Organic Farming?
produced by
HDRA - the organic organisation
Organic Farming
crop rotation
crop rotation
Organic farmers do not leave their farms to be taken over by nature; they use all
the knowledge, techniques and materials available to work with nature. In this
way the farmer creates a healthy balance between nature and farming, where
crops and animals can grow and thrive.
To be a successful organic farmer, the farmer must not see every insect as a
pest, every plant out of place as a weed and the solution to every problem in an
artificial chemical spray. The aim is not to eradicate all pests and weeds, but to
keep them down to an acceptable level and make the most of the benefits that
they may provide.
Combined techniques
On an organic farm, each technique would not normally be used on its own.
The farmer would use a range of organic methods at the same time to allow
them to work together for the maximum benefit. For example the use of green
manures and careful cultivation, together provide better control of weeds than if
the techniques were used on their own.
use resources which the farmer already has, so the farmer needs less
money to buy farm inputs.
produce nutritious food, feed for animals and high quality crops to sell at a
good price.
Artificial fertilisers and herbicides are easily washed from the soil and
pollute rivers, lakes and water courses.
The prolonged use of artificial fertilisers results in soils with a low organic
matter content which is easily eroded by wind and rain.
Artificial pesticides can stay in the soil for a long time and enter the food
chain where they build up in the bodies of animals and humans, causing
health problems.
Crop nutrition
To produce a healthy crop an organic farmer needs to manage the soil well.
This involves considering soil life, soil nutrients and soil structure.
Artificial fertilisers provide only short term nutrient supply to crops. They
encourage plants to grow quickly but with soft growth which is less able to
withstand drought, pests and disease. Artificial fertilisers do not feed soil life
and do not add organic matter to the soil. This means that they do not help to
build good soil structure, improve the soils water holding capacity or drainage.
The soil is a living system. As well as the particles that make up the soil, it
contains millions of different creatures. These creatures are very important for
recycling nutrients.
Feeding the soil with manure or compost feeds the whole variety of life in the
soil which then turns this material into food for plant growth. This also adds
nutrients and organic matter to the soil. Green manures also provide nutrients
and organic matter. These are plants with high nitrogen content that are sown
as part of a rotation and are dug into the soil when young.
The organic farmer must cultivate the soil at the right time and in the right ways
to provide the best living conditions for the soil life and plant roots.
Choice of crops
Each crop and crop variety has its own specific needs. In some places it will
grow well and others it will not. Crops are affected by;
soil type
rainfall
altitude
temperature
These factors affect how a crop grows and yields. If a crop is grown in a
climate to which it is not suited, it is likely to produce low yields and be more
susceptible to pest and diseases. This then creates the need to use agrochemicals
to fertilise the crop and control pest and diseases.
The successful organic farmer learns to grow the crops and varieties which are
suited to the local conditions. He should grow crops which are suited to his
geography and climate. He should choose varieties which are suited to the local
conditions such as local varieties.
Rotations
Growing the same crops in the same site year after year reduces soil fertility
and can encourage a build up of pests, diseases and weeds in the soil. Crops
should be moved to a different area of land each year, and not returned to the
original site for several years. For vegetables a 3 to 4 year rotation is usually
recommended as a minimum.
Crop rotation means having times where the fertility of the soil is being built up
and times where crops are grown which remove nutrients.
Crop rotation also helps a variety of natural predators to survive on the farm by
providing diverse habitats and sources of food for them.
A typical 4 year rotation would include a cycle with maize and beans, a root
crop and cereals with either of the following;
2. A legume crop where a green manure, which is a plant grown mainly for
the benefit of the soil, is grown (more information about green manures can
be obtained from HDRA).
roots cereal
legume maize /
beans
Composting
Compost is organic matter (plant and animal residues) which has been rotted
down by the action of bacteria and other organisms, over a period of time.
Materials such as leaves, fruit skins and animal manures can be used to make
compost. Compost is cheap, easy to make and is a very effective material that
can be added to the soil, to improve soil and crop quality.
Compost improves the structure of the soil. This allows more air into the
soil, improves drainage and reduces erosion.
Compost improves the soils ability to hold water. This stops the soil from
drying out in times of drought.
Compost can reduce pests and diseases in the soil and on the crop.
Grass cover
Soil
Soil
Ash
Green vegetation
Soil
Manure
Mature vegetation
Compost has many advantages over chemical fertilisers. These provide nutrients
for plants but do not improve soil structure. They usually only improve yields in
the season in which they are applied. Because compost feeds soil life and
improves soil structure, the beneficial effects are long lasting.
There are many ways to make compost depending on available materials and
climate, for example:
Indore method
Bangalore method
Pit composting
Trench composting
Basket composting
Boma composting
Mulching
Mulching means covering the ground with a layer of loose material such as
compost, manure, straw, dry grass, leaves or crop residues. Green vegetation
is not normally used as it can take a long time to decompose and can attract
pests and fungal diseases.
Mulches have several effects on the soil which help to improve plant growth:
Reducing weed growth by reducing the amount of light reaching the soil
Always apply mulches to a warm, wet soil. Mulch applied to a dry soil will
keep the soil dry.
Care should be taken as to the thickness of the mulch applied. Too much
mulch will prevent air flow and encourage pests.
To allow the germination of planted seeds through the mulch, a layer of less
than 10cm should be used.
Green manures
Green manures, often known as cover crops, are plants which are grown to
improve the structure, organic matter content and nutrient content of the soil.
