATUR
Kandungan Kolostrum ASI Transisi ASI Matur
Energy (kg/kal) 57,0 63,0 65,0
Laktosa (gr/100 ml) 6,5 6,7 7,0
Lemak (gr/100 ml) 2,9 3,6 3,8
Protein (gr/100 ml) 1,195 0,965 1,324
Mineral (gr/100 ml) 0,3 0,3 0,2
Imunoglobulin:
Ig A (mg/100 ml) 335,9 - 119,6
Ig G (mg/100 ml) 5,9 - 2,9
Ig M (mg/100 ml) 17,1 - 2,9
Lisosin (mg/100 ml) 14,2-16,2 - 24,4-27,5
Laktoferin 420-420 - 250-270
Sumber: Marmi (2012).

Air susu yang mengalir pertama kali atau saat 5 menit pertama

disebut sebagai foremik. Foremik lebih encer, foremik mempunyai

kandungan randah lemak dn tinggi laktosa, gula, protein, mineral dan air.

Air susu berubah menjadi hindmilk kaya akan lemak dan nutrisi.

Hindmilk membuat bayi akan akan cepat kenyang, dengan demikian bayi

akan membutuhkan keduanya baik foremik maupun hindmilk

(Marmi,2012).
17

4) Cara Menyusui Yang Benar

a) Cara menyusui dengsn sikap duduk:

Duduk dengan posisi santai dan tegak menggunakan kursi pendek agar

kaki tidak tergantung dengan punggung bersandar di sandaran kursi

(1) Sebelum menyusui, ASI dikeluarkan sedikit dan dioleskan pada

putting, dengan manfaat sebagai desinfektan dan menjaga

kelembapan putting susu

(2) Gunakan bantal atauselimut untuk menopang bayi dengan posisi bayi

diatas pangkuan ibu.

(3) Tangan kanan menyangga payudara kiri dan keempat jari dan ibu jari

menekan payudara bagian atas areola

(4) Bayi diberi rangsangan untuk membuka mulut (rooting refleks)

dengan cara menyentuh pipi dengan putting susu atau menyentuh sisi

mulut bayi

(5) Stelah bayi membuka mulut, dengan cepat kepala bayi didekatkan ke

payudara ibu dengan putting serta areola dimasukkan ke mulut bayi.

b) Melepaskan isapan bayi

Setelah menyusui pada satu payudara sampai terasa kosong, sebaiknya

diganti menyusui pada payudara yang lain. Cara melepas isapan bayi: jari

kelingking ibu dimasukkan ke mulut bayi melalui sudut mulut atau dagu

bayi ditekan ke bawah

c) Menyusui berikutnya dimulai pada payudara yang belum terkosongkan

(yang dihisap terakhir).


18

d) Setelah seleai menyusui, ASI dikelurkan sedikit kemudian dioleskan pada

putting susu dan areola sekitarnya. Biarkan kering dengan sendirinya.

e) Menyendawakan bayi

(1)Tujuan menyendawakan bayi adalah mengelurkan udara dari

lambung supaya bayi tidak muntah setelah menyusu. Cara

menyendawakan bayi:

(2) Bayi digendong tegak dengan bersandar pada bahu ibu kemudian

punggungnya ditepuk perlahan-lahan.

(3) Dengan cara menelungkupkan bayi di atas pangkuan ibu lalu usap-

usap punggung bayi sampai bayi bersendawa (Wulandari,2011).

d. KebijakanPemerintah tentang Masa Nifas

Kebijakan program nasional yang telah dibuat oleh pemerintah

mengenai masanifas merekomendasikan paling sedikit empat kali melakukan

kunjungan pada masa nifas, dengan tujuan untuk:

1) Menilai kondisi kesehatan ibu dan bayi.

2) Melakukan pencegahan terhadap kemungkinan-kemungkinan adanya

gangguan kesehatan ibu nifas dan bayinya.

3) Mendeteksi adanya komplikasi atau maasalah yang timbul dan mengganggu

kesehatan ibu nifas maupun bayinya.

4) Menangani komplikasi atau masalah yang timbul dan mengganggu

kesehatan ibu nifas maupun bayinya (Marmi, 2012).


19

Berikut ini merupakan aturan waktu dan bentuk asuhan yang wajib

diberiakan sewaktu melakukan kunjungan masa nifas yang disajikan pada tabel

2.

Tabel 2. KUNJUNGAN MASA NIFAS


Kunjungan Waktu Asuhan
I 6-8 jam Mencegah perdarahan masa nifas oleh karena
post atonia uteri.
partum Mendeteksi dan perawatan penyebab lain
perdarahan serta melaukan rujukan jika
perdarahan berlanjut.
Pemberian ASI awal.
Mengajarkan cara mempererat hubungan
antara ibu dan bayi baru lahir.
Menjaga bayi tetap sehat melalui pencegahan
hipotermi.
Setelah bidan melakukan pertolongan
persalinan,maka bidan harus menjaga ibu
dan bayi untuk 2 jam pertama.
Setelah kelahiran atau sampai keadaan ibu
dan bayi baru lahir dalam keadaan baik.
II 6 hari Memastikan involusi uterus berjalan dengan
post normal, uterus berkontraksi dengan baik,
partum tinggi fundus uteri dibawah umbilikus, tidak
perdarahan abnormal.

III 2 Asuhan pada 2 minggu postpartum sama


minggu dengan asuhan yang diberikan pada
post kunjungan 6 hari postpartum.
Partum
IV 6 Menanyakan penyulit-penyulit yang dialami
minggu ibu selama masa nifas.
post Memberikan konseling KB secara dini.
partum
Sumber:( Yanti, 2011 ).

Selama masa nifas, paling sedikit 4 kali kunjungan masa nifas dilakukan

untuk menilai status ibu dan bayi baru lahir. Kunjungan tersebut untuk
20

mencegah, mendeteksi dan menangani masalah-masalah yang terjadi. Empat

kali kunjungan tersebut setidaknya pada saat:

1) 6-8 jam setelah persalinan (kunjungan I).

2) 6 hari setelah persalinan (kunjungan II).

3) 2 minggu setelah persalinan (kunjungan III).

4) 6 minggu setelah persalinan (kunjungan IV).

Tujuan dari masing-masing kunjungan tersebut berbeda-beda. Dibawah

ini uraikan mengenai tujuan dari tiap kunjungan tersebut.

1) Tujuan kunjungan 6-8 jam setelah persalinan adalah sebagai berikut:

a) Mencegah perdarahan masa nifas yang disebabkan oleh atonia uteri.

b) Mendeteksi dan merawat penyebab lain perdarahan serta harus segera

merujuk jika perdarahan berlanjut.

c) Memberikan konseling pada ibu atau salah satu anggota keluarga tentang

bagaimana mencegah perdarahan pada masa nifas karena atonia uteri.

d) Pemberian ASI awal.

e) Melakukan hubungan antara ibu dan bayi baru lahir.

f) Menjaga bayi tetap sehat dengan cara mencegah hipotermi.

2) Tujuan kunjungan 6 hari setelah persalinan adalah sebagai berikut:

a) Memastikan bahwa involusi uterus berjalan dengan normal (uterus

berkontraksi, fundus dibawah umbilikus, tidak ada perdarahan abnormal

dan tidak berbau).

b) Menilai adanya tanda-tanda demam, infeksi, atau perdarahan abnormal.


21

c) Memastikan bahwa ibu mendapatkan cukup makanan, cairan, dan

istirahat.

d) Memastikan bahwa ibu menyusui dengan baik dan tidak memperlihatkan

adanya tanda-tanda penyulit.

e) Memberikan konseling pada ibu mengenai asuhan pada bayi, tali pusat,

menjaga bayi tetap hangat dan merawat bayi sehari-hari.

3) Tujuan kunjungan 2 minggu setelah persalinan sama dengan tujuan dari

kunjungan 6 hari setelah persalinan di atas.

4) Tujuan kunjungan 6 minggu setelah persalinan adalah sebagai berikut:

a) Menanyakan kepada ibu tentang penyulit-penyulit yang dialami pada ibu

dan bayi.

b) Memberikan konseling untuk KB secara dini (Yanti, 2011).

e. Peran dan Tanggung Jawab Bidan dalam Masa Nifas

Bidan memiliki peranan yang sangat penting dalam pemberian asuhan

postpartum. Asuhan kebidanan pada masa nifas merupakan hal yang sangat

penting, karena periode ini merupakan masa kritis bagi ibu maupun bayinya.

Adapun peran dan tanggung jawab bidan dalam masa nifas antara lain:

1) Memberikan dukungan secara berkesinambungan selama masa nifas sesuai

dengan kebutuhan ibu untuk mengurangi ketegangan fisik dan psikologis

selama masa nifas.

2) Sebagai promotor hubungan antara ibu dan bayi serta keluarga.

3) Mendorong ibu untuk menyusui bayinya dengan meningkatkan rasa nyaman.


22

4) Membuat kebijakan, perencana program kesehatan yang berkaitan ibu dan

anak, dan mampu melakukan kegiatan administrasi.

5) Mendetaksi adanya komplikasi dan perlunya rujukan.

6) Memberikan konseling untuk ibu dan keluarganya mengenai cara mencegah

perdarahan, mengenali tanda-tanda bahaya, menjaga gizi yang baik, serta

mempraktekkan kebersihan yang aman.

7) Melakukan manajemen asuhan dengan cara mengumpulkan data,

mengidentifikasi, menetapkan diagnosa dan rencana tindakan serta

melaksanakannya untuk mempercepat proses pemulihan, mencegah

komplikasi dengan memenuhi kebutuhan ibu dan bayi selama periode nifas.

8) Memberikan asuhan secara professional. (Marmi, 2012).

2. Anemia

a. Pengertian Anemia

Menurut WHO (2013) Anemia adalah suatu kondisi dimana terdapat

kekurangan sel darah merah atau hemoglobin.Anemia secara praktis

didefinisikan senagai kadar Ht, kensentrasi Hb, atau hitung eritrosit dibawah

batas normal(Sarwono, 2009).

Anemia adalah suatu kondisi medis dimana jumlah sel darah merah atau

hemoglobin kurang dari normal. Anemia merupakan salah satu kelainan darah

yang umumnya terjadi ketika kadar sel darah merah (eritrosit) dalam tubuh

menjadi terlalu rendah. Hal ini dapat menyebabkan masalah kesehatan karena

sel darah merah mengandung hemoglobin, yang membawa oksigen keseluruh

jaringan tubuh (Atikah, 2011).


23

Anemia adalah penurunan kuantitas sel-sel darah merah dalam sirkulasi,

abnormalitas kandungan hemoglobin sel darah merah, atau keduanya. Anemia

dapat disebabkan oleh gangguan pembentukan sel darah merah atau

peningkatan kehilangan sel darah merah melalui perdarahan kronis, perdarahan

mendadak, atau lisis (destruksi)sel darah merah yang berlebihan

(Elizabeth,2008).

Anemia adalah suatu keadaan adanya penurunan kadar hemoglobin,

hematokrit dan jumlah eritrosit dibawah nilai normal. Pada penderita anemia,

lebih sering disebut sebagai kurang darah, kadar sel darah merah

(Hemoglobin/Hb) dibawah nilai normal. Penyebabnya bisa karena kuranggnya

zat besi, asam folat, vitamin B12, tetapi yang sering terjadi adalah anemia

karena kekurangan zat besi (Rukiah,2011).

Anemia merupakan suatu keadaan adanya penurunan kadar hemoglobin,

hematokrit dan jumlah eritrosit dibawah nilai normal. Pada penderita anemia

lebih sering disebut kurang darah, kadar sel darah merah (Hemoglobin/Hb)

dibawah nilai normal. Anemia defisiensi besi adalah anemia yang disebabkan

oleh kurangnya zat besi dalam tubuh. Banyak faktor yang dapat menyebabkan

timbulnya anemia defisiensi besi, antara lain kurangnya asupan zat besi dan

protein dari makanan, adanya gangguan absorpsi usus, perdarahan akut maupun

kronis dan meningkatnya kebutuhan zat besi seperti pada wanita hamil, masa

pertumbuhan dan masa penyembuhan dari penyakit. Kebanyakan anemia dalam

kehamilan disebabkan oleh defisiensi besi dan perdarahan akut bahkan tidak

jarang keduannya saling berinteraksi (Rukiyah, 2010).


24

Dari teoriteori yang dikemukakan oleh para ahli, penulis dapat

menyimpulkan bahwa anemia adalah suatu keadaan atau kondisi dimana dalam

darah terjadi penurunan kadar hemoglobin atau sel darah merah di bawah nilai

normal.

b. Klasifikasi Anemia.

Secara umum, ada 3 jenis utama anemia, diklasifikasikan menurut

ukuran sel darah merah:

1) Jika sel darah merah lebih kecil dari biasanya, ini disebut anemia mikrositik.

Penyebab utama dari jenis ini defisiensi besi (besi tingkat rendah) anemia

dan thalassemia (kelainan bawaan hemoglobin).

2) Jika ukuran sel darah merah normal dalam ukuran (tetapi rendah dalam

jumlah), ini disebut anemia normositik, seperti anemia yang menyertai

penyakit kronis atau anemia yang berhubungan dengan penyakit ginjal

3) Jika sel darah merah lebih besar dari normal, maka disebut anemia

makrositik. Penyebab utama dari jenis ini adalah anemia pernisiosa dan

anemia yang berhubungan dengan alkoholisme, yang disajikan pada tabel 3.


25

Tabel 3. GAMBARAN ANEMIA SECARA UMUM


Temuan
Jenis Anemia Umum Penyebab
Laboratorium
Normositik Perdarahan akut Penurunan HCT
Anemia sel sabit Penurunan
Malaria Hemoglobin
Anemia aplastik MCV tidak
Talasemia berubah
Anemia akibat penyakit MCHC tidak
kronis berubah
Zat besi normal
Feritin Normal
Mikrositik Defisiensi besi Penurunan HCT
Perdarahan kronis lambat Penurunan
Anemia dalam kehamilan hemoglobin
Penurunan
statuszat besi
Penurunan feritin
Penurunan MCV
MCHC tuun atau
tidak berubah

Anemia megaloblastik Defisiensi asam folat Penurunan HCT


Defisiensi vitamin B Penurunan
Hemoglobin
Peningkatan
MCV
MCHC normal
Sumber: (Elizabeth,2008).

Disebut anemia bila kadar Hb kurang dari 10 gr/dl, disebut anemia

sedang jika Hb 7-8 gr/dl, disebut anemia berat atau bila kurang dari 6 gr/dl

disebut anemia gravis. Wanita tidak hamil mempunyai nilai normal 12-15 gr/dl

dan hematokrit 35-54 %. Sebaiknya pemeriksaan dilakukan setiap 3 bulan atau

2 kali pada trimester 1 dan 1 kali pada trimester terakhir( Ashari, 2010).
26

c. Tanda dan Gejala Anemia

Manifestasi klinis dari anemia defisiensi besi sangat bervariasi, bisa

hampir tanpa gejala, bisa juga gejala-gejala penyakit pada dasarnya yang

menonjol, ataupun bisa ditemukan gejala anemia bersama-sama dengan gejala

penyakit dasarnya.

Gejala-gejala dapat berupa kepala pusing, palpitasi, berkunang-kunang,

perubahan jaringan epitel kuku, gangguan system neurumuskular, lesu, lemah,

lelah, disphagia dan pembesaran kelenjar limpa. Bila kadar Hb < 7 gr/dl maka

gejala-gejala dan tanda-tanda anemia akan jelas (Rukiyah, 2010).

Menurut Atika (2011), anemia terdiri atas 2 jenis yaitu anemia ringan

dan anemia berat. Adapun tanda dan gejlanya sebagai berikut:

1) Anemia Ringan

Gejala anemia ringan yaitu kelelahan, penurunan energy, kelemahan, sesak

napas, palpitasi(rasa jantung balab atau pemukulan tidak teratur) dan tampak

pucat

2) Anemia Berat

Beberapa tanda-tanda yang mungkin menunjukkan anemia berat pada

seseorang dapat mencakup Denyut jantung cepat; Tekanan darah rendah;

Frekuensi pernapasan cepat; Pucat dan kulit dingin; kulit kuning disebut

jaudince jika anemia karena kerusakan sel darah merah; murmur jantung;

penyebab limpa dengan penyebab anemia tertentu; nyeri dada; pusing atau

kepala terasa ringan(terutama berdiri atau); kelelahanatau kekurangan


27

energi; sakit kepala; tidak bisa berkonsentrasi; sesak napas; nyeri dada serta

pingsan (Proverawati,2011).

Beberapa pasien dengan anemia tidak menunjukkan gejala. Sedangkan

anemia pada orang lain mungkin merasa: capek, mudah kelelahan, tampak

pucat, terjadi palpitasi/berdebar (rasa balab jantung) dan menjadi sesak napas.

Perlu dicatat bahwa jika anemia sudah berjalan lama (anemia kronis), tubuh

dapat menyesuaikan diri dengan kadar oksigen rendah dan mungkin individu

tidak merasa berbeda kecuali anemia menjadi berat (Atika, 2011).

Tabel 4. TANDA DAN GEJALA ANEMIA


Ringan Sedang Berat
Tingkat Hb
10 12 g/dl 8 10 g/dl < 8 g/dl
Gejala :
1. Kelelahan 1. Fatig 1. Overwhelming
2. Penurunan jantung 2. Sulit konsentrasi 2. Fatig
meningkat 3. Detak jantung > 3. Dizziness (pusing)
3. Detak jantung 100 kali/menit 4. Jantung berdebar
meningkat 4. Berdebar 5. Vertigo
4. Ekstraksi O2 jaringan 5. Dispnoe pada 6. Depresi, gangguan
meningkat aktivitas tidur
5. Dilatasi system 6. Pucat 7. Dispnoe pada
vascular perifer istirahat

d. Penyebab Anemia.

Anemia dapat disebabkan oleh banyak hal, tetapi tiga mekanisme utama tubuh

yang menyebabkanya adalah:

1) Penghancuran Sel Darah Merah Yang Berlebihan

Sel darah yang usianya muda biasanya gampang pecah/lisis sehingga

terjadi anemia. Penghancuran darah yang berlebihan dapat disebabkan oleh:

masalah dengan sum-sum tulang (limfoma, leukemia, atau muktiple


28

myeloma), masalah dengan sistem kekebalan tubuh yang menyebabkan

kerusakan sel-sel darah (anemia hemolitik), kemoterapi dan penyakit krois

(AIDS).

Jenis-jenis anemia yang disebabkan oleh penghancuran sel darah

merah: anemia hemolitik, anemia sel sabit, thalasemia, glukosa-6-

folatdehidrogenase (G6PD), dan spherocytosis herediter.

2) Kehilangan Darah

Kehilangan darah disebabkan oleh perdarahan (menstruasi dan

persalinan), penyakit (malaria), penyakit kronis (kangker), colitis ulserativa

atau rheumatoid arthritis dan kehilangan darah (misalnya dari menstruasi

berat atau borok lambung)

3) Penurunan Produksi Sel Darah Merah

Penurunan produksi sel daah merah dapat terjadi akibat: obat-

obatan/racun, diet yang rendah, vegetarian ketat, gagal ginjal, genetik

beberapa bentuk anemia seperti talasemia, kehamilan sarta operasi untuk

lambung atau usus mengurangi penyerapan zat besi, vitamin B12, atau asam

folat.

e. Komplikasi Anemia

Hemoglobin memiliki peran penting dalam mengantar oksigen

keseluruh bagian tubuh untuk konsumsi dan membawa kembali karbon

dioksida kembali ke paru-paru menghembuskan nafas keluar dari tubuh. Jika

kadar hemoglobin terlalu rendah, proses ini dapat terganggu, sehingga tubuh

memiliki tingkat oksigen yang rendah (Hipoksia).


29

Masih banyak lagi komplikasi yang dapat terjadi, akan tetapi semua itu

berdasarkan tingkat atau jenis anemia yang dialami. Seperti anemia defisiensi

vitamin B12, dapat mempengaruhi sel-sel yang membentuk permukaan luar

tubuh dan sel epitel. Oleh karena itu, kurangnya B12 dapat menyebabkan

abnormal papsmear palsu. Kemudian anemia defisiensi asam folat, koplikasi

yang mungkin terjadi: rambut yang mulai memuti, peningkatan warna kulit

(pigmen), infertilitas, memburuknya penyakit jantung.Pada anemia defisiensi

besi, biasanya tidak ada komplikasi. Namun. Anemia defisiensi besi mungkin

dapat kembali terjadi (Atikah, 2011).

f. Penatalaksanaan Anemia

Penatalaksanaan anemia memiliki berbagai macam cara, namun pada

dasarnya terlebihdahulu mengetahu penyebab dari anemia yang dialami klien.

Pengobatan yang dilakukan harus ditujukan pada penyebab anemia, dan

mungkin termasuk:

1) Tranfusi darah

2) Kortikosteroit atau obat-obatan lainnya yang menekan system kekebalan

tubuh

3) Erytropoetin, obat yang membantu sumsum tulang belakang membuat sel

darah merah

4) Suplemen zat besi, vitamin B12, asam folat, atau vitamin dan mineral

lainnya.

Berikut pengobatan anemia berdasarkan jenis anemia yang dialami

klien:
30

1) Pengobatan untuk anemia kekurangan vitamin B12 diperintahkan untuk

mengkonsumsi suplemen vitamin dan mengikuti diet lebih seimbang.

2) Pengobatan yang dapat diberikan pada anemia defisiensi asam folat yaitu

suplemen asam folat per oral atau intravena. Dan diet juga yang terdiri dari

peningkatan asupan sayuran hijau dan buah jeruk.

3) Pengobatan untuk anemia defisiensi zat besi, terlebih dahulu megetahui

penyebab kekurangan zat besi harus ditemukan dan dibeikan suplemen zat

besi (ferro Sulfat) (Atikah, 2011).

Pencegahan anemia defisiensi besi dapat dilakukan dengan suplemen

besi dan asam folat. WHO menganjurkan untuk memberikan 60 mg besi selama

6 bulan untuk memenuhi kebutuhan fisiologi selama kehamilan. Namun,

banyak literatur menganjurkan dosis 100 mg besi setiap hari selama 16 minggu

atau lebih pada kehamilan. Di wilayah-wilayah dengan prevalensi anemia yang

tinggi, dianjurkan untuk memberikan suplementasi sampai tiga bulan

postpartum (Sarwono, 2010).

Transfusi untuk anemia dilakukan pada pasien dengan kondisi berikut:

Kadar Hb <7 g/dl atau kadar hematokrit <20 %, Kadar Hb >7 g/dl dengan

gejala klinis: pusing, pandangan berkunang-kunang, atau takikardia (frekuensi

nadi >100x per menit) (WHO, 2013).

3. Anemia Postpartum

Anemiaa postpartum adalah suatu keadaan dimana seseorang ibu

sehabis melahirkan sampai dengan kira-kira 5 minggu dalam kondisi pucat,

lemah dan kurang bertenaga. Anemia terjadi jika kadar hemoglobin dalam
31

darah rendah. Hemoglobin adalah zat pembawa oksigen dalam sel darah merah.

Jika terjadi gangguan sistem transportasi oksigen (misalnya anemia) akan

menyebabkan tubuh sulit untuk bekerja (Silviana, 2012)

Anemia postpartum didefinisikan sebagai kadar hemoglobin kurang dari

10g. Ini merupakan masalah yang umum dalam bidang kebidanan. Meskipun

wanita hamil dengan kadar besi yang terjamin, konsentrasi hemoglobin

biasanya berkisar 11-12 g/dl sebelum melahirkan. Hal ini diperburuk dengan

kehilangan darah saat melahirkan dan pada masa nifas (Dewi, 2012).

1) Penyebab anemia postpartum

Penyebab paling sering dari anemia postpartum adalah disebabkan

oleh intake zat besiyang tidak cukup serta kehilangan darah selama

kehamilan dan persalinan. Anemia postpartum berhubungan dengan lamanya

perawatan di rumah sakit, depresi, kecemasan, dan pertumbuhan janin

terhambat.

Kehilangan darah adalah penyebab lain dari anemia. Kehilangan

darah yang signifikan setelah melahirkan dapat meningkatkan risiko

terjadinya anemiapostpartum. Banyaknya cadangan hemoglobindan besi

selama persalinan dapat menurunkan risiko terjadinya anemiaberat dan

mempercepat pemulihan (Silviana, 2012).

2) Patofisiologi

a) Perdarahan, sehingga kekurangan banyak unsur zat besi.

b) Kebutuhan zat besi meningkat, dengan adanya perdarahan,

gemeli,multiparitas, makin tuanya kehamilan.


32

c) Absorbsi tidak normal / saluran cerna terganggu, misal defisiensi vitamin

Csehingga absorbsi Fe terganggu.

d) Intak kurang misalnya kualitas menu jelek atau muntah terus (Silviana,

2012).

3) Pengobatan anemia postpartum

a) Pada anemi ringan, bisa diberikan sulfas ferosis 3 x 100 mg/hari

dikombinasi dengan asam folat / B12 : 15 30 mg/hari.

b) Pemberian vitamin C untuk membantu penyerapan.

c) Bila anemi berat dengan Hb kurang dari 6 gr % perlu tranfusi disamping

obat-obatan diatas dan bila tidak ada perbaikan cari penyebabnya.

Pengobatan terhadap anemiapostpartum tergantung dari derajat

anemia dan faktor risiko maternal. Wanita muda yang sehat dapat

mengkompensasi kehilangan darah yang banyak lebih baik dibandingkan

wanita nifas dengan gangguan jantung meskipun dengan kehilangan darah

yang tidak terlalu banyak (Dewi, 2012).

Pengobatan terhadap anemia meliputi pemberian zat besi secara oral

atau parenteral (suntik), transfusi darah, dan suntikan obat (eritropoietin)

yang membantu tubuh anda menciptakan lebih banyak sel darah merah.

Suplemen besi merupakan pilihan tepat bagi wanita hamil yang

membutuhkan besi lebih banyak (Dewi, 2012).


33

B. Konsep Manajemen Kebidanan

1.Pengertian

Manajemen kebidanan merupakan metode atau bentuk pendekatan yang

digunakan bidan dalam memberikan asuhan kebidanan sehingga langkah-langkah

dalam manajemen kebidanan merupakan alur piker bidan dalam pemecahan

masalah atau pengambilan keputusan klinis (Astuti, 2012).

Manajemen kebidanan adalah proses pemecahan masalah yang digunakan

sebagai metode untuk mengorganisasikan pikiran dan tindakan berdasarkan teori

ilmiah, temuan, keterampilan dalam rangkaian tahapan logis untuk pengabilan

keputusan yang berfokus pada klien (Simatupang, E. J. 2008).

Varney menjelaskan bahwa proses manajemen merupakan proses

pemecahan masalah yang ditemukan oleh perawat dan bidan pada awal tahun

1970an. Proses ini memperkenalkan sebuah metode dengan pengorganisasian,

pemikiran, dan tindakan-tindakan dengan urutan yang logis dan menguntungkan

bagi klien maupun tenaga kesehatan. Proses ini mengraikan bagaimana perilaku

yang diharapkan dari pemberian asuhan. Proses manajemen ini bukan hanya terdiri

2. Pedoman Penerapan Asuhan Kebidanan pada Masa Nifas

a. Tujuan Asuhan Masa Nifas.

Tujuan dari pemberian asuhan pada masa nifas untuk:

1) Menjaga kesehatan ibu dan bayinya, baik fisik maupun psikologis.

2) Melaksanakan skrining secara komprehensif, deteksi dini, mengobati atau

merujuk bila terjadi komplikasi pada ibu maupun bayinya.


34

3) Memberikan pendidikan kesehatan, tentang perawatan kesehatan diri,

nutrisi, keluarga berencana, cara dan manfaat menyusui, pemberian

imunisasi serta perawatan bayi sehari-hari.

4) Memberikan pelayanan keluarga berencana.

5) Mendapatkan kesehatan emosi (Yanti, 2011).

b. Perubahan yang Terjadi pada Masa Nifas

Perubahan-perubahan yang dapat terjadi pada masa nifas meliputi:

1) Suhu Badan

Suhu badan wanita inpartu tidak lebih dari 37,2 oC sesudah partus dapat naik

0,5 oC dari keadan normal, tetapi tidak melebihi 38,0 oC sesudah 12 jam

pertama melahirkan umumnya suhu badan akan kembali normal. Bila suhu

badan lebih dari 38,0 oC mungkin ada infeksi (Marmi, 2011).

2) Nadi

Pada umumnya nadi berkisar antara 60-80 denyutan/menit. Segera setelah

partus dapat terjadi bradikardi. Bila terdapat takikardi sedangkan badan tidak

panas mungkin ada perdarahan berlebihan atau ada vitium kordis pada

penderita. Pada masa nifas umumnya denyut nadi labil dibanding dengan

suhu badan (Marmi, 2011).

3) Tekanan Darah

Tekanan darah pada masa nifas biasanya tidak mengalami perubahan,

kemungkinan tekanan darah akan rendah setelah ibu melahirkan karena

disebabkan adanya perdarahan. Tekana darah tinggi pada masa nifas dapat

menandakan terjadinya preeklamsia postpartum (Wulandari, 2011).


35

4) Pernapasan

Keadaan pernapasan selalu berhubungan dengan keadaan suhu dan denyut

nadi. Apabila suhu dan denyut nadi tidak normal maka pernapasan juga akan

mengikutinya kecuali ada gangguan khusus pada saluran pernapasan.