They are a cheap alternative to artificial fertilisers and can be used to complement
animal manures.
Growing a green manure is not the same as simply growing a legume crop,
such as beans, in a rotation. Green manures are usually dug into the soil when
the plants are still young, before they produce any crop and often before they
flower. They are grown for their green leafy material which is high in nutrients
and provides soil cover. They can be grown together with crops or alone.
Green manures:
Weed control
In organic farming systems, the aim is not necessarily the elimination of weeds
but their control. Weed control means reducing the effects of weeds on crop
growth and yield.
Organic farming avoids the use of herbicides which, like pesticides, leave harmful
residues in the environment. Beneficial plant life such as host plants for useful
insects may also be destroyed by herbicides.
Crop rotation
Hoeing
Mulches, which cover the soil and stop weed seeds from germinating
Planting crops close together within each bed, to prevent space for weeds
to emerge
Soil cultivation carried out at repeated intervals and at the appropriate time,
when the soil is moist. Care should be taken that cultivation does not cause
soil erosion.
Weeds do have some useful purposes. They can provide protection from erosion,
food for animals and beneficial insects and food for human use.
Chemical control
Pesticides do not solve the pest problem. In the past 50 years, insecticide use
has increased tenfold, while crop losses from pest damage have doubled. Here
are three important reasons why natural control is preferable to pesticide use.
Artificial pesticides can quickly find their way into food chains and water courses.
This can create health hazards for humans.
Human health can also be harmed by people eating foods (especially fruit and
vegetables) which still contain residues of pesticides that were sprayed on
the crop.
There is also much concern for those people using chemical pesticides. The
products may be misused because the instructions are not written in the language
spoken by the person using them. This has led to many accidents such as
reports of people suffering from severe skin rashes and headaches as a result
of using chemical pesticides. There are an estimated one million cases of
poisoning by pesticides each year around the world. Up to 20,000 of these
result in death. Most of the deaths occur in tropical countries where chemical
pesticides which are banned in Europe or the USA are still available.
Cost
Using natural pest and disease control is often cheaper than applying chemical
pesticides because natural methods do not involve buying materials from the
outside. Products and materials which are already in the home and around the
farm are most often used.
There are a number of harmful effects that chemical pesticides can have on the
environment:
Chemical pesticides can kill useful insects which eat pests. Just one
spray can upset the balance between pests and the useful predators
which eat them.
Insect pests can very quickly, over a few breeding cycles, become
resistant to artificial products and are no longer controlled. This means that
increased amounts or stronger chemicals are then needed creating further
economic, health and environmental problems.
Natural control
There are many ways in which the organic farmer can control pests
and diseases.
Growing healthy crops that suffer less damage from pests and diseases.
Timely planting of crops to avoid the period when a pest does most
damage.
Companion planting with other crops that pests will avoid, such as onion
or garlic.
Companion planting
Identifying pest and diseases correctly. This will prevent the farmer from
wasting time or accidentally eliminating beneficial insects. It is therefore
useful to know life cycles, breeding habits, preferred host plants and
predators of pests.
Using crop rotations to help break pest cycles and prevent a carry over of
pests to the next season.
Through careful planning and using all the other techniques available it should
be possible to avoid the need for any crop spraying. If pests are still a problem
natural products can be used to manage pests, including sprays made from
chillies, onions, garlic or neem. Further information can be obtained from HDRA.
Even with these natural pesticides, their use should be limited as much as
possible and only the safest ones used. It is wise to check with national and
international organic standards to see which ones are allowed or recommended.
Genetic diversity
Within a single crop there can be many differences between plants. They
may vary in height or ability to resist diseases, for example. These differences
are genetic.
Traditional crops grown by farmers contain greater genetic diversity than modern
bred crops. Traditional varieties have been selected over many centuries to
meet the requirements of farmers. Although many are being replaced by modern
varieties, seeds are often still saved locally.
Crops which have been bred by modern breeding methods tend to be very
similar and if one plant is prone to disease, all the other plants are as well.
Although some modern varieties may be very resistant to specific pests and
diseases they are often less suited to local conditions than traditional varieties.
It can therefore be dangerous to rely too much on any one of them.
save the seed of local and improved crop varieties rather than relying on
buying seed from outside the farm every year. Exchange of seed with other
farmers can also help to increase diversity, and ensure the survival of the
many traditional crop varieties which are being lost as they are replaced by
a few modern varieties.
Strip cropping onions and tomatoes to prevent pest and disease attack
As with other resources, organic farmers should try to use water which is
available locally, avoiding using water faster than it is replaced naturally.
The use of terracing, rain water basins or catchments and careful irrigation
The addition of organic matter to the soil to improve its ability to hold water
The use of mulches to hold water in the soil by stopping the soil surface
from drying out or becoming too hot
Animal husbandry
In an organic system, the welfare of the animals is considered very important.
Animals should not be kept in confined spaces where they cannot carry out
their natural behaviour such as standing and moving around in an
inadequate amount of space. However, care should be taken that animals
do not damage crops.
Breeds should be chosen to suit local needs and local conditions and
resources
These factors help to ensure that livestock are more healthy, better able to resist
diseases and to provide good yields for the farmer.
International standards
The International Federation of Organic Agriculture Movements (IFOAM) has
produced a set of international organic standards, laid down by people from
many countries. These give guidelines about what organic farming is and how it
should be practised on the farm.