5) Hemokonsentrasi

Pada masa hamil didapat hubungan pendek yang dikenal sebagai shunt

antara sirkulasi ibu dan plasenta. Setelah melahirkan shunt akan hilang

dengan sendirinya dan tiba-tiba. Volume darah pada ibu relative akan

bertambah keadaan ini menimbulkan pada jantung, sehingga dapat

menimbulkan dekompensasi kordis pada penderita vitium kordis (Marmi,

2011).

6) Perkemihan

Diuresis dapat terjadi setelah 2-3 hari masa nifas. Hal ini merupakan salah

satu pengaruh selama kehamilan dimana saluran urinaria mengalami dilatasi.

Kondisi ini akan kembali normal setelah 4 minggu masa nifas. Pada awal

masa nifas kandung kemih mengalami oedema, kongesti, dan hipotonik. Hal

ini disebabkan karena adanya overdistensi pada saat kala II persalinan dan

pengeluaran urin yang tertahan selama proses persalinan. Sumbatan pada

uretra disebabkan karena adanya trauma saat persalinan berlangsung dan

trauma ini dapat berkurang setelah 24 jam masa nifas.

7) Involusi Uterus

Involusi uteri atau pengerutan uterus merupakan suatu proses

dimana uterus kembali ke kondisi sebelum hamil dengan bobot hanya 60


36

gram. Involusi uteri dapat juga dikatakan sebagai proses kembalinya uteri

pada keadaan semula atau keadaan sebelum hamil (Marmi, 2012).

Involusi uterus melibatkan reorganisasi dan penanggalan decidua

atau endometrium dan pengelupasan lapisan pada tempat implantasi plasenta

sebagai tanda penurunan ukuran dan berat serta perubahan tempat uterus,

warna dan jumlah lochea. Ukuran uterus akan mengecil seperti sebelum

hamil. Untuk lebih lengkapnya, akan diuraikan dalam tabel 5.

Tabel 5. TINGGI FUNDUS UTERI


Involusi uteri Tinggi Fundus Uteri Berat Diameter
Uterus Uterus
Plasenta Setinggi pusat 1000 gram 12,5 cm
lahir
7 hari Pertengahan pusat simfisis 750 gram 7,5 cm
(1 minggu)
14 hari Tidak teraba di atas 500 gram 5 cm
(2 minggu) simpisis
6 minggu Normal 350 gram 2,5 cm
Sumber: (Marmi, 2012).

8) Lochea

Lochea adalah ekskresi cairan rahim selama masa nifas dan

mempunyai reaksi basah atau alkalis yang dapat membuat organisme

berkembang lebih cepat dari pada kondisi asam yang ada pada vagina

normal. Lochea mempunyai bau yang amis meskipun tidak terlalu

menyengat dan volumenya berbeda-beda pada setiap wanita. Pengeluaran

lochea dapat dibagi berdasarkan waktu dan warnanya, disajikan pada tabel 6.
37

Tabel 6. WAKTU DAN WARNA LOCHEA


Lochea Waktu Warna Ciri-ciri
Rubra 1-3 hari Merah Terdiri dari sel
kehitaman desidua, verniks
caseosa, rambut
lanugo, sisa
mekonium dan sisa
darah.
Sanguinolenta 3-7 hari Putih Sisa darah bercampur
bercampur lendir.
merah
Serosa 7-14 hari Kekuningan Lebih sedikit darah
atau dan lebih banyak
kecoklatan serum, juga terdiri
dari leukosit dan
robekan laserasi
plasenta.
Alba >14 hari Putih Mengandung leukosit,
selaput lendir serviks
dan serabut jaringan
yang mati.
Sumber: (Marmi, 2012).

c. Deteksi Dini dan Komplikasi pada Masa Nifas

Berikut ini akan diuraikan komplikasi yang dapat terjadi pada masa nifas

meliputi:

1) Perdarahan Pervaginam

Perdarahan pervaginam yang melebihi 500 ml setelah bersalin didefinisikan

sebagai perdarahan pasca persalinan. Perdarahan pervaginam dibedakan

menjadi 2 yaitu hemorargi post partum primer yang terjadi dalam 24 jam

setelah persalinan danhemorargi post partum sekunder yang terjadi setelah

24 jam persalinan sampai 6 minggu masa nifas (Wulandari, 2011).


38

2) Infeksi Masa Nifas

Beberapa bakteri dapat menyebabkan infeksi setelah persalinan, infeksi masa

nifas masi merupakan penyebab tertinggi AKI. Infeksi genitalia merupakan

komplikasi masa nifas. Infeksi yang meluas kesaluran urinaria, payudara dan

pasca pembedahan merupakan salah satu penyebab terjadinya AKI tinggi.

Gejala umum infeksi berupa suhu badan panas dan denyut nadi cepat.

Gejala lokal dapat berupa uterus lembek, kemerahan dan rasa nyeri pada

payudara atau adanya disuria (Marmi, 2011).

3) Sakit Kepala, Nyeri Epigastrik dan Penglihatan Kabur

Gejala-gejala ini merupakan tanda-tanda terjadinya eklamsia masa nifas,

terutama bila disertai dengan tekanan darah tinggi (Marmi, 2011).

4) Pembengkakan di Wajah atau Ekstermitas

Hal ini berhubungan dengan poin di atas, yang mana pembengkakan pada

bagian wajah dan ekstermitas merupakan salah satu dari beberapa gejala dan

tanda terjadinya eklamsia masa nifas (Marmi, 2011).

5) Demam, Muntah, Rasa Sakit Waktu Berkemih

Pada masa nifas dini sensitifitas kandung kemih terhadap tegangan air kemih

di dalam vesika sering menurun akibat trauma persalinan serta analgesia

epidural atau spinal. Sensasi peregangan kandung kemih juga mungkin

berkurang akibat rasa tidak nyaman, yang ditimbulkan oleh episiotomi yang

lebar, laserasi, dan hematom dinding vagina (Marmi, 2011).


39

6) Kelainan Payudara

a) Bendungan ASI

Bendungan ASI merupakan keadaan dimana payudara mengalami

distensi menjadi keras dan berbenjol-benjol ditandai dengan adanya rasa

nyeri yang cukup hebat dan disertai dengan kenaikan suhu (Wulandari,

2011).

b) Mastitis

Mastitis adalah peradangan pada payudara. Mastitis dapat terjadi kapan

saja sepanjang periode menyusui, akan tetapi paling sering terjadi antara

hari ke 10 dan hari ke 28 setelah melahirkan (Rahmawati, 2011).

c) Abses Payudara

Abses payudara terjadi apabila mastitis tidak teratasi dengan baik,

sehingga memperberat infeksi (Yanti, 2011).

d) Puting Susu Lecet

Puting susu lecet terjadi karena trauma pada puting susu saat menyusui,

selain itu dapat pula terjadi karena retak dan pembentukan celah-celah.

Retakan pada puting susu dapat sembuh sendiri dalam waktu 48 jam

(Yanti, 2011).

e) Saluran Susu Tersumbat

Saluran susu tersumbat merupakan air susu yang mengental sehingga

menyumbat lumen saluran. Hal ini terjadi sebagai akibat air susu jarang

yang dikeluarkan, adanya penekanan saluran air susu dari luar dan

pemakaian bra yang terlalu ketat (Yanti, 2011).


40

7) Kehilangan Nafsu Makan dalam Waktu yang Lama

Kelelahan yang amat berat setelah persalinan dapat mengganggu nafsu

makan, sehingga ibu tidak ingin makan sampai kelelahan itu hilang.

Hendaknya setelah bersalin berikan ibu minuman hangat, susu, kopi atau teh

yang bergula untuk mengembalikan tenaga yang hilang. Berikanlah makanan

yang sifatnya ringan, karena alat pencernaan perlu istirahat guna

memulihkan keadaannya kembali (Yanti, 2011).

8) Rasa Sakit, Merah, Lunak dan Pembengkakan pada Kaki

Selama masa nifas dapat terbentuk thrombus sementara pada vena-vena

manapun di pelvis yang mengalami dilatasi (Marmi, 2011).

9) Merasa Sedih atau Tidak Mampu Mengasuh Sendiri Bayinya dan Dirinya

Sendiri

Penyebabnya adalah kekecewaan emosional bercampur rasa takut

yang dialami kebanyakan wanita hamil dan melahirkan, rasa nyeri pada awal

masa nifas kelelahan akibat kurang tidur selama persalinan dan setelah

melahirkan, kecemasan akan kemampuanya untuk merawat bayinya setelah

meninggalkan rumah sakit, ketakutan akan menjadi tidak menarik lagi

(Marmi, 2011).

d. Kebutuhan Dasar Ibu Masa Nifas

1) Nutrisi dan Cairan

Ibu nifas memerlukan nutrisi dan cairan untuk pemulihan kondisi kesehatan

setelah melahirkan, cadangan tenaga serta untuk memenuhi produksi air

susu. Ibu nifas dianjurkan untuk memenuhi kebutuhan gizi sebagai berikut:
41

a) Mengkonsumsi makanan tambahan, kurang lebih 500 kalori tiap hari.

b) Makan dengan diet gizi seimbang untuk memenuhi kebutuhan

karbohidrat, protein, lemak, vitamin dan mineral.

c) Minum sedikitnya 3 liter setiap hari.

d) Mengkonsumsi tablet besi selama 40 hari pstpartum.

e) Mengkonsumsi vitamin A 200.000 intra unit (Wulandari, 2011).

2) Ambulasi

Ambulasi dini adalah mobilisasi segera setelah ibu melahirkan

dengan membimbing ibu untuk bangun dari tempat tidurnya. Ibu postpartum

diperbolehkan bangun dari tempat tidurnya 24-48 jam setelah melahirkan.

Anjurkan ibu untuk memulai mobilisasi dengan miring kanan/kiri, duduk

kemudian berjalan (Yanti, 2011).

Menurut Yanti (2011), keuntungan mobilisasi dini:

a) Ibu merasa lebih sehat dan kuat.

b) Fungsi usus, sirkulasi, paru-paru dan perkemihan lebih baik.

c) Kemungkinan untuk mengajarkan perawatan bayi pada ibu.

d) Mencegah trombosis pada pembuluh tungkai.

e) Sesuai dengan keadaan indonesia (sosial ekonomis).

Ambulasi dini tidak dianjurkan bagi ibu nifas dengan penyulit seperti

anemia, penyakit jantung, penyakit paru-paru, demam dan sebagainya

(Yanti, 2011).
42

3) Eliminasi

Buang air kecil sendiri sebaiknya dilakukan secepatnya. Miksi

normal bila dapat BAK spontan setiap 3-4 jam. Kesulitan BAK dapat

disebabkan karena springter uretra tertekan oleh kepala janin selama

persalinan atau dikarenakan oedema kandung kemih selama persalinan.

Lakukan katerisasi apabila kandung kemih penuh dan sulit berkemih (Yanti,

2011).

Ibu diharapkan dapar BAB sekitar 3-4 hari postpartum. Apabila

mengalami kesulitan BAB/obstipasi, lakukan diet teratur cukup cairan,

konsumsi makanan berserat, olahraga, berikan obat rangsangan per oral/

rektal atau lakukan klisma bilamana perlu (Yanti, 2011).

4) Kebersihan Diri

Kebersihan diri berguna untuk mengurangi infeksi dan meningkatkan

perasaan nyaman. Kebersihan diri meliputi kebersihan tubuh, pakaian,

tempat tidur maupun lingkungan (Yanti, 2011).

5) Istirahat

Ibu nifas memerlukan istirahat yang cukup, istirahat tidur yang dibutuhkan

oleh ibu nifas sekitar 8 jam pada malam hari dan 1 jam pada siang hari.

Kurang istirahat dapat menyebabkan jumlah ASI berkurang, memperlambat

involusi uterus, depresi, ketidak mampuan merawat bayi serta anemia yang

ditandai dengan wajah, mata, dan kuku pucat (Wulandari, 2011).


43

6) Seksual

Hubungan seksual aman dilakukan setelah darah berhenti. Selama periode

nifas, hubungan seksual juga dapat berkurang. Hal ini disebabkan oleh

gangguan/ketidaknyamanan fisik, kelelahan, ketidakseimbangan hormon dan

kecemasan berlebihan (Yanti, 2011).

7) Senam Nifas

Organ-organ tubuh wanita akan kembali seperti semula sekitar 6 minggu.

Oleh karena itu, ibu akan berusaha memulihkan dan mengencangkan bentuk

tubuhnya. Hal tersebut dapat dilakukan dengan cara latihan senam nifas.

Senam nifas adalah senam yang dilakukan sejak hari pertama melahirkan

sampai dengan hari ke sepuluh (Yanti, 2011).

e. Peran dan Tanggung Jawab Bidan dalam Masa Nifas

Bidan memiliki peranan yang sangat penting dalam pemberian asuhan

masa nifas. Asuhan kebidanan pada masa nifas merupakan hal yang sangat

penting, karena periode ini merupakan masa kritis bagi ibu maupun bayinya.

Adapun peran dan tanggung jawab bidan dalam masa nifas antara lain:

1) Memberikan dukungan secara berkesinambungan selama masa nifas sesuai

dengan kebutuhan ibu untuk mengurangi ketegangan fisik dan psikologis

selama masa nifas.

2) Sebagai promotor hubungan antara ibu dan bayi serta keluarga.

3) Mendorong ibu untuk menyusui bayinya dengan meningkatkan rasa nyaman.

4) Membuat kebijakan, perencana program kesehatan yang berkaitan ibu dan

anak dan mampu melakukan kegiatan administrasi.


44

5) Mendetaksi adanya komplikasi dan perlunya rujukan.

6) Memberikan konseling untuk ibu dan keluarganya mengenai cara mencegah

perdarahan, mengenali tanda-tanda bahaya, menjaga gizi yang baik, serta

mempraktekkan kebersihan yang aman.

7) Melakukan manajemen asuhan dengan cara mengumpulkan data,

mengidentifikasi, menetapkan diagnosa dan rencana tindakan serta

melaksanakannya untuk mempercepat proses pemulihan, mencegah

komplikasi dengan memenuhi kebutuhan ibu dan bayi selama periode nifas.

8) Memberikan asuhan secara professional (Marmi, 2012).

Dari pemikiran dan tindakan saja, melainkan juga perilaku pada setiap

langkah agar pelayanan yang komprehensif dan aman dapat tercapai (Asrinah,

2010).

3. Langkah-langkah Manajemen Kebidanan

Proses manajemen terdiri dari 7 langkah yang dimulai dengan

pengumpulan data dasar dan diakhiri dengan evaluasi. Ke tujuh langkah terdiri

dari keseluruhan kerangka kerja yang dapat dipakai dalam segala situasi. Setiap

langkah, dapat dipecah/dirubah untuk sebagai batas tugas dan kewajiban, dan ini

sangat bervariasi sesuai dengan kondisi klien saat itu. Langkah-langkah tersebut

sebagai berikut:
45

a. Langkah I. Identifikasi Data Dasar

Dalam mengumpulkan data subjektif dan data objektif yang perlu dikaji yaitu:

1) Data Subyektif (S).

Hal yang perlu dikaji pada ibu nifas meliputiidentitas ibu dan

suami, keluhan yang dirasakan ibu saat ini, adakah kesulitan atau gangguan

dalam pemenuhan kebutuhan sehari-hari misalnya pola makan buang air

kecil atau buang air besar, kebutuhan istirahat dan mobilisasi, selanjutnya

dikaji pula riwayat persalinan meliputi komplikasi, laserasi atau episiotomi.

Obat atau suplemen yang dikonsumsi saat ini misalnya tablet besi, kemudian

menanyakan perasaaan ibu saat ini berkaitan dengan kelahiran bayinya,

penerimaan terhadap peran baru sebagai orang tua termasuk suasana hati

yang dirasakan ibu sekarang, kecemasan dan kekhawatiran. Adakah

kesulitan dalam pemberian ASI dan perawatan bayi sehari-hari, bagaimana

rencana menyusui nanti (eksklusif atau tidak), rencana merawat bayi

dirumah (dilakukan ibu sendiri atau dibantu oleh orang tua/mertua). Dikaji

pula bagaimana dukungan suami atau keluarga terhadap ibu serta

menanyakan pengetahuan ibu tentang nifas (Wulandari, 2011).

Keluhan utama yang ditemui pada kasus ibu di masa nifas dengan

anemia berat yaitu menurut Proferawati (2011) yaitu tekanan darah rendah

frekuensi pernapasan rendah, pucat dan kulit dingin, kulit kuning, nyeri

dada, sakit kepala, tidak bias berkonsentrasi, sesak napas, nyeri dada serta

pingsan.
46

2) Data Obyektif (O).

Pemeriksaan yang dapat dilakukan pada ibu nifas menurut

Wulandari (2011) meliputi keadaan umum, kesadaran, tanda-tanda vital

(tekanan darah, nadi, suhu dan pernapasan), payudara (pembesaran, putting

susu, ASI/kolostrum sudah keluar atau belum, adakah pembengkakan atau

benjolan yang abnormal. Selanjutnya dilakukan pula pemeriksaan kadar Hb

dan tranfusi darah serta dilakukan pemeriksaan pada ekstremitas bawah

(pergerakan, gumpalan darah pada otot kaki yang menyebabkan nyeri,

oedema, Homans Sign dan varises).

b. Langkah II. Identifikasi Diagnosa/Masalah Aktual

Pada langkah ini, dilakukan identifikasi yang benar terhadap diagnosis

atau masalah, dan kebutuhan klien berdasarkan interpretasi yang benar atas

dasar-dasar yang telah diinterpretasikan sehingga ditemukan maslah atau

diagnosis yang spesifik (Asrinah, 2010).

Berdasarkan data yang diperoleh maka dirumuskanlah sebuah

diagnosa, diagnosa tersebut memuat tentang jumlah kelahiran (para), jumlah

keguguran, jumlah hari masa nifas disertai masalah yang dialami pasien.

Diagnosa yang dapat terjadi pada masa nifas menurut Yanti (2011) meliputi

perdarahan pervaginam, infeksi masa nifas, sakit kepala, nyeri epigastrik dan

penglihatan kabur, pembengkakan di wajah atau ekstermitas, demam, muntah,

rasa sakit waktu berkemih, kelainan payudara, bendungan asi, mastitis, abses

payudara, puting susu lecet, saluran susu tersumbat, kehilangan nafsu makan

dalam waktu yang lama, rasa sakit, merah, lunak dan pembengkakan pada kaki,

merasa sedih atau tidak mampu mengasuh sendiri bayinya dan dirinya sendiri.
47

c. Langkah III. Identifikasi Diagnosa/Masalah Potensial

Pada langkah ini kita mengidentifikasi masalah atau diagnosis potensial lain

berdasarkan rangkaian masalah dan diagnosis yang telah diidentifikasi.

Langkah ini membutuhkan antisipasi, bila memungkinkan dilakukan

pencegahan. Sambil mengamati klien bidan diharapkan dapat bersiap-siap bila

diagnosis/masalah potensial ini benar-benar terjadi. Pada langkah ini penting

sekali melakukan asuhan yang aman (Asrinah, 2010). Sehingga diagnosa

potensial terjadi karena kelanjutan dari diagnosa aktual yang tidak ditangani

dengan baik.

d. Langkah IV. Perlunya Tindakan Segera/ Kolaborasi dan Konsultasi

Beberapa data memberi indikasi tidak ditemukan adanya situasi yang

emergency pada pasien dengan mastitis dimana bidan tidak harus bertindak

segera dalam rangka menyelamatkan nyawa ibu, akan tetapi tetap

membutuhkan konsultasi atau kolaborasi dokter.Dalam hal ini untuk

pengumpulan data pada kasus anemia berat yaitu perlu dilakukan kolaborasi

dengan dokter untuk mencegah masalah potensial seperti terjadi infeksi.

Tindakan kolaborasi yang dibutuhkan yaitu kolaborasi dokter tentang

pemberian obat-obatan (Nita, 2011).

e. Langkah V. Rencana Asuhan

Pada langkah ini dilakukan perencanaan yang menyeluruh, ditentukan

langkah-langkah sebelumnya. Langkah ini merupakan kelanjutan manajemen

terhadap diagnosis atau masalah yang telah diidentifikasi atau diantisipasi.

Informasi atau data dasar yang tidak lengkap dapat dilengkapi. Rencana asuhan
48

yang menyeluruh tidak hanya meliputi apa yang sudah teridentifikasi dari

kondisi klien, atau dari setiap masalah yang berkaitan, tetapi juga dari kerangka

pedoman antisipasi terhadap perempuan tersebut, seperti apa yang diperkirakan

akan terjadi berikutnya, apakah dibutuhkan penyuluhan, konseling dan apakah

perlu merujuk klien.

Menurut Dewi (2012), pengobatan terhadap anemia meliputi

pemberian zat besi secara oral atau parental ( suntik ), tranfusi darah dan

suntikan obat ( eritropoietin ) yang membantu anda menciptakan lebih banyak

sel darah merah. Suplemen besi merupakan pilihan tepat bagi wanita hamil

yang membutukan besi lebih banyak.

f. Langkah VI. Implementasi

Pada langkah ini, rencana asuhan yang menyeluruh dalam langkah

kelima harus dilaksanakan secara efisien dan aman. Perencanaan ini bisa

dilakukan seluruhnya oleh bidan, atau sebagian dilakukan oleh bidan dan

sebagian lagi oleh klien atau anggota tim kesehatan lainnya.

Dalam situasi dimana bidan melakukan tindakan kolaborasi dengan

dokter, dan masih tetap terlibat dalam penatalaksanaan perawatan klien yang

mengalami komplikasi, maka seorang bidan yang memikul tanggung jawab

untuk pelaksanaan tindakan kolaborasi dan perawatan secara menyeluruh bagi

pasien. Implementasi yang efektif dapat mengurangi biaya perawatan dan

meningkatnya kualitas pelayanan kepada pasien. Dalam hal ini untuk

pengumpulan data pada kasus mastitis yaitu melaksanakan asuhan sesuai

rencana asuhan.
49

g. Langkah VII Evaluasi

Pada langkah ini, dilakukan evaluasi guna menilai efektifitas dari asuhan yang

telah diberikan, meliputi pemenuhan kebutuhan akan bantuan, apakah benar-

benar telah terpenuhi sesuai dengan kebutuhan sebagaimana telah diidentifikasi

dalam masalah dan diagnosis (Asrinah, 2010).

4. Dokumentasi Asuhan Kebidanan

a. Definisi Dokumentasi

Secara umum dokumentasi dapat diartikan sebagai suatu catatan otentik

atau semua surat asli yang dapat dibuktikan atau dijadikan bukti dalam

persoalan hokum (Asrina, 2010).

Dokumentasi dalam kebidanan adalah suatu bukti pencatatan dan

pelaporan yang dimiliki oleh bidan dalam melakukan catatan perawatan yang

berguna untuk kepentingan klien, bidan dan tim kesehatan dalam memberikan

pelayanan kesehatan dengan dasar komunikasi yang akurat dan lengkap secara

tertulis dengan tanggung jawab bidan (Asrina, 2010).

Dokumentasi dalam asuhan kebidanan merupakan suatu pencatatan

yang lengkap dan akuratterhadap keadaan/kejadian yang dilahat dalam

pelaksanaan asuhan kebidanan (proses asuhan kebidanan) (Sudarti, 2010).

SOAP adalah catatan yang bersifat sederhana, jelas, logis dan tertulis.

Metode 4 langkah yang di sebut SOAP ini di hasilkan dari proses pemikiran

penatalaksanaan kebidanan. Metode SOAP di pakai untuk mendokumentasikan

asuhan pasien dalam rekam medis sebagai catatan kemajuan informasi yang
50

sistematis yang mengorganisir penemuan dan kesimpulan menjadi suatu

rencana asuhan (Asrinah, 2010).

b. Unsur-unsur Dokumentasi

Menurut Varney (2007), alur piker bidan saat menghadapi klien

meliputi 7 langkah. Agar orang lain mengetahui apa yang telah dilaksanakan

oleh bidan melalui proses berpikir sistematis maka dilakukanlah

pendokumentasian dalam format SOAP, yakni:

S: Subyektif, menggambarkan pendokumentasian hasil pengumpulan data klien

melalui anamneses,sebagai langkah 1 Varney.

O: Obyektif, menggambarkan pendokumentasian hasilpemeriksaan fisik klien

melalui anamneses, sebagai langkah 1 Varney.

A: Assesment, menggambarkan pendokumentasian hasil analisa dan

interpretasi data subyektif dan obyektif dalam suatu identifikasi diagnosa

atau masalah aktual, antisipasi diagnosa atau masalah potensial dan

perlunya intervensi segera oleh bidan atau dokter,konsultasi kolaborasi dan

rujukan. Menggambarkan langkah 2, 3, dan 4 Varney.

P: Planning, menggambarkan pendokumentasian dari tindakan dan evaluasi

perencanaan berdasarkan assesment sebagai langkah 5, 6, dan 7 Varney

(Panduan Penyusunan Karya Tulis Ilmiah Akbid Paramata, hal. 10).


51

BAB III

STUDI KASUS

Pada bab ini penulis menguraikan tentang bagaimana penerapan manajemen

kebidanan yang dimulai dari pengumpulan data dasar hingga pendokumetasian. Pada

tanggal 01 Mei 2014 Ny. F dirujuk oleh bidan kordinator Lasalepa tepatnya pada

jam 23.00 wita dengan indikasi hipertensi. Pada tanggal 2 Mei 2014 ibu melahirkan

secara SC tepat pada jam 07.30. 1 hari pasca SC ibu mengalami perdarahan karena

atonia uteri. Pada tanggal 2 Mei 2014 ibu merasa pusing, cepat lelah dan mata

berkunang-kunang. Pada tanggal 4 Mei 2014 dilakukan pengkajian terhadap Ny. F.

A. Manajemen

1. Langkah I. Identifikasi Data Dasar

a. Identitas Istri/Suami

1) Nama : Ny.F / Tn.M

2) Umur : 22 Tahun /23 Tahun

3) Suku : Muna / Muna

4) Agama : Islam / Islam

5) Pendidikan : SMK / SD

6) Pekerjaan : IRT / Swasta

7) Pernikahan ke :I/I

8) Lamanya Menikah : 1 Tahun

9) Alamat : DesaLabunti

b. Data Biologis / Fisiologis

1) Keluhan Utama:

51
52

Ibu mengatakan merasa pusing, cepat lelah, dan mata berkunang-kunang, serta

jantungnya berdebar-debar.

2) Riwayat Keluhan Utama:

Pada tanggal 3 Mei 2014 setelah melahirkan tanggal 2 Mei 2014 ibu mengalami

perdarahan. Mulai timbul keluhan sejak setelah melahirkan pada tanggal 03

Mei 2014, sifat keluhan menetap serta mempengaruh fungsi tubuh yaitu

mengganggu karena ibu mengeluh pusing dan cepat lelah. Adapun Usaha ibu

mengatasi keluhan dengan tirah baring.

3) Riwayat Nifas Sekarang

Ibu mengatakan melahirkan anak pertama dengan SC dan tidak pernah

keguguran. Melahirkan pada tanggal 02-05-2014 Jam : 07.30 WITA. Masih

ada pengeluaran darah dari jalan lahir. ASI-nya sudah keluar bila dipencet

serta perban telah diganti.

4) Riwayat Kesehatan yang Lalu / Sekarang

a) Ibu tidak pernah mengalami penyakit kronik seperti hipertensi, malaria, DM,

jantung, TBC

b) Ibu tidak ada riwayat alergi terhadap makanan, obat-obatan dan tidak pernah

merokok, minum alcohol dan memakai NAPZA

5) Riwayat Kesehatan Keluarga

a) Tidak ada anggota keluarga yang mengidap penyakit menular seperti

hepatitis B,TBC

b) Tidak ada anggota keluarga yang mengidap penyakit keturunan seperti

diabetes mellitus
53

6) Riwayat Reproduksi

a) Riwayat haid

Ibu mengatakan menarche pada usia 13 tahun, dengan siklus haid 28 30

hari, durasi haid 7 hari, perlangsungan normal dan tidak ada gangguan haid.

b) Riwayat obstetric

(1)Riwayat kehamilan, persalinan dan nifas yang lalu :

Tidak ada.

(2)Riwayat kehamilan

Hari pertama haid terakhir tanggal 14-08-2013; Pemeriksaan kehamilan

dilakukan 4 kali selama hamil pada bidan setempat dan tidak pernah

memeriksakan keadaanya pada dokter ahli kandungan dan telah

mendapatkan suntikan TT1 dan TT2 pada kehamilan sekarang. Selama

hamil tidak pernah mengalami pengeluaran darah dari jalan lahir. Dan

selama hamil tidak menghabiskan tablet Fe yang diberikan bidan dengan

alasan sering mual sehabis mengkonsumsi tablet Fe. Selama hamil ibu

tidak pernah memeriksakan kadar HBnya.

(3)Riwayat Persalinan

Ibu di SC dengan indikasi CPD + IUGR pada tanggal 2 Mei 2014 jam

07.30 wita. Berat bayi lahir 1800 gram dan panjang badan 49 cm.

c) Riwayat Ginekologi

Ibu mengatakan tidak ada riwayat penyakit tumor dan tidak ada riwayat

penyakit infeksi lain.