International standards are also used to help countries set their own standards,
which take into account different farming systems. Many countries have an
organic standards authority which lays down national standards and awards a
symbol to farms which have followed the standards. This symbol then allows
farmers to market certified organic produce. This is important, as it ensures
that people know that the food which they buy is organic.
The main principles of organic farming were laid down by IFOAM in 1992.
To interact in a constructive and life enhancing way with all natural systems
and cycles.
To work, as far as possible, with materials and substances which can be re-
used or recycled, either on the farm or elsewhere.
To give all livestock living conditions which will allow them to perform the
basic aspects of their innate behaviour.
To minimise all forms of pollution that may result from agricultural practices.
To consider the wider social and ecological impact of the farming system.
Organic food is becoming popular in Europe and America. However for food to
be sold as organic it must bear a symbol that proves that it is truly organic. This
is obtained through a certification organisation. This is quite a complex procedure
and is potentially expensive if there are not certification organisations in
your country.
Please contact HDRA for further information about how to become a certified
organic producer.
Further reading
Field Notes on Organic Farming (1994) JW Njoroge. Kenya Institute of Organic
Farming, PO Box 34972, Nairobi, Kenya
Natural Pest and Disease Control (date unknown) H Elwell and A Mass.
Natural Farming Network, PO Box CY 301, Causeway, Harare, Zimbabwe
The aims of HDRA - the organic organisation are to carry out scientific research
into, collate and disseminate information about, and promote interest in organic
gardening, farming and food in the UK and overseas. For more than a decade,
HDRAs international programme has been involved in the support and extension
of sustainable farming practices; supporting research on aspects of tropical
organic agriculture, providing advice and literature on appropriate organic
techniques and providing tree seeds and technical information to organisations
involved in tree planting and research.
i
Acknowledgements
The Gatsby Charitable Foundation gratefully acknowledges the support of the numerous individuals who
contributed time and materials to this publication. From the International Centre of Insect Physiology and
Ecology (ICIPE): Dr Zeyaur Khan, Professor Ahmed Hassanali, Dr Annalee Mengech, Mr George Genga,
Mr Dickens Nyagol, Mr Naphtali Dibogo, Mr Philip Akelo and Ms Esther Njuguna. From the Kenya
Agricultural Research Institute (KARI): Dr Romano Kiome, Mr Charles Nkonge, Dr Francis Muyekho,
Mr Charles Lusweti and Mr Japheth Wanyama. From Western Seed Company Ltd: Mr Saleem Esmail.
From Rothamsted Research: Professors John Pickett and Lester Wadhams. In addition, our thanks go to
Dr Hans Herren and Professor Richard Flavell who pursued the basic concept with enthusiasm.
Susan Parrott of Green Ink conducted the field research and literature review, wrote the text,
supplied the photographs and, together with other members of the Green Ink team, completed the edit,
layout and proofreading. The publication was printed in India by Pragati Offset Pvt. Ltd.
Last, but not least, we thank all the farmers who cheerfully related their pushpull experiences.
Dedication
This paper is dedicated to the late Professor Thomas Odhiambo, founder Director of ICIPE. His vision of
science in Africa has been an inspiration to many and he is responsible for the initial idea that led to the
development of the habitat management technology.
ii
Contents
Page
Foreword v
iii
iv
Foreword
The Trustees of the Gatsby Charitable Foundation have been supporting agricultural research and
development in Africa for the past 20 years. Gatsbys mission is to increase the physical yields of small
farms and the nutritional and market value of subsistence crops in ways that are both valuable to low-
income households and environmentally sustainable. Gatsby aims to achieve this by supporting projects
along a spectrum, from applied research at institute level, through the dissemination of improved varieties
and cropping systems, to adaptive on-farm activities and multiplication of improved planting material1.
Gatsby also helps small-scale enterprise through provision of micro-finance and business development
support2.
The habitat management or pushpull project illustrates how action across the spectrum can lead
to the development of a technology that markedly improves the lives of subsistence farmers. This projects
success owes much to the very high quality of research and the vision, tenacity and determination of the
principal scientists. The close working relationship that evolved between the various partners was another
contributing factor.
Pushpull is just the kind of technology needed to support a uniquely African green revolution,
as called for at the meeting of African Heads of State in July 2004. The participants agreed that efforts to
increase agricultural productivity in Africa must be based on technologies that are more environmentally
friendly and people-centred than those that fuelled the original Asian green revolution. Habitat
management fits well with this concept and is worthy of support by all who wish to see Africas declining
yields and rising poverty levels reversed.
We believe the experiences gained during this project will be of interest to others involved in
agricultural development in Africa and we hope the lessons learned will encourage further innovations in
this challenging field.
1
A review of all Gatsby-funded projects in Africa can be found in the Gatsby Occasional Paper: Raising Yields,
Creating Partnerships: Gatsbys On-Farm Work in Africa.
2
See Building from the Base: The Work of the African Gatsby Trusts for more.
Both publications are available on the Gatsby website (www.gatsby.org.uk).
v
vi
1. Push and pull: plants versus pests
1
The full title of the project is Habitat management strategies for control of stemborers and striga weed in cereal-based
farming systems in eastern Africa. Project funding to date amounts to US$5.98 million, 65% of which was funded by
the Gatsby Charitable Foundation.