54

d) Riwayat KB

Ibu mengatakan belum pernah menjadi akseptor KB

7) Riwayat Pemenuhan Kebutuhan Dasar

a) Pola Nutrisi

(1) Kebiasaan selama hamil

Ibu mengatakan memiliki kebiasaan pola makan teratur, jenis makanan

meliputi nasi, ikan, sayur, buah dan kadang susu, frekuensi makan 3 x

sehari, nafsu makan baik dan minum 7-8 gelas/hari.

(2) Setelah melahirkan

Ibu mengatakan nafsu makan agak berkurang

b) Kebutuhan Eliminasi

(1) Kebiasaan selama hamil

(a) Buang Air Kecil (BAK)

Ibu mengatakan kebiasaan sehari-hari buang kecil dengan frekuens 6-

7 x / hari, berwarna kuning, bau khas amoniak dan tidak ada

gangguan buang air kecil.

(b) Buang Air Besar (BAB)

Ibu mengatakan kebiasaan sehari-hari buang besar dengan frekuensi

1x / hari, berwarna kuning dan konsistensi lunak serta tidak ada

gangguan buang air besar.

(2) Setelah melahirkan

Ibu mengatakan BAK dan BAB tidak ada gangguan dan ibu telah BAK

dengan terpasang kateter dan BAB sebanyak 1 kali setelah melahirkan.


55

c) Pola Istrahat/tidur

(1)Kebiasaan selama hamil

Ibu mengatakan tidur siang/istrahat siang 1 jam dan tidur malam/ istrahat

malam8 jam.

(2)Kebiasaan setelah melahirkan

Ibu mengatakan istirahatnya agak terganggu karena anemia yang

dialaminya.

d) Personal Hygiene

(1) Kebiasaan selama hamil

Ibu mengatakan keramas 2-3 x seminggu mengunakan shampo,

menggosok gigi dan mulut 2x sehari menggosok gigi setelah sarapan dan

sebalum tidur menggunakan pasta gigi, mandi 2x sehari menggunakan

sabun mandi, genitalia dibersihkan setiap kali mandi dan setiap kali

selesai buang air besar/buang air kecil, pakaian diganti setiap kali selesai

mandi dan setiap kali kotor serta kuku tangan dan kaki dipotong setiap

kali panjang.

(2) Setelah melahirkan

Ibu mengatakan setelah melahirkan belum pernah keramas, gosok gigi,

dan mandi.

c. Data Psikologis

Ibu berharap agar bayinya dapat tumbuh dan berkembang dengan baik, serta

berharap agar secepatnya dapat sembuh.


56

d. Data Spiritual

1) Ibu selalu bardoa agar diri dan bayinya selalu sehat

2) Ibu belum melakukan sholat setelah melahirkan (masih dalam masa nifas)

e. Pemeriksaan Fisik

a. Pemeriksaan Umum

Keadaan umum ibu tampak lemah dan kesadaran komposmentis

2) Pemeriksaan tanda-tanda vital

Tekanan darah 90/60 mmHg, Nadi 88 x/menit, Suhu 36,5oC dan Pernapasan 26

x / menit.

3) LILA: 23 cm

4) Inspeksi, Palpasi dan Perkusi

a) Kepala

Rambut tidak rontok, kepala bersih dan tidak ada benjolan

b) Wajah

Wajah tampak pucat dan tidak ada oedema

c) Mata

Konjungtiva tampak pucat, sklera tampak putih dan kelopak mata sembab.

d) Hidung

Tidak ada secret dan tidak ada polip

e) Telinga

Tidak ada serumen dan secret, dan tidak ada pembengkakan di belakang

telinga
57

f) Mulut dan Gigi

Bibir lembab, tampak pucat, tidak ada sariawan, bersih, tidak ada karies

gigi, tidak ada sariawan.

g) Payudara
Simetris kiri dan kanan, puting susu menonjol, hyperpigmentasi pada areola

mammae, payudara tampak membesar, tidak ada benjolan dan tidak ada

nyeri tekan serta ada peneluaran ASI sedikit bila ditekan.

h) Abdomen

Tampak striae livide dan linea nigra, TFU 3 jari bawah pusat, tidak ada nyeri

tekan, tampak luka operasi, dan tonus otot perut kendor, serta verban telah

diganti.

i) Genitalia dan anus

Tidak ada varices, tidakluka bekas jahitan, tidak ada oedema,tampak

pengeluaran darah dan lochia rubra, tidak ada hemoroid, terpasang kateter.

j) Ekstremitas Atas dan Bawah

Simetris kiri dan kanan, tidak ada oedema, tidak ada varices dan humansign

positif (tidak terdapat tromboflebitis), tampak terpasang infus pada tangan

sebelah kanan serta pada kuku jari tangan dan kaki tampak pucat.

k) Kulit

Kulit tampak kuning (jaudince)

5) Pemeriksaan penunjang :

Lab: gol. Darah O, Hb : pada tanggal 3 Mei 2014 4,6 gr/dl, Leukosit (WBC) :

23.400 mm3. dan LED/BBS : 120/- mm/1 jam.


58

Berdasarkan data subyektif dan data obyektif yang di paparkan di atas,

maka dapat dirumuskan sebuah diagnosa. Adapun diagnosa yang dapat penulis

rumuskan bedasarkan paparan diatas adalah sebagai berikut:

2. Langkah II. Identifikasi Diagnosa/Masalah Aktual

Setelah dilakukannya pengumpulan data maka ditegakkan diagnosa masalah aktual

pada Ny.F yaitu, PIA0, postpartum hari ke tiga anemia berat dengan masalah

cepat lelah, untuk lebih lanjut lihat uraian berikut:

a. PIA0

1) Dasar

a) Data Subyektif:

Ibu mengatakan melahirkan anak yang pertama dan tidak pernah

keguguran.

b) Data Obyektif:

Pada pemeriksaan abdomen tampak linea nigra serta tonus otot perut

kendor.

2) Analisis dan Interprestasi


Pada banyak perempuan kulit digaris pertengahan perutnya (linea alba) akan

berubah menjadi hitam kecoklatan yang disebut linea nigra (Sarwono,

2009).Tonus otot perut kendor terjadi karena sudah pernah mengalami

peregangan akibat kehamilan (Sarwono, 2009).


59

b. Post partum hari ke tiga

1) Dasar

a) Data Subyektif:

Ibu mengatakan melahirkan dengan cara SC pada tanggal 02 Mei 2014

jam 07.30 wita.

b) Data Obyektif:

Tanggal pengkajian 04 Mei 2014

Tinggi fundus uteri 3 jari bawah pusat

Tampak pengeluaran Lochia rubra

2) Analisis dan Interprestasi

Segera setelah persalinan, tinggi fundus uteri 3 cm di bawah pusat, 12 jam

kemudian kembali 1 cm di atas pusat dan menurun kira-kira 1 cm setiap

hari. Pada hari ke dua setelah persalinan tinggi fundus uteri 1 cm dibawah

pusat. Pada hari ke 3-4 tinggi fundusuteri 2 cm di bawah pusat. Pada hari 5-7

tinggi fundus uteri setengah pusat-simpisis. Pada hari ke 10 tinggi fundus

uteri tidak teraba (Wulandari,2011).

Lochia rubra pada hari 1 sampai hari ke 4 masa postpartum. Cairan yang

keluar berwarna merah karena berisi darah segar, jaringan sisa sisa

plasenta, dinding rahim, lemak bayi, lanugo (rambut bayi) dan mekonium

(Wulandari,2011).
60

c. Anemia berat

1) Dasar

a) Data Subyektif:

Ibu mengatakan merasa pusing, cepat lelah, jantung berdebar-debar dan

mata berkunang-kunang

b) Data Objektif:

Keadaan umum ibu tampak lemah, kulit tampak pucat dan kuning

(jaudince) , tanda-tanda vital TD: 90/60 mmHg, N: 88 x/menit, S: 36,50

C dan P: 26 x/menit, ujung-ujung jari tampak pucat, pemeriksaan

penunjang : Lab : gol. Darah O, Hb : pada tanggal 03 Mei 2014 4,6

gr/dl, Leukosit : 23.400 mm3, LED/BBS : 120/- mm/1 jam.

2) Analisis dan Interprestasi

a) Beberapa tanda-tanda yang mungkin menunjukan anemia berat pada

seseorang dapat mencakup: denyut jantung cepat, Tekanan darah rendah,

Frekuensi pernapasan cepat, Pucat dan kulit dingin; kulit kuning disebut

jaudince jika anemia karena kerusakan sel darah merah, pusing atau

kepala terasa ringan(terutama berdiri atau),kelelahanatau kekurangan

energi, sakit kepala; tidak bisa berkonsentrasi, sesak napas; nyeri dada

serta pingsan (Atika Proverawati,2011).

b) Tanda dan gejala anemia yaitu kelopak mata pucat, sering kelelahan,

sering mual, sakit kepala, ujung jari pucat, sesak napas, denyut

jantungtidak teratur, wajah pucat, rambut rontok, menurunnya kekebalan

tubuh(Zafran,2011).
61

c) Berdasarkan klasifikasi dari WHO kadar hemoglobin pada ibu hamil

dapat di bagi menjadi 4 kategori yaitu :

(1) Hb > 11 gr%Tidak anemia (normal)

(2) Hb 9-10 gr% Anemia ringan

(3) Hb 7-8 gr% Anemia sedang

(4) Hb <7 gr% Anemia berat (Manuaba I.B.G, 2010).

d. Cepat lelah

1) Dasar Subyektif

a) Data

Ibu mengatakan merasa pusing, cepat lelah, jantung berdebar-debar dan

mata berkunang-kunang.

b) Data Obyektif

Keadaan umum ibu tampak lemah, wajah tampak pucat.

2) Analisis dan Interprestasi

Anemia merupakan salah satu kelainan darah yang umum terjadi ketika

kadar sel darah merah (eritrosit) dalam tubuh menjadi lebih rendah. Hal ini

dapat menyebabkan masalah kesehatan karena sel darah merah mengandung

hemoglobin yang membawah oksigen ke jaringan tubuh. Anemia dapat

menyebabkan berbagai komplikasi, termasuk kelelahan dan stress pada

organ tubuh. Hal ini diakibatkan oleh kurangnya oksigen dalam tubuh (Atika

Proferawati).
62

3. Langkah III. Identifikasi Diagnosa/ Masalah Potensial

Jika anemia yang dialami ibu tidak segera teratasi secara tepat maka keadaan yang

dialami ibu dapat berlanjut pada terjadinya infeksi post partum. Untuk lebih lanjut,

lihat uraian berikut:

a. Infeksi pada luka operasi

1) Dasar

a) Data subyektif:

Ibu mengatakan cepat lelah dan setelah melahirkannafsu makan

berkurang.

b) Data obyektif:

Keadaan umum ibu lemah, porsi makan tidak dihabiskan dan LILA 23

cm.

2) Analisis dan Interpretasis

Infeksi disebabkan oleh bakteri, virus, dan parasit, sedangkan penularan

terjadi intrauterin, pada waktu persalinan atau pascalahir. Transmisi bisa

secara plasenta ataupun melalui aliran darah atau cairan amnion. Faktor

predisposisi infeksi masa nifas, diantaranya: keadaan yang dapat

menurunkan keadaan umum yaitu perdarahan antepartum dan post partum,

anemia pada saat kehamilan, malnutrisi dan kelelahan (Menurut Icesmi

Sukarni,2013).

4. Langkah IV. Evaluasi Perlunya Tindakan Segera / Kolaborasi

Untuk memperbaiki keadaan umum ibu, maka diperlukan penanganan

lebih lanjut. Adapun rencana asuhannya yaitu melakukan kolaborasi dengan dokter
63

dalam pemberian obat-obatan berupa tablet Fe 10 tablet dosis 1x1, cefadroxil 500

mg dosis 2x1, dan Obdamin dengan dosis 1x1 serta pemeriksaan laboratorium.

Rencana tindakan segera yaitu dengan melakukan tranfusi darah pada Ny.F .

5. Langkah V. Rencana Asuhan

Setelah dilakukannya identifikasi data, identifikasi diagnosa aktual, dan

potensial sampai dengna perlunya tindakan segera/kolaborasi. Maka diperlukan

penanganan yang lebih lanjut terhadap Ny. F denga rencana asuhan sebagai

berikut:

a. Tujuan:

1) Masa nifas berlangsung normal

2) Kadar HB ibu menigkat

3) Tidak terjadi infeksi

b. Kriteria

1) Masa nifas berlangsung normal ditandai dengan

a) Involusio uterus berlangsung normal, ditandai dengan tinggi fundus

uteri (TFU) turun 1 cm setiap hari sampai uterus kembali sampai seperti

semula, kontraksi uterus baik (taraba bundar dan keras), dan

pengeluaran lochia sesuai dengan fisiologisnya:

Lochea rubra : berlangsung 1-3 hari

Lochea sanguinolenta : berlangsung 4 -7 hari

Lochea serosa : berlangsung 8-14 hari

Lochea alba : berlangsung > 14 hari


64

b) Tanda-tanda vital dalam batas normal:

(1)Tekanan darah : sistol 90-120 mmHg dan diastole : 70-80 mmHg

(2)Suhu : 36,5 0C - 37,50C

(3)Nadi : 60 100 x/menit

(4)Pernapasan : 16 24 x/menit.

c) Proses laktasi berjalan baik

(1)ASI Colostrum : Berlangsung 1-3 hari

(2)ASI peralihan : Berlangsung 4-10 hari

(3)ASI matur : Berlangsung 11 hari dan seterusnya

2) Kadar Hb ibu dapat mengalami peningkatan.

3) Tidak terjadi infeksi, ditandai dengan suhu badan ibu tidak meningkat dan

lochea ibu tidak berbau busuk.

c. Rencana Tindakan

1) Umum

a) Beritahu ibu keadaan ibu sekarang

Rasional: Ibu berhak mengetahui hasil pemeriksaan kesehatannya dan

penting bagi ibu untuk membuat keputusan yang tepat untuk

mengatasi masalah kesehatannya.

b) Pantau keadaan umum dan tanda-tanda vital ibu

Rasional: Untuk mengetahui keadaan ibu saat ini.

c) Observasi tinggi fundus uteri

Rasional: Mengobserfasi tinggi fundus uteri ibu bertjuan untuk memastikan

apakah infolusio uterus berlangsung normal atau tidak.