A sleeping enemy
Most legumes act as false hosts of striga in that they stimulate germination but do not support growth of the
weed. However, field trials showed that when legumes were intercropped with maize, far less striga was seen
with desmodium than with other legumes such as cowpea, soybean and sun hemp. In addition, desmodium
progressively reduced the number of striga seeds in the soil. Experiments revealed that the desmodium roots
were releasing chemicals that undermined the growth of the weed, a so-called allelopathic effect.
Work to identify the chemicals responsible has been funded by Gatsby, the Rockefeller Foundation and
the Biotechnology and Biological Sciences Research Council (BBSRC) of the UK. The research team have
discovered three new isoflavanone compounds (uncinanone A, B and C) and a previously known isoflavanone
(genistein). They now know that desmodium not only stimulates germination of striga seeds but also inhibits
post-germination growth of the parasites radicle the part that attaches to the host plant. This is known as
suicidal germination and explains why desmodium can actually reduce the number of striga seeds in the soil.
The research work is time consuming. Hassanali at ICIPE reckons it will take another five or six years to
isolate and characterise all the compounds produced by desmodium roots and to understand their roles in post-
germination inhibition of striga.
Nevertheless, the range of
potential applications is broad
and encouraging. Witchweeds
threaten the staple food of more
than 100 million Africans. Of the
23 species prevalent in Africa,
Striga hermonthica is the most
significant, parasitising a range
of crops including maize,
sorghum, millet, rice and
sugarcane.
2000
800
2001
2002
600 2003
2004
2005
400
200
0
a
ba
yo
ga
ia re
ia
o
o
si
or
Ba
i
si
ay
nd
nd
zo
r
um te
Ki
s
n
Te
ig
Ku
Su
hi
Bu
uo
Si
M Bu
ya
Bo
N
ng
Vi
a
om
ch
N
s
Bu
an
Ra
H
Tr
District
Tanzania Katawi
Mwanza
2002
2003
2004
2005
The success of the dissemination tactics grass variety Bana, although many farmers already
employed in the first two districts led the team to grow Napier and can multiply their own stocks.
replicate the system elsewhere. In each new location After the first season, most trial farmers are
the researchers begin by inviting local farmers to a keen to expand their pushpull plots, while field
baraza (public meeting), publicised through local days and informal contacts attract additional local
chiefs, district agricultural officers and church interest. If farmers can show a degree of
leaders. The researchers listen to farmers problems commitment to the project by planting border rows
and explain the benefits of the pushpull of Napier, the project will supply desmodium seed
technology. Based on criteria such as willingness to for the intercrop. In all areas, ICIPE and KARI
experiment, having enough land and cattle, technicians and Ministry of Agriculture staff are
availability of Napier grass and extent of the available to advise and help with keeping records.
stemborer and/or striga problem, farmers are asked The demonstration plots proved to be a
to nominate their own representatives, normally 10 powerful advertisement for the technology and
per district. These guinea pig farmers test the word spread quickly. Despite recruiting additional
technology in their own fields. In exchange, they technicians, the researchers realised they needed to
receive free desmodium or molasses grass seed. In provide more extensive help and support if new
some areas they are also given stocks of the Napier project farmers were to acquire sufficient
Peter Koinange is a respected elder in his village of Wamuini, 10 km southeast of Kitale in Trans Nzoia.
Although there is no striga here, stemborers cause considerable damage and the soils are poor and lack
nitrogen. Koinange was one of the first farmers to host on-farm trials in 1997, when he planted Napier grass
around his maize plot. It was incredible, he remembers. Before, I had to spend a lot of money on insecticide
and fertilizer. Adding the grass meant I could use fewer inputs and still get a better yield. He later added a
desmodium intercrop and established a seed multiplication plot.
Koinange is one of a rapidly growing group of farmerteachers who are spreading the word about push
pull. When he had successfully managed his pushpull plot for three years, he was given a bicycle, a notebook
and a small allowance of KSh750 (about US$5) per month. He visits five farmers every two weeks to give
advice and guidance. Visits and progress are recorded by both teacher and students and regularly reported to
ICIPE technicians.
Training in scientific methods has encouraged farmerteachers to experiment further, equipping them
with new skills so they can expand the range of options they offer to other farmers. For example, Koinange
has experimented with molasses grass, discovering that it not only repels stemborers from maize but also
keeps ticks off his cattle. He has since planted a border of molasses grass around his zero grazing unit and
some of his neighbours have copied the idea.
At first glance, the Gumo family farm in Kiminini (Trans Nzoia) has
little in common with that of the Chapya family, who live in Ebukanga
(Vihiga). The Gumos have 40 ha, keep ten crossbred dairy cows
and earn money by selling milk. The Chapyas, with ten people to
feed, have to survive on only 0.25 ha of land.
Both families, however, have adopted pushpull and have seen
a dramatic increase in their farm output. Due to shortage of
desmodium seed, Livingstone Chapya planted only a small plot
(measuring 35 x 15 m) with the technology but was amazed at the
result. Before, the farm was purple with striga, he says. But after
planting pushpull, I harvested two sacks (180 kg) of maize. I was
only getting a quarter of that from the same area before. He has
since expanded the size of his pushpull plot and feeds the Napier
grass and desmodium to his zebu heifer. He also sells forage when Livingstone Chapya currently has a
zebu heifer but will soon have
he has enough. He no longer has to buy maize or seek off-farm
sufficient forage to support a
work; instead, he can invest time and resources in improving his
crossbred animal.
farm and household assets.