65

d) Observasi jumlah input dan output

Rasional: Untuk mengetahui kesesuaian jumlah cairan yang masuk dan

jumlah cairan yang keluar dari tubuh ibu. Dan juga untuk

mengetahui adakah gangguan dalam sistem perkemihan ibu.

e) Memberikan support mental kepada ibu

Rasional: Pemberian support pada ibu bertujuan untuk mengurangi beban

pikiran ibu, sehingga ibu bisa menerima keadaanya sekarang

dengan ikhlas.

f) Sarankan untuk melibatkan orang terdekat dengan ibu selama perawatan

Rasional: Ibu akan merasa aman bila berada didekat / disamping orang

terdekat sehingga mengurangi kecemasan.

g) Bantu ibu mengatur posisi yang nyaman sesuai dengan kebutuhannya

Rasional: Dengan posisi yang diinginkan akan memberikan rasa nyaman

pada klien

2) Anemia Berat

1) Tindak lanjuti kolaborasi denga dokter tentang pemberian obat-obatan

berupa tablet Fe 10 tablet dosis 1x1, cefadroxil 500 mg dosis 2x1, dan

Obdamin dengan dosis 1x1.

Rasional: Pemberian tablet Fe, cefadroxil dan Obdamin bertujuan untuk

memperbaiki keadaan umum ibu dalam menangani anemia serta

mencegah terjadinya infeksi.

2) Mobilisasi dini tidak dianjurkan


66

Rasional: ibu nifas dengan penyulit seperti anemia berat tidak dianjurkan

mobilisi dini karena keadaan ibu masi lemah.

3) Beritahu ibu bahwa besok akan dilakukan tranfusi darah

Rasional: Agar ibu dapat mempersiapkan dirinya untuk tranfusi darah pada

esok hari.

4) Anjurkan ibu mempersiapkan pendonor yang bergolongan darah O sebanyak

1 orang untuk persiapan tranfusi besok.

Rasional: Agar ibu dapat melakukan tranfusi esok hari sehingga anemia ibu

dapat cepat teratasi.

3) Edukasi

a) Anjurkan ibu untuk istirahat total

Rasional: Bedres total bertujuan untuk mengoptimalkan kondisi tubuh ibu.


b) Berikan health education (HE) pada ibu tentang:

(1)Beri KIE pada ibu tentang gizi ibu nifas dengan anemia

Rasional: Untuk mengobati anemia ibu melalui makanan yang ibu

konsumsi.

(2)Gizi ibu masa nifas dengan anemia berat yaitu mengkonsumsi makanan

yang tinggi kalori, protein dan zat besi.

Rasional: Untuk mengatasi anemia berat ibu melalui makana yang ibu

konsumsi sehingga anemia berat ibu cepat teratasi.

(3)Makan makanan yang kaya akan serat serta perbanyak minum air putih

2,5 3 liter/hari.
67

Rasional: Makanan yang kaya akan serat dapat mempermudah ibu untuk

BAB, sehingga ibu tidak mengalami konstipasi.

(4)Gizi ibu menyusui, yaitu makan makanan yang mengandung karbohidrat,

protein, lemak, vitamin, mineral dan susu khusus ibu menyusui.

Rasional: Gizi pada ibu menyusui sangat penting bagi kesehatan ibu dan

pertumbuhan bayinya karena zat-zat gizi yang dikonsumsi ibu

akan terkandung di dalam ASI.

(5)Kebersihan diri/personal hygiene terutama daerah genitalia.

Rasional: Dengan menjaga kebersihan diri dan genitalia dapat mencegah

terjadinya infeksi genitelia/jalan lahir dan memberikan suasana

nyaman pada ibu.

(6)Memandikan pasien

Rasional:Dengan ibu di mandikan bisa mengurangi infeksi dan

meningkatkan perasaan nyaman pada ibu.

6. Langkah VI. Implementasi


Untuk mengembalikan keadaan umum ibu ke keadaan normal (pulih),

maka perlu dilaksanakanya asuhan yang telah tercantum dalam rencana asuhan.

Adapun pelaksaan dan hasil dari pelaksanaan asuhannya sebagai berikut:

Tanggal 4 Mei 2014 Jam 12.40-14.30 WITA

a. Umum

1) Memberitahu ibu keadaan ibu sekarang

Hasil: Ibu bersedia dirawat

2) Memeriksa keadaan umum dan tanda-tanda vital ibu


68

Hasil: Keadaan umum ibu lemah, Tekanan darah 90/60 mmHg, Nadi 88

x/menit, Suhu 36,5oC, Pernapasan 26 x/menit.

3) Mengobserfasi tinggi fundus uteri

Hasil: Tinggi fundus uteri 3 jari bawah pusat.

4) Mengobserfasi jumlah input dan output ibu

Hasil: Jumlah cairan yang masuk 500 cc dan jumlah urin yang keluar 260 cc.

5) Memberikan support mental kepada ibu

Hasil: Ibu dapat menerima keadaan yang dialaminya sekarang.

6) Menyarankan untuk melibatkan orang terdekat dengan ibu selama perawatan

Hasil: ibu ditemani oleh suami dan saudaranya.

7) Membantu ibu mengatur posisi yang nyaman sesuai dengan kebutuhannya

Hasil: Ibu merasa nyaman dengan posisinya.

b. Anemia Berat

1) Menindaklanjuti kolaborasi denga dokter tentang pemberian obat-obatan

berupa tablet Fe 10 tablet dosis 1x1, cefadroxil 500 mg dosis 2x1, dan

Obdamin dengan dosis 1x1.

Hasil : Obat telah diresepkan dan akan diberikan setelah makan malam.

2) Memberitahu ibu bahwa besok akan dilakukan tranfusi darah

Hasil: Ibu bersedia melakukan tranfusi darah

3) Menganjurkan ibu mempersiapkan pendonor yang bergolongan darah O

sebanyak 1 orang untuk persiapan tranfusi besok.

Hasil: Ibu telah memiliki pendonor satu orang.


69

c. Edukasi

1) Memberikan KIE pada ibu tentang gizi ibu nifas dengan anemia

Hasil: Ibu bersedia melakukan anjuran bidan

2) Menganjurkan ibu untuk mengonsumsi makanan yang tinggi kalori, tinggi

protein dan zat besi.

Hasil: Ibu mau mengikuti anjuran bidan untuk mengkonsumsi makanan

tersebut.

3) Mengkonsumsi makanan yang kaya akan serat dan perbanyak minum air

pituh 2.5 3 liter/hari

Hasil: Ibu mengerti dan mau melakukan anjuran dari bidan

4) Gizi ibu menyusui, yaitu makan makanan yang mengandung karbohidrat,

protein, lemak, vitamin, mineral, air putih, susu khusus ibu menyusui jika

ada

Hasil: Ibu mengerti dan mau mengonsumsi makanan bergizi.

5) Kebersihan diri/personal hygiene terutama daerah genitalia

Hasil: Ibu mengerti dan mau mengikuti anjuran petugas

6) Istrahat yang cukup dan tidak melakukan pekerjaan yang berat

Hasil: Ibu mengerti dan mau mengikuti anjuran petugas

7. Langkah VII Evaluasi

Setelah dilaksanakannya asuhan sebagaimana yang telah di rencanakan,

untuk mengetahui berhasil dan tidaknya asuhan yang dilakukan maka perlu

dilakukan evaluasi. Diantaranya sebagai berikut:


70

Tanggal 4 Mei 2014 Jam 14.40-18.00 WITA

a. Keadaan umum ibu lemah

b. Tanda-tanda vital :

1) Tekanan Darah : 90/60 mmHg

2) Nadi : 88 x/menit

3) Suhu : 36,50C

4) Pernapasan : 26 x/menit

c. Tidak terdapat tanda tanda infeksi yang ditandai dengan suhu badan ibu

tidak meningkat dan lochea ibu tidak berbau

d. Involusio uterus berlangsung dengan normal yang ditandai dengan TFU 3 jari

bawah pusat, uterus berkontraksi dengan baik yaitu teraba keras dan bundar,

serta pengeluaran lochea rubara.

e. Ada pengeluaran ASI sedikit bila di pencet

f. BAK dengan terpasang kateter jumlah urine yang keluar 260 cc, dan BAB 1

kali setelah melahirkan.

g. Hb pada tanggal 3 Mei 2014 4,6 gr/dl

B. Pendokumentasian

Setelah dilakukannya manajemen asuhan kebidanan 7 langkah varnei pada

Ny. F ibu nifas dengan anemia berat, maka penulis akan merangkum manajemen

tersebut dalam 4 langkah pendokumentasian yang dikenal dengan SOAP, untuk lebih

jelas dapat dilihat pada uraian berikut:


71

1. Data Subyektif ( S )

Ibu mengatakan:

a. Melahirkan anak pertama secara SC pada tanggal 2 Mei 2014 jam 07.30 dan

tidak pernah keguguran

b. Merasa pusing, cepat lelah, mata berkunang-kunang dan jantungnya berdebar -

debar sejak 1 hari yang lalu

c. Selama hamil jarang mengkonsumsi tablet Fe yang diberikan bidan dengan

alasan sering pusing setelah mengkonsumsi tablet F

d. Perban telah diganti

2. Data Obyektif ( O )

a. Pemeriksaan Umum

Keadaan umum ibu tampak lemah dan kesadaran komposmentis.

b. Pemeriksaan tanda-tanda vital

Tekanan darah 90/60 mmHg, Nadi 88 x/menit, Suhu 36,50C dan Pernapasan 26

x / menit.

c. LILA: 23 cm

d. Inspeksi, Palpasi dan Perkusi

1) Wajah

Wajah tampak pucat dan tidak ada oedema.

2) Mata

konjungtiva tampak pucat , sklera tampak putih dan kelopak sembap.

3) Mulut dan Gigi

Bibir lembab, tampak pucat


72

4) Payudara
Simetris kiri dan kanan, puting susu menonjol, hyperpigmentasi pada areola

mammae, payudara tampak membesar, tidak ada benjolan dan tidak ada

nyeri tekan serta ada pengeluaran ASI sedikit bila ditekan.

5) Abdomen

Tampak linea nigra dan striae livide, TFU 3 jari bawah pusat, tidak ada

nyeri tekan, tanpak luka operasi, dan tonus otot perut kendor serta verban

telah diganti.

6) Genitalia dan anus

Tidak ada varices, tidakluka bekas jahitan, tidak ada oedema,tampak

pengeluaran darah dan lochia rubra tidak ada hemoroid, kateter terpasang.

7) Ekstremitas Atas dan Bawah

Simetris kiri dan kanan, tidak ada oedema, tidak ada varicesdan humansign

positif (tidak terdapat tromboflebitis). Serta tampak terpasang infus pada

tangan sebelah kanan, kuku jari jari tangan dan kaki tampak pucat.

8) Kulit

Kulit tampak kuning (jaudince).

9) Pemeriksaan penunjang :

Lab: gol. Darah O, Hb : pada tanggal 3 Mei 2014 4,6 gr/dl, Leukosit

(WBC) : 23.400 mm3. dan LED/BBS : 120/- mm/1 jam.

3. Assesment(A)

PI A0 post partum hari ke tiga anemia berat dengan masalah cepat lelah potensial

terjadinya infeksi post partum serta dilakukan kolaborasi dengan dokter Obgin
73

dalam pemberian obat-obatan, pemeriksaan laboratorium, dan rencana tranfusi

darah.

4. Planning (P)

Tanggal 4 Mei 2014 Jam 12.40-14.40 WITA

a. Umum

1) Memberitahu ibu keadaan ibu sekarang

Hasil: Ibu bersedia dirawat.

2) Memeriksa keadaan umum dan tanda-tanda vital ibu

Hasil: Keadaan umum ibu lemah, Tekanan darah 90/60 mmHg, Nadi 88

x/menit, Suhu 36,5oC, Pernapasan 26 x/menit

3) Mengobserfasi tinggi fundus uteri

Hasil: tinggi fundus uteri 3 jari bawah pusat.

4) Mengobserfasi jumlah input dan output ibu

Hasil: jumlah cairan yang masuk 500 cc dan jumlah urin yang keluar 260

cc.

5) Memberikan support mental kepada ibu

Hasil: ibu dapat menerima keadaan yang dialaminya sekarang.

8) Menyarankan untuk melibatkan orang terdekat dengan ibu selama perawatan

Hasil: ibu ditemani oleh suami dan saudaranya.

9) Membantu ibu mengatur posisi yang nyaman sesuai dengan kebutuhannya

Hasil: ibu merasa nyaman dengan posisinya.


74

b. Anemia Berat
1) Menindaklanjuti kolaborasi denga dokter tentang pemberian obat-obatan

berupa tablet Fe 10 tablet dosis 1x1, cefadroxil 500 mg dosis 2x1, dan

Obdamin dengan dosis 1x1

Hasil : Obat telah diresepkan

2) Memberitahu ibu bahwa besok akan dilakukan tranfusi darah

Hasil: ibu bersedia melakukan tranfusi darah

3) Menganjurkan ibu mempersiapkan pendonor yang bergolongan darah O

sebanyak 1 orang untuk persiapan tranfusi besok.

Hasil: ibu telah mempersiapkan pendonor satu orang.

c. Edukasi

1) Memberikan KIE pada ibu tentang gizi ibu nifas dengan anemia

Hasil: Ibu bersedia melakukan anjuran bidan

2) Menganjurkan ibu untuk mengonsumsi makanan yang tinggi kalori, tinggi

protein dan zat besi.

Hasil: Ibu mau mengikuti anjuran bidan untuk mengkonsumsi makanan

tersebut.

3) Mengkonsumsi makanan yang kaya akan serat dan perbanyak minum air

pituh 2,5 3 liter/hari

Hasil: Ibu mengerti dan mau melakukan anjuran dari bidan

4) Gizi ibu menyusui, yaitu makan makanan yang mengandungkarbohidrat,

protein, lemak, vitamin, mineral, air putih, susu khusus ibu menyusui jika

ada
75

Hasil: Ibu mengerti dan mau mengonsumsi makanan bergizi.

5) Kebersihan diri/personal hygiene terutama daerah genitalia

Hasil: Ibu mengerti dan mau mengikuti anjuran petugas.

6) Memandikan ibu di atas tempat tidur

Hasil: Ibu telah di mandikan

7) Istrahat yang cukup dan tidak melakukan pekerjaan yang berat

Hasil: Ibu mengerti dan mau mengikuti anjuran petugas.

5. Follow Up

Diharapkan pada kunjungan nifas hari pertama tanggal 5 Mei 2014:

a. Keadaan umum ibu mulai membaik, ditandai dengan ibu sudah tidak mengeluh

pusing.

b. Masa nifas belangsung normal, yang ditandai dengan:

a) Kontraksi uterus baik ditandai dengan uterus teraba bundar dan keras.

b) TFU 3 jari dibawah pusat dan pengeluaran lochea rubra

c) Proses laktasi berjalan baik.

c. Obat-obatan yang diberikan diminum secara teratur.

d. Tidak ada tanda-tanda infeksi yaitu lochia berbau busuk, suhu badan ibu tinggi

serta ada peningkatan kadar Hb.

e. Tranfusi berjalan dengan baik tanpa ada efek alergi, seperti: kulit bentol-bentol

dan berwarna merah dan badan terasa gatal-gatal.