0
zo s
ba
ia re
ria
i
si
or
N ran
Ba
ny
si
ig
om
ay
um te
Ki
ia
Ku
ig
Su
Bu
h
uo
Si
M Bu
T
Vi
ng
M
a
om
ch
Bu
Ra
District
In Suba District, farmers currently produce of the Suba farmers who upgraded his cattle. He
7 million litres of milk per year, far short of the used to keep zebus and obtained a meagre 300 ml
estimated annual demand of 13 million litres. Most of milk per cow per day. With crossbred cows he
cattle are the indigenous zebu type and a major now gets five times as much.
constraint to keeping crossbred dairy cattle is the Sale of desmodium seed is another income-
seasonal shortage and generally poor quality of generating opportunity. This came to light when
available feed. The pushpull technology, adopted the speed of adoption of the pushpull technology
by over 400 farmers in this district, is having a big led to a serious seed shortage. In 2003, with Gatsby
impact. The number of crossbred dairy cattle in funding, ICIPE launched a seed multiplication
Suba rose from only four in 1997 to 350 in 2002 project, and this has now developed into a
(see graph), putting the district well on the way to commercial enterprise (see Chapter 3).
self-sufficiency in milk production. Obinga is one
Asset acquisition
Making the difficult transition from subsistence
farming to earning a cash income allows farmers to
start acquiring assets and so to increase the income-
generating potential of their farms still further.
Accumulating assets also gives farmers some
insurance against hard times or for when family
needs arise. For example, Samuel Ndele, who lives
on a 1.2 ha farm in Ebukanga, Vihiga, was
experiencing diminishing maize yields due to the
combined effects of stemborers, striga and
declining soil fertility. When he heard about push
pull on Tambea na majira he thought it might help
him. He tried it and was delighted when he
harvested twice as much maize from his first plot
than he had previously. With the money he earned
from selling Napier grass and maize, he bought a
sow and fed her on maize and desmodium forage.
When she farrowed, he sold all six piglets and
Napier grass being sold by traders (KSh50 per bundle)
on the roadside in Luanda, western Kenya. bought a zebu heifer and a new roof. Now that he
100
50
0
1997 1998 1999 2000 2001 2002
Year
has plenty of forage, he can return more of his crop them to livestock. Zero grazing units are an
residues (and the manure from the pigs stall) to the excellent source of farmyard manure that farmers
soil, improving the fertility of his farm. This year can use to enrich the soil either by applying it
he hopes to build a bigger house and next year he directly or using it to make compost. Many apply
will buy a crossbred cow. Now every year gets farmyard manure to their Napier grass, which
better instead of worse, he says. grows faster allowing more frequent harvesting.
Improving soil fertility is especially important in
Safeguarding the environment Trans Nzoia, where non-pushpull farmers have to
Many farmers comment on the beneficial effects of use inorganic fertilizer and pesticides if they are to
the habitat management technology on soil fertility, obtain a reasonable maize yield. Farmers like the
soil erosion and soil moisture. In addition, the Wangombes and the Gumos have discovered that
improved availability of forage allows them to with pushpull they can get sizeable yields without
return crop residues to the soil instead of feeding adding chemicals.
Monocropping and the use of chemical
inputs are strongly correlated with the loss of
biodiversity. By introducing a mixture of crop
species into the farm environment and reducing
the need to use pesticides, this project reverses that
trend. In addition to increased numbers of natural
enemies of stemborers, researchers found
significantly more beneficial soil organisms in
maizedesmodium fields than in maize crops
alone. Reducing the use of pesticides and inorganic
fertilizers has important benefits for human and
environmental health and, of course, releases
farmers cash for other purposes. Another benefit
with far-reaching implications is the ability of the
system to improve livelihoods on even very small
farms. This has the potential to reduce human
pressure on the land, thereby slowing human
Sale of piglets and, eventually, milk will allow Samuel migration to the cities and to marginal or
Ndele to continue to invest in his farm and improve his
income over the longer term. protected areas.
1
The work in Tanzania is funded by the Maendeleo Agricultural Technology Fund.
It is important to emphasise that the high and Fertility (TSBF) Programme2 has revealed that
labour inputs for establishing the Napier border the gross margins of pushpull can be greater than
rows and desmodium intercrop are a one-off, while those of other striga control strategies. The
the benefits continue for many years. Hence, the scientists studied combinations of desmodium,
benefit-to-cost ratio is likely to increase as time soybean or sun hemp and local maize or imazapyr
goes on. herbicide resistant (IR) maize, developed by
A collaborative project between ICIPE, the CIMMYT. IR maize has a low dose (30 g/ha) of
International Maize and Wheat Improvement imazapyr herbicide added as a seed coat to
Center (CIMMYT) and the Tropical Soil Biology herbicide-resistant maize. The herbicide attacks the
striga seedling before or at the time of attachment
to the maize root and any imazapyr not absorbed
by the maize seedling diffuses into the soil, killing
non-germinated striga seeds. The various options
were tested with or without fertilizer.
The results showed that pushpull with local
maize and no fertilizer gave the best return. Adding
fertilizer is inappropriate in dry areas since drought
frequently affects crop growth and the investment
cannot be recovered. The high gross margins of
pushpull are related to the low input costs, since
Napier and desmodium are perennial crops and,
once planted, provide income for several years.