C. Catatan Perkembangan

Dalam catatan perkembangan ini penulis melakukan pemantauan selama 3

hari. Berikut akan diuraikan mengenai catatan perkembangan Ny. F:


76

1. Hari Pertama

Tanggal 5 Mei 2014 Pukul : 08.00 -08.20Wita

a. Data Subyektif

Ibu mengatakan:

1) masih merasa lemas dan pusing.

2) obat yang diberikan telah diminum.

3) payudaranya terasa penuh.

b. Data Obyektif

1) Keadaan umum ibu baik dan kesadaran komposmentis.

2) Tanda tanda vital Tekanan darah 110/60 mmHg, Nadi 80 x / menit, Suhu

37 0C, Pernapasan 20 x / menit.

3) Wajah tampak pucat.

4) Konjungtiva masih pucat.

5) Payudara teraba keras.

6) TFU 3 jari bawah pusat dan diastasis negative.

7) Lochia sanguilenta berwarna merah kekuningan.

8) Ekstermitas atas dan bawah, tidak ada oedema pada punggung tangan dan

kaki serta tidak ada tromboflebitis (Human sign positif).

c. Assesment (A)

F PIA0 post partum hari ke empat dengan anemia berat, potensial terjadinya

infeksi post partum serta dilakukan kolaborasi dengan dokter Obgin dalam

pemberian obat-obatan, pemeriksaan laboratorium, dan rencana tranfusi darah.

d. Planning
77

Tanggal 5 Mei 2014 Pukul : 08.25 -11.00 Wita

1) Memeriksa keadaan umum ibu

Hasil: Keadaan umum ibu tampak lemah.

2) Mengkaji keluhan yang ibu rasakan

Hasil: ibu mengatakan masi merasa lemas dan pusing.

3) Menyampaikan kondisi ibu saat ini

Hasil: ibu telah mengetahui kondisinya saat ini.

4) Mengompres payudaranya dengan menggunakan air hangat

Hasil: payudara ibu telah dikompres dengan menggunakan air hangat.

5) Menganjurkan pada ibu agar tetap mengkonsumsi obat yang telah diberikan

dengan teratur.

Hasil: ibu bersedia mengkonsumsi obat-obatan yang diberikan.

6) Membantu ibu mengganti pakaian ibu dengan pakaian baru

Hasil: pakayan ibu telah terganti dengan pakayan yang bersih.

7) Membantu ibu menggantu verban luka operasi

Hasil: verban telah di ganti

8) Menganjurkan ibu untuk mobilisasi

Hasil : ibu telah miring kiri dan kanan

9) Menganjurkan ibu tetap menjaga kebersihan tubuhnya, terutama daerah

genitalia.

Hasil: ibu bersedia menjaga kebersihan tubuhnya dan pakaian dalam ibu

telah diganti.

10) Mengobserfasi jumlah input dan output


78

Hasil: Jumlah cairan yang masuk 800 cc dan jumlah output 270 cc.

11) Melakukan persiapan tranfusi darah

Hasil: Dexametason dan Nipenhidramin telah diaplos dan NaCl telah

terpasang.

12) Menyuntikkan Dexametason dan Dipenhidramin secara IM pada bokong ibu

Hasil: telah disuntikkan dexadipen

13) Melakukan tranfusi darah 1 zak (250 cc)

Hasil: tranfusi telah dilakukan pada jam 12.00 Wita dan selesai pada jam

12.45 Wita.

14) Melakukan kembali tes Hb setelah dilakukan tranfusi sebanyak 3 kali

Hasil: talah dilakukan tes Hb yaitu dengan hasil 5,8 gr/dl.

e. Follow Up

Diharapkan pada kunjungan hari kedua tanggal 6 Mei 2014:

1) Keadaan umum ibu mulai membaik, ditandai dengan ibu sudah tidak

mengeluh pusing dan tanda tanda vital dalam batas normal

2) Involusio uterus belangsung normal , yang ditandai dengan:

a) Kontraksi uterus baik ditandai dengan uterus teraba bundar dan keras.

b) TFU 4 jari dibawah pusat dan peneluaran lochea rubra

3) Obat-obatan yang diberikan diminum secara teratur

4) Tidak ada tanda-tanda infeksi yaitu lochia berbau busuk, suhu badan ibu

tinggi

5) Dengan diberikannya tranfusi kadar HB ibu dapat menigkat

6) Pembengkakan pada Payudara ibu dapat berkurang.


79

2. Hari Kedua

Tanggal 6 Mei 2014 Pukul: 08.30 08.55 wita

a. Data Subyektif

Ibu mengatakan:

1) Masi merasa lemas dan pusing jika duduk.

2) Masih ada pengeluaran darah dari jalan lahir.

3) Payudaranya terasa sakit.

b. Data Obyektif

1) Keadaan umum ibu masi lemas , kesadaran komposmentis.

2) Tanda tanda Vital : Tekanan darah 120/80 mmHg, Nadi 80 x/ menit, Suhu

36,5oC, Pernapasan 20 x/menit.

3) Wajah tidak pucat.

4) Konjungtiva masih pucat, sclera tampak putih.

5) Payudara ibu teraba keras.

6) TFU 4 jari bawah pusat.

7) Lochia rubra berwarna merah kekuningan.

8) Tidak ada tanda tanda infeksi.

c. Assesment

PIA0 post partum hari ke lima dengan anemia berat, potensial terjadinya

bendungan ASI, serta dilakukan kolaborasi dengan dokter Obgin dalam rencana

tranfusi darah.
80

d. Planning

Tanggal 6 Mei 2014 Pukul : 09.00 - 11.00 Wita

1) Memeriksa keadaan umum ibu dengan memeriksa tanda-tanda vital ibu

Hasil: keadaan umum ibu masih lemah, dengan Tekanan darah 120/80

mmHg, Nadi80 x / menit, Suhu 36,5oC, Pernapasan 20 x / menit.

2) Memberitahu ibu keadaan ibu sekarang.

Hasil : Ibu mengerti dengan keadaannya.


3) Menganjurkan pada ibu agar tetap mengkonsumsi obat yang telah diberikan

dengan teratur

Hasil: ibu telah mengkonsumsi obat-obatan yang diberikan.

4) Menganjurkan ibu mengompres payudaranya dengan menggunakan air

hangat

Hasil: payudara ibu telah dikompres dengan menggunakan air hangat.

5) Menganjurkan ibu agar memompa ASInya

Hasil: ASI ibu telah dipompa dan paydara ibu pembengkakannya menurun.

6) Membantu ibu mengganti pakaian ibu dengan pakaian baru

Hasil: pakaian ibu telah terganti dengan pakaian yang bersih.

7) Membantu ibu mengganti verban luka opersi.

Hasil : verban telah di ganti

8) Menganjurkan ibu untuk mobilisasi

Hasil : ibu telah miring kiri dan kanan

9) Menganjurkan ibu tetap menjaga kebersihan tubuhnya, terutama daerah

genitalia
81

Hasil: Ibu bersedia menjaga kebersihan tubuhnya dan pakayan dalam ibu

telah diganti.

10) Mengobserfasi jumlah input dan output

Hasil: jumlah cairan yang masuk 900 cc dan jumlah output 500 cc.

11) Melakukan persiapan tranfusi darah

Hasil: Dexametason dan Dipenhidramin telah diaplos dan NaCl telah

terpasang.

12) Menyuntikkan Dexdipen IM pada bokong ibu

Hasil: telah disuntikkan dexadipin.

13) Melakukan tranfusi darah 1 zak (250 cc)

Hasil: tranfusi telah dilakukan pada jam 12.40 Witadan selesai pada jam

13.10 Wita.

e. Follow Up

Diharapkan pada kunjungan nifas hari ke tiga tanggal 7 Mei 2014:

1) Keadaan umum ibu mulai membaik, ditandai dengan ibu sudah tidak

mengeluh pusing dan tanda tanda vital dalam batas normal

2) Infolusio uterus belangsung normal , yang ditandai dengan:Kontraksi uterus

baik ditandai dengan uterus teraba bundar dan keras, pertengahan pusat dan

simpisis serta peneluaran lochea sanguelenta

3) Obat-obatan yang diberikan diminum secara teratur.

4) Tidak ada tanda-tanda infeksi yaitu lochia berbau busuk, suhu badan ibu

tinggi.

5) Dengan diberikannya tranfusi darah kadar HB ibu mengalami peningkatan.


82

6) Pembengkakan pada Payudara ibu mulai berkurang.

3. Hari Ketiga

Tanggal 7 Mei 2014 Pukul : 08.00-08.40 wita

a. Data Subyektif

Ibu mengatakan sudah merasakan baikan dan tidak merasakan pusing serta

sakit pada payudaranya sudah berkurang.

b. Data Obyektif

1) Keadaan umum ibu baik dan kesadaran komposmentis

2) Tanda tanda Vital: Tekanan darah120/80 mmHg, Nadi 80 x/menit, Suhu

36,5 oC, Pernapasan22 x/menit

3) Wajah tidak pucat dan tidak ada oedema.

4) Konjungtiva merah mudah dan sclera tampak putih.

5) Payudara teraba lembek.

6) TFU pertengahan pusat dan simpisis.

7) Lochia Sanguinolenta, berwarna merah kekuningan.

c. Assesment

PIA0 post partum hari ke enam dengan anemia berat, serta dilakukan

kolaborasi dengan dokter Obgin dalam rencana tranfusi darah.

d. Planning

Tanggal 7 Mei 2014 Pukul : 08.45-10.30 Wita

1) Memeriksa keadaan umum ibu

Hasil: keadaan umum ibu masih lemah, dengan tekanan darah 120/80 mmHg,

Nadi 80 x/menit, Suhu 36,5 oC, Pernapasan 20 x / menit.


83

2) Mengkaji keluhan yang dirasakan ibu saat ini

Hasil: Ibu mengatakan sudah merasakan baikan, tidak merasakan pusing, sakit

pada payudaranya sudah berkurang dan payudaranya sudah teraba

lembek.

3) Memberitahu ibu keadaan ibu sekarang

Hasil : Ibu mengerti dengan keadaannya.

4) Menganjurkan pada ibu agar tetap mengkonsumsi obat yang telah diberikan

dengan teratur

Hasil: ibu telah mengkonsumsi obat-obatan yang diberikan .

5) Membantu ibu mengganti verban luka operasi

Hasil : verban telah di ganti

6) Menganjurkan ibu untuk mobilisasi

Hasi : ibu telah bisa duduk

7) Menganjurkan ibu tetap menjaga kebersihan tubuhnya, terutama daerah

genitalia

Hasil: ibu bersedia menjaga kebersihan tubuhnya dan pakayan dalam ibu telah

diganti.

8) Memberitahu ibu bahwa akan melakukan pemeriksaan tes Hb

Hasil: ibu bersedia melakukan pemeriksaan Hb.

9) Melakukan persiapan tranfusi darah

Hasil: Dexametason dan Dipenhidramin telah diaplos dan NaCl telah

terpasang.

10) Menyuntikkan Dexadipen secara IM pada bokong ibu


84

Hasil: telah disuntikkan dexadipin.

11) Melakukan tranfusi darah 1 zak (250 cc)

Hasil: tranfusi telah dilakukan pada jam 12.45 Wita dan selesai pada jam

13.25 Wita.

12) Melakukan pemeriksaan kadar Hb dalam darah ibu

Hasil: kadar Hb ibu 7 gr/dl.


85

BAB IV

PEMBAHASAN

Pada bab ini penulis akan munguraikan studi kasus yang telah dipilih oleh

penulis, berdasarkan dengan Manajemen Kebidanan Varney mulai dari pengkajian

sampai dengan evaluasi. Selain itu, penulis akan menguraikan tentang ada dan

tidaknya kesenjangan antara teori yang ada dengan praktek yang penulis temukan

dilapangan.

Pelaksanaan asuhan kebidanan Ny. F PIA0Post partum Hari Ke-3dengan

anemia berat diRumah Sakit Umum Daerah Kabupaten Muna Tanggal 4 s.d. 7 Mei

2014, walaupun ada beberapa kondisi yang tidak sesuai dengan teori yang penulis

peroleh.

A. Identifikasi Data Dasar

Pengkajian merupakan tahap awal yang digunakan sebagai landasan dalam

proses asuhan kebidanan, tahap ini mencakup kegiatan pengumpulan, pengolahan

dan analisa data atau fakta yang dikumpulkan dari beberapa data subyektif dan

obyektif. Data tersebut diperoleh dengan cara wawancara, observasi, pemeriksaan

fisik, studi dokumentasi, dan studi kepustakaan. Pengkajian ini dibuat teliti dan

sistematis, sehingga dapat diketahui diagnosa kebidanan, masalah dan kebutuhan

yang ada dan akhirnya dapat diberikan asuhan kebidanan terhadap masalah

tersebut.

Setelah Ny. F melahirkan di Rumah Sakit Umum Daerah mengalami

pendarahan dan keadaan umum Ny. F tampak lemah. Setelah dilakukannya

pengkajian pada Ny. F, melalui wawancara penulis mendapatkan Ny. F mengeluh

85
86

pusing dan mata berkunang-kunang. Setelah itu dilakukan pemeriksaan fisik,

penulis menemukan keadaan umum ibu lemah, kesadaran komposmentis, tekanan

darah 90/60 mmHg, Nadi 88 x/menit, Suhu 36,50C dan Pernapasan 26 x/menit.

Serta pada pemeriksaan fisik wajah, konjungtiva, tangan dan kaki tampak pucat.

Selain itu juga dilakukan pemeriksaan Leb, dan didapatkan hasil: golongan darah

O, Hb : 4,6 gr/dl, leukosit (WBC) : 23.400 mm3, LED/BBS : 120/- mm/1 jam.

Menurut Rukiah (2011) Anemia adalah suatu keadaan adanya penurunan

kadar hemoglobin, hematokrit dan jumlah eritrosit dibawah nilai normal. Pada

penderita anemia, lebih sering disebut sebagai kurang darah, kadar sel darah merah

(Hemoglobin/Hb) dibawah nilai normal. Penyebabnya bisa karena kuranggnya zat

besi, asam folat, vitamin B12, tetapi yang sering terjadi adalah anemia karena

kekurangan zat besi.

Beberapa tanda-tanda yang mungkin menunjukan anemia berat pada

seseorang dapat mencakup: denyut jantung cepat; tekanan darah rendah; frekuensi

pernapasan cepat; Pucat dan kulit dingin; kulit kuning disebut jaudince jika anemia

karena kerusakan sel darah merah; mur-mur jantung; penyebab limpa dengan

anemia tertentu; nyeri dada; pusing atau kepala terasa ringan(terutama berdiri

atau); kelelahanatau kekurangan energi; sakit kepala; tidak bisa berkonsentrasi;

sesak napas; nyeri dada serta pingsan (Atika Proverawati,2011).Berdasarkan tanda

dan gejala yang ditemukan pada kasus Ny. F menunjukkan antara tinjauan pustaka

dan kasus memiliki kesenjangan.


87

B. Identifikasi Diagnosa/Masalah Aktual

Interpretasi data terdiri dari penentuan diagnosa kebidanan, masalah dan

kebutuhan. Menurut Rukiyah (2010) gejala-gejala dari anemia dapat berupa kepala

pusing, palpitasi, berkunang-kunang, perubahan jaringan epitel kuku (pucat), lesu,

lemah, lelah, disphagia. Bila kadar Hb < 7 gr/dl maka gejala-gejala dan tanda-

tanda anemia akan jelas (Rukiyah, 2010).

Beberapa tanda-tanda yang mungkin menunjukan anemia berat pada

seseorang dapat mencakup: denyut jantung cepat; tekanan darah rendah; frekuensi

pernapasan cepat; Pucat dan kulit dingin; kulit kuning disebut jaudince jika anemia

karena kerusakan sel darah merah; mur-mur jantung; penyebab limpa dengan

anemia tertentu; nyeri dada; pusing atau kepala terasa ringan(terutama berdiri

atau); kelelahanatau kekurangan energi; sakit kepala; tidak bisa berkonsentrasi;

sesak napas; nyeri dada serta pingsan (Proverawati,2011).

Sesuai dengan data yang dikumpulkan melalui wawancara dan

pemeriksaan yang dilakukan, penulis menyimpulkan bahwa anemia ibu termasuk

anemia defisiensi zat besi. Diagnosa kebidanan yang penulis tegakkan berdasarkan

hasil pemeriksaan adalah Ny. F PIA0 dengan anemia berat. Dimana di dapatkan

kadar Hb Ny. F 4,6 gr/dl. Sehingga antara diagnosa kasus dan telaah pustaka tidak

diketemukan adanya kesenjangan karena diagnosa yang di tegakkan yaitu anemia

berat sesuai dengan tanda dan gejala anemia berat pada telaah pustaka.

C. Identifikasi Diagnosa Atau Masalah Potensial

Perlukaan jalan lahir sudah dapat dipastikan terjadi pada setiap persalinan

yang akan menjadi jalan masuknya bakteri yang bersifat komensal dan menjadi
88

infeksius. Infeksi pada masa nifas adalah terjadinya peradangan pada alat-alat

genitalia yang diakibatkan oleh masuknya kuman-kuman ke dalam tubuh pada saat

persalinan maupun pada masa nifas.Menurut Icesmi Sukarni (2013), menyatakan

bahwa faktor predisposisi infeksi pada masa nifas salah satunya keadaan yang

dapat menurunkan keadaan umum yaitu perdarahan antepartum dan post partum,

anemia pada saat kehamilan, malnutrisi dan kelelahan.

Komplikasi pada masa nifas yaitu perdarahan pervaginam,infeksi masa

nifas, sakit kepala, nyeri epigastrik dan penglihatan kabur, pembengkakan di

wajah atau ekstremitas, demam, muntah, rasa sakit saat berkemih, payudara

bengkak, kehilangan nafsu makan dalam waktu yang lama.

Sebagaimana yang penulis temukan, pada saat wawancara Ny. F

mengatakan bahwa selama hamil tidak mengkonsumsi tablet Fe yang diberikan

bidan dan juga pada pemeriksaan fisik penulis mendapatkan hasil pengukuran

LILA Ny. F sebesar 23 cm. Ini menandakan ibu mengalami malnutrisi. Diagnosa

potensial yang penulis tegakkan berdasarkan kasus yang dialami Ny. F adalah

Infeksi post partum. Sehingga antara diagnosa potensial kasus Ny. F dengan telaah

pustaka tidak terjadi kesenjangan.

D. Perlunya Tindakan Segera atau Kolaborasi

Pada kasus ini antisipasi penanganan segera untuk mencegah terjadinya

infeksi post partum yang diakibatkan oleh anemia, maka perlu dilakukan

penanganan segera. Untuk itu dilakukan kolaborasi dengan dokter dalam

pemeriksaan kadar hemoglobin Ny. F dan didapatkan kadar Hb Ny. F sebesar 4,6
89

gr/dl. Dan juga pemberian obat-obatan, berupa tablet Fe 10 tablet dosis 1x1,

Cefadroxil 500 mg dosis 2x1, dan Obdamin dengan dosis 1x1.

Pencegahan anemia defisiensi besi dapat dilakukan dengan suplemen besi

dan asam folat. WHO menganjurkan untuk memberikan 60 mg besi selama 6

bulan untuk memenuhi kebutuhan fisiologi selama kehamilan. Namun, banyak

literatur menganjurkan dosis 100 mg besi setiap hari selama 16 minggu atau lebih

pada kehamilan. Di wilayah-wilayah dengan prevalensi anemia yang tinggi,

dianjurkan untuk memberikan suplementasi sampai tiga bulan postpartum

(Sarwono, 2010).

Transfusi untuk anemia dilakukan pada pasien dengan kondisi berikut:,

a. Kadar Hb <7 g/dl atau kadar hematokrit <20 %,

b. Kadar Hb >7 g/dl dengan gejala klinis: pusing, pandangan berkunang-

kunang, atau takikardia (frekuensi nadi >100x per menit) (WHO,

2013).

Dan pada akhirnya antara penanganan segera yang dilakukan pada Ny. F

dengan telaah pustaka memiliki kesamaan.

E. Rencana Asuhan

Pada kasus Ny. F dengan anemia berat rencana tindakan yang akan

dilakukanyaitu memberian obat-obatan berupa tablet Fe 10 tablet dosis 1x1,

Cefadroxil 500 mg dosis 2x1, dan Obdamin dengan dosis 1x1, pemeriksaan kadar

Hb, tranfusi darah, pemantauan tanda-tanda vital, memberikan healt education

mengenai gizi ibu nifas dengan anemia.


90

Menurut Elizabeth (2009), penangan dalam anemia yang dialami Ny. F

yaitu pemberian suplemen zat besi serta diet makanan yang kaya akan zat besi

seperti daging maupun sayuran berwarna hijau. Dan juga perlu dilakukan tranfusi

darah, dimana syarat dilakukannya tranfusi darah pada pasien dengan kadar Hb <7

gr/dl atau kadar hematokrit <20 % dan Kadar Hb >7 gr/dl dengan gejala klinis:

pusing, pandangan berkunang-kunang, atau takikardi (frekuensi nadi >100x per

menit) (WHO, 2013).

Selain rencana penanganan anemia pada Ny. F, penulis merencanakan pula

penanganan ibu dalam masa nifas dimana bertujuan agar masa nifas ibu berjalan

dengan baik serta dapat mencegah terjadinya infeksi postpartum dengan

menganjurkan makan makanan yang kaya akan serat serta perbanyak minum air

putih 2,5 3 liter/hari; gizi ibu menyusui, yaitu makan makanan yang

mengandung karbohidrat, protein, lemak, vitamin, mineral dan susu khusus ibu

menyusui; kebersihan diri/personal hygiene terutama daerah genitalia; istrahat

yang cukup dan memberikan support mental kepada ibu. Sehingga rencana asuhan

yang dibuat penulis untuk penanganan anemia pada Ny. F memiki kesamaan

dengan telaah pustaka.

F. Pelaksanaan

Dalam pelaksanaan dilakukan berdasarkan perencanaan yang telah disusun

penulis. Dalam kasus diberikan terapi tablet besi, pelaksanaan tranfusi darah,

mengkonsumsi makanan bergiizi yang mengandung zat besi serta pemeriksaan

kembali kadar Hb.


91

Terdapat kesamaan antara teori dan praktek, dimana penanganan anemia

defisiensi zat besi yang menyebabkan terjadinya anemia berat yaitu dengan

ssmemberikan suplemen zat besi serta diet makanan yang tinggi kandungan zat

besi salah satunya sayuran berwarna hijau. Dan bagi pasien dengan kadar Hb yang

rendah, perlu dilakukan tranfusi darah untuk mengurangi gejala anemianya (Atika

Proverawati,2011).

G. Evaluasi

Setelah mendapatkan asuhan selama 3 hari, dari tanggal 4 sampai 7 Mei

2014 didapatkan hasil keadaan umum ibu baik dan kesadaran kompesmentis,

tanda-tanda vital yaitu Tekanan darah 120/80 mmHg, Nadi 80 kali/ menit, Suhu

36,50C dan Pernapasan 20 kali/ menit, konjungtiva merah muda dan sklera tidak

ikterus, wajah dan ekstermitas tidak pucat serta kadat Hb Ny. F meningkat menj

adi 7,0 gr/dl.

Pada bab pembahasan ini mulai dari pengkajian, interpretasi data, diagnosa

potensial, perlunya tindakan segera/kolaborasi, rencana tindakan, pelaksanaan

sampai dengan evaluasi tidak ada kesenjangan yang berarti dan semua

permasalahan teratasi.
92
BAB V

KESIMPULAN DAN SARAN

Pada tahap akhir pembuatan studi kasus pada Ny. F dengan anemia berat,

penulis dapat menyimpulkan dan beberapa saran untuk lebih meningkatkan asuhan

kebidanan khususnya pada ibu nifas dengan anemia berat yang penulis ambil di

RSUD Raha Kab. Muna.

A. Kesimpulan

Setelah penulis melakukan asuhan kebidanan dengan menggunakan

manajemen menurut Varney pada ibu nifas dengan anemia berat maka penulis dapat

mengambil kesimpulan sebagai berikut:

1. Dalammelakukanpengkajianterhadapibunifasdengan anemia berat

dilaksanakandenganpengumulan data

subyektifdenganwawancaradaripasiendengankeluhanbadanlemas, pusing,

mataberkunang kunang, dan data obyktifdiperolehdaripemeriksaanfisikdan data

penunjang yang diperolehhasilpemeriksaanlaboratoriumyaitupemeriksaan Hb

4,6 gr%/dl

2. Interprestasi data dilakukandenganpengumpulan data

secaratelitidanakuratsehinggadidapatkadiagnosa PI A0, post partum hari ke tiga

dengan anemia berat yang disertaimasalah yang dialamiNy. F adalahkepala

pusing, badan lemas, danmataberkunang-kunang,

sehinggamembutuhkandukunganmoril, informasitentangkeadaanya,

daninformasitentangmakanan bergizi.

93
94

3. DiagnosapotensialpadakasusNy. F dengan anemia berat akan menjadi infeksi

post partum, namuntidakterjadipadaNy. F dikarenakanpasiencepat

mendapatkanpenangananintensif.

4. AntisipasipadaNy. F dengananemia berat yang dilakukanpemberianmakanan

yang bergizi, pemberian Fe 2 x 1 ( 200 mg ), pelaksanaan tranfusi darah

danmelakukanpemeriksaan kembali Hemoglobin.

5. RencanatindakanpadaNy. F

adalahsesuaidengankebutuhanpasienyaitumeningkatkankonsumsi

pemberiansuplemenzatbesi, diet makanan yang mengandung tinggi zat besi,

melakukan tranfusi darah danmelakukanpemeriksaan kembali Hemoglobin.

6. Pelaksanaanpadaibunifasdengan anemia berat

adalahdilaksanakansesuaidenganrencanatindakan.

7. Evaluasipadaibunifasdengan anemia berat setelahdiberikanasuhanselama 3

haridiperolehhasil KU ibubaik , kepalatidakpusing, badantidaklemas,

danmatatidakberkunang kunang, hasilpemeriksaan Hb 7, gr%/dl

8. Pembahasanpadaasuhankebidananpadaibunifasdengan anemia berat

tidakterdapatkesenjanganantarateoridanprakteksehinggatidak memerlukan

alternativ pemecahanmasalah.

B. Saran

Berdasarkan hasil pembahasan dan kesimpulan yang telah diuraikan

sebelumnya, maka penulis ingin mengemukakan saran-saran sebagai berikut:

1. Agar karya tulis ini dapat dijadikan sebagai bahan referensi dan menambah

wawasan pembacanya sehingga dapat membantu dalam proses perkuliahan


95

2. Dengan adanya karya tulis ini kita dapat melihat betapah pentingnya Fungsi

dari pemberian tablet Fe di masa kehamilan.

3. Dengan adanya karya tulis ini para pembaca khususnya mahasiswa dapat

menambah wawasan dan pengetahuan terutama tentang masalah ibu nifas

patologi

dengan anemia berat sehingga dapat memberikan penanganan yang tepat dan

sesuai dengan masalah yang terjadi, sehingga mengurangi angka kejadian

anemia, khususnya pada masa nifas dan angka kematian ibu dapat berkurang.

4. Diharapkan dalam pemberian asuhan bidan dapat mengidentifikasi suatu

keadaan yang dapat mengarah kearah patologi, sehingga dapat mencegah

kejadian yang tidak diharapkan.

5. Sehingga dengan adanya karya tulis ini, bila benar-benar terjadi anemia berat

pada masa nifas (anemia post partum) dapat memberikan penanganan secara

cepat dan tepat.


DAFTAR PUSTAKA

Ashari. (2010). Asuhan Kebidanan Patologi. Yogyakarta, Pustaka Rihana.

Asrinah, dkk, (2010). Asuhan Kebidanan Masa Kehamilan. Yogyakarta, Graha Ilmu.

Astuti, Hutari Puji. (2012). Buku Ajar Asuhan Kebidanan Ibu I ( Kehamilan).
Yogyakarta, Rohima Press.

Bahiyatun. (2009). Anemia Post Partum. Jakarta, Monika Ester.

Departemen Kesehatan RI. (2008). Gambaran-Pengetahuan-Ibu- pada- Masa-


Nifas.html http:// gambaran-pengetahuan-ibu-pada-nifas.blogspot.com.
Diakses pada Tanggal 3 Juni 2014.

Dewi. (2012) Anemia Post Partum.

93
PEMERINTAHAN KABUPATEN MUNA
RUMAH SAKIT UMUM DAERAH
Jl. Sultan Hasanudin No. 6 Raha Telp. (0403) 2521220 2521328 Raha
93611

SURAT KETERANGAN

No. 445 / ID46.C / IX /2014

Direktur Rumah Sakit Umum Daerah Kabupaten Muna memberikan keterangan


bahwa:

Nama : DARMINA

NIM : 2011.IB.0062

Asal Institusi : AKBID PARAMATA RAHA

Telah melaksanakan penelitian sejak tanggal 11 s/d 17September 2014 di Rumah

sakit Umum Daerah Kabupaten Muna.Demikian surat keterangan ini, untuk dapat

dipergunakan sebagaimana mestinya.

Raha, 13 September 2014

Direktur RSUD Kab.


Muna

Dr. Tutut Purwanto

Nip. 19700727 200003 1 006

93