Christian Were is one of the farmers
comparing these options. Although she found that
a combination of pushpull with IR maize and
fertilizer provides the best control of striga, her
preferred option is to grow local maize in a push
pull plot. With this system I dont have to buy
fertilizer or seed, she explains. And I get more
Christian Were (pictured with Dickens Nyagol from ICIPE), maize when I plant a desmodium intercrop than I
is testing various crop rotations together with IR maize and
the pushpull technology on her farm in Siaya District. do with the other legumes.
2
TSBF is a programme coordinated by the International Center for Tropical Agriculture (CIAT). This work was not
funded by Gatsby.
As they start to be adopted, new technologies often began clamouring for seed, creating a serious
encounter obstacles, some of which may have been shortage. Although the Kenya Seed Company was
unforeseen at the outset of the project. Hurried importing seed from Australia, the price was high
dissemination, without first addressing these and availability limited. Gatsby responded by
obstacles, may lead to failure. For example, providing additional funds for a seed
desmodium is labour-intensive to establish since the multiplication project. Initially, this was
plot requires frequent and thorough weeding if the implemented by informal groups of farmers, who
emerging seedlings are not to be overcome by planted desmodium bulking plots primarily for the
weeds. Until farmers have seen desmodium seed harvest. The activity proved lucrative, with
seedlings growing, they cannot tell the weeds from seeds fetching a high price in the market between
the crop. This is where visits to Mbita Point and US$15 and 20 per kg.
help from farmerteachers prove invaluable. The The quantities produced, however, were
high incidence of HIV/AIDS in some areas is rather small and in 2003 Khan sought help from
another factor contributing to shortage of labour. the private sector. He approached the Kitale-based
Here too, farmerteachers or farmer groups may be Western Seed Company to undertake commercial
able to help by mobilising support within the local seed production through contracts with local
community. farmers and community groups. The initiative
began with 300 farmers in Bungoma and Trans
The need for seed Nzoia, who were trained in seed production and
As word spread about desmodiums ability to preparation and given 250 g of seed each to
suppress striga, farmers throughout the trial districts multiply (see box overleaf ).
Harvested desmodium
seed before (left) and
after on-farm processing.
Western Seed undertakes to buy the harvest pockets. Esmail believes that, by raising farmers
from all its contract farmers. It then cleans the seed, out of poverty, his company can lead them into the
checks germination and viability, and packs and cash economy so that they become tomorrows seed
stores the seed. In 2004 the number of contract buyers.
farmers increased to 450 and, by the end of 2005, Linking a commercial seed company with
there should be over 700 farmers involved. While numerous small-scale farmers can cause logistical
the company currently sells most of its packaged problems, which is why the scheme is restricted to
seed to ICIPE (for distribution to new project only two districts at the moment. ICIPE is
farmers), after 2005 it hopes to sell seed on the currently covering the cost of seed inspection and
open market. In conjunction with ICIPE, the certification, which are required by law and
company has started a promotional scheme, conducted by the Kenya Plant Health Inspectorate
whereby a 100 g pack of desmodium seed is given Service (KEPHIS). Once seed production is on a
away with every purchase of a bag of hybrid maize purely commercial basis, it will benefit farmers to
seed. This scheme could reach up to 3000 new
farmers each year, considerably expanding the
market for desmodium seed. Sufficient information
to enable farmers to adopt the technology and
make contact with Western Seed and/or ICIPE will
be included in the package, together with
suggestions for contacting local farmerteachers.
Although busy with his own maize
development programme, Saleem Esmail, Chief
Executive of Western Seed, was keen to assist
because he was convinced of the benefits of the
habitat management approach. But did it make
good business sense to become involved? Yes,
probably there will be long-term benefits, he
replies cautiously. There is an element of risk. In
fact, profitability is not the immediate reason for
his involvement. There is a need to address the
whole sustainability of farming in Africa, he
continues. We cannot sell to farmers who have no Saleem Esmail, Chief Executive of Western Seed
cash first we have to help put money in their Company.
A cow named Zawadi (meaning gift) represents Joseph Litunyas aspirations for the future of the farm he
shares with his parents and five brothers. Since adopting the pushpull technology, his family have not only
doubled their maize yield but also satisfied the criteria for the local Rural Outreach Programme (ROP), which
helps farmers without cash or access to credit to acquire a crossbred dairy cow. Zawadi is 75% Ayrshire, and
when she calves, Litunya hopes she
will give over 6 litres of milk per day,
which will provide the family with
much-needed income. As a farmer
who would otherwise have had no
opportunity to obtain a crossbred
cow, Litunya is only too glad to help
someone else in his situation by
offering them his first in-calf heifer
and sharing his knowledge of dairy-
ing with them.
Litunya has also helped found the
Busia Farmers Group, which is
helping all its members to acquire
crossbred dairy cows. Registered
with the Ministry of Social Services,
this formal group has better access
to credit and development funds than
Thanks to a plentiful supply of forage grass and a home-built zero individuals, and the members may
grazing unit, Joseph Litunya has met the criteria for a livestock have better status with schemes such
scheme that provides crossbred dairy cows to farmers who lack the as ROP. In time, the members also
required cash or credit. hope to win a contract for commer-
cial production of desmodium seed.
The story so far is one of success. Thousands of if real improvements in rural livelihoods are to be
Kenyan farmers have adopted pushpull and most achieved. This action ranges from strategic research
have experienced impressive gains in their food (building knowledge), through applied research
security and incomes. The research team and the (developing new technologies), to adaptive on-
farmers they have worked with have learned much farm research (fine-tuning technologies to local
about plant and insect chemistry and the principles conditions) and to scaling up and out (involving
that underlie environmentally friendly pest control. intensive programmes to educate farmers).
Constraints to adoption have been identified and The pushpull project provides a good
strategies for addressing them have been devised. illustration of the need to base new agricultural
The key question now is how widely can the technologies on sound science. Detailed knowledge
technology be applied elsewhere in Africa? of the chemical mechanisms responsible for the
Experience shows that out-scaling of projects in pushpull effect helps to ensure the continuing
African agriculture is difficult and requires efficacy of the system and allows it to be adapted to
considerable investment of time, money and other new situations. As Pickett says: Science-based
resources. Local adaptation is also essential if new solutions are more robust. Understanding the
technologies are to reach their full potential in underlying mechanisms means that if the
different areas. technology ceases to work, we will be able to find
The pushpull technology is flexible and can out why and take appropriate action. Knowledge
be successfully adapted and introduced to new also gives researchers and farmers confidence to
cropping systems and agro-ecologies. Habitat experiment further with the technology.
management options can be developed and fine- Linking the science with the results is a
tuned for a range of cereal crops, while introducing deliberate feature of many Gatsby-funded projects,
the genes that code for stemborer-repellent and and one that other donors find attractive. Indeed,
striga-inhibiting chemicals into food legumes could the habitat management project has secured
extend the reach of the technology still further, to significant funding from sources other than Gatsby,
areas where striga affects food security but where including the UKs Department for International
few people keep livestock. Perhaps most Development, the Rockefeller Foundation and the
importantly, the technology points the way to a Global Environment Facility of the United Nations
much broader approach to IPM than previously Environment Programme, among others.
attempted an approach that sets pest and disease
management in the context of the health of the A flexible agenda
whole agro-ecosystem. In 1994, when Gatsby began supporting research
on maize stemborers, pushpull was little more
From science to impact than a promising idea in the minds of an informal
When Gatsby began supporting agricultural global network of chemical ecologists. That it has
research in Africa 20 years ago, the prime objective now become mainstream thinking in several
was to alleviate hunger by raising the yields of key national research systems is due in large part to the
crops through the transfer of existing technology to freedom enjoyed by the scientists involved to
farmers fields. However, action across the whole pursue new research directions as these arose and
research and development spectrum is still needed in particular the links between the environmental
Training in scientific
methods has helped Mary
Rabilo (pictured with
ICIPE technician George
Genga) to develop her
own forage ration for dairy
cows, which contains
ground maize and dagaa
(small fish from Lake
Victoria) mixed with
chopped desmodium leaf.
She has evaluated
different combinations of
ingredients and
developed a mix that
costs less than bought
concentrate feed, yet
gives a higher milk yield.
1
www.un.org/apps/sg/sgstats.asp?nid=1010
2
www.unmillenniumproject.org
ISBN 1 901351 53 X
The Organic Farmer
The newspaper for sustainable agriculture in Kenya Nr. 6 Sept./Oct. 2005
Dear farmers,
As you can see we have additional pages in
this issue of our newspaper. We have
made a double issue for September and
October. We are taking a break for one
month in order to reflect on what we have
already done. This period will give us a
good opportunity to go out and meet as
many farmers as possible and hear their
views. It will enable us provide better
service to you. We also will use this break
to streamline the distribution of the paper
and ensure it reaches farmers in every
corner of the country. The aim is to
empower them with the relevant
information on agriculture and organic
crop and animal production in particular.
We are so disappointed that some of the
people we have entrusted with the
responsibility of passing on the copies of
The Organic Farmer to fellow farmers
have not done so. Instead we have at times
Dairy goats are becoming popular with many farmers, page 4,5 found the copies stacked in an office. This
is sad taking into consideration the
number of farmers who are calling us
Fighting the potato disease daily, requesting for copies of the
newspaper. One cannot understand why
New approaches are being used to control these people would not like farmers to
issues. But all the copies were sent out benefit from this useful information. Are
bacterial wilt and to increase to farmers. That's why we decided to
production of clean potato seed. give farmers once again the most they not happy when farmers are
important tips they can apply to enlightened? Farmers, if you have not
The Organic Farmer control the disease. (See page 12). received a copy, approach the chairman of
Apart from the disease we your group and ask him why your copy for
In the May and June issues of The the month is missing!
Organic Farmer, we gave you tips on mentioned that the country faces an
how to control the devastating potato acute shortage of clean potato seed Going by the response we are getting
bacterial wilt. Following the story, for sale to farmers. daily from the farmers, demand for the
many farmers have written to us newspaper is higher than we are able to
requesting for copies of the two Positive selection meet. We will have achieved our objectives
To address this problem, the in information dissemination if every
government with assistance from the farmer who gets a copy of the paper is
International Potato Centre (CIP) and willing to share it with a neighbour, discuss
the German Technical Cooperation the content, may it be an important tip on
In this issue (GTZ) is using two approaches. One how to control a particular pest, where one
of these is to use selected farmers could get seeds for a particular fodder crop
Natural pesticide across the country to produce clean or even how to prepare farm yard manure
Diatomite is a useful powder that seed for sale to other potato growers.
The other is to train the potato in the right way.
controls pests. Page 2
farmers on positive selection of As we have mentioned many times, the
Farmers bank healthy potatoes in their farms, which responsibility of improving agricultural
Sacco are a souce of cheap credit for they are encouraged to use as seed the productivity in the country falls squarely
rural farmers. Page 3 following season. The method has on the farmers themselves. We will do our
been found to increase the overall best to provide you with the relevant
The saviour of cabbage yield by about 50 per cent. The two information to help you improve organic
A wasp stops destruction of cabbage approaches could greatly reduce the agricultural production.
by Diamondback moth. Page 8 spread of the disease while increasing
potato yield for farmers. The Editors
2 The Organic Farmer Nr. 6 September/October 2005
MY OPINION
By John Kariuki
The powder that kills pests
Are we Kenyan farmers serious Diatomite is an effective powder for pest substance to each ton of maize, barley,
with farming? I doubt it! If you control, its deadly to insects and completely buckwheat, wheat, oats, rice, rye,
want to find out yourself, just harmless to animals. sorghum or mixtures of these grains
walk to the small garden behind directly after harvesting. Coating the
your house. Chances are that The Organic farmer grain's outside surface can be done
your bean or vegetable garden is when the grain is being moved into
overgrown with weeds. It sounds Diatomite is a powder made up of storage.
very good to blame the fossilized microscopic plants called Diatomite is ground and graded for
government and urge it to diatoms. The plants once lived in the various uses, which include filtration in
support agriculture. Or to blame oceans and lakes, which covered much beer industry. It is also used for the
the extension officers and the of the world in prehistoric times. Today same purpose in sugar syrup making,
Non-governmental organisations they remain as deposits of soft porous water, fruit juices, swimming pools and
staff for sitting only in their offices white rock. In Kenya the African lubricating oils among others. And you
instead of visiting you. Do not Diatomite Industries Company mines can find it in toothpastes and plastics.
rely on them, depend on yourself! diatomite at Kariandusi near Gilgil and Following strict rules on use of
It is up to us farmers to work Soysambu. chemicals in agricultural produce
hard. In this way you and your This porous white rock is pounded to exported to European Union markets
families will move forward. extremely fine powder, consisting of
millions of small particles which have
John Kariuki is farmer in Nakuru very sharp edges. If you would see
diatomite under a microscope, its
The Organic Farmer particles resemble broken glass. How
does diatomite work against insects,
Nr. 6, September/October 2005 and why is it deadly to them? This is
The Organic Farmer is an easy to explain. Most insects have a
independent newspaper for the waxy outer shell covering their bodies.
Kenyan farming community. It When diatomite's sharp edges come
promotes organic farming and into contact with an insect or a parasite,
supports discussions on all aspects of the protective coating is pierced,
sustainable development. The causing the insect to dehydrate and die.
Organic Farmer is published This makes diatomite an excellent and
monthly and distributed free to totally natural pest control, with no risk
farmers. of chemical damage to animal tissue. in the last few years, Kenyan companies
The reports of The Organic Farmer By rubbing the dust into an animal's growing flowers for export to this
do not necessarily reflect the views coat, it can be used as a control for market are increasingly turning to
of ICIPE. fleas, lice and other external pests. diatomite for pest control. According
When used correctly, diatomite is to Rogers Oluchiri, the sales and
The Organic Farmer is sponsored by effective against ants, aphids, marketing manager at Diatomite
BioVision, a Swiss based foundation bollworm, salt marsh caterpillar, Industries, one of the major customers
for the promotion of sustainable cockroaches, maize worms, earwigs, for diatomite is Home Grown-Kenya, a
development. houseflies, fruit flies, leaf perforators, flower company based at Naivasha
www.biovision.ch leaf hoppers, lygus bugs, mites, pink which is now using diatomite for pest
boll weevils, red spider mites, slugs, control.
Publisher snails, termites, Japanese beetle (grub Even Su Kahumbu who is answering
International Centre of Insect stage) and many other insects. the farmer's questions in The Organic
Physiology and Ecology (ICIPE) Farmer is using diatomite. She is
P.O.Box 30772, 00100 Nairobi Useful for stored maize applying it on her animals and
KENYA Australian and American farmers have vegetables. Diatomite can be mixed
Tel. +254 20 863 2000 for decades relied on diatomite to with water and sprinkled over the
e-mail: icipe@icipe.org control pests in both cattle and plants. vegetables.
homepage: http://www.icipe.org The very strict US health laws do not
require products containing the Available and cheap
Editors substance to carry a warning, but one In Kenya diatomite is on the market
Peter Kamau, Peter Baumgartner should avoid breathing in diatomite under the name KensilF. Phillip Sudi,
Secretariat dust. of the quality control section of
Lucy W. Macharia Diatomite, a naturally occurring Diatomite Industries, says the KensilF
Advisory Board siliceous sedimentary mineral grade of diatomite is specifically suited
Dr. Bernhard Lhr, ICIPE compound, is relatively unknown in for agricultural application. A
Dr. Nguya Maniania, ICIPE Africa. Not even in South Africa do the Kilogramme of KensilF goes for Ksh
Dr. Fritz Schulthess, ICIPE farmers know about Diatomite, even 20. For trade enquiries farmers
Address though the country boasts some top interested in buying diatomite should
The Organic Farmer quality diatomaceous earth, all of get in touch with the company:
P.O.Box 14352, 00800 Nairobi which is mined in the Northern Cape.
KENYA Diatomite can also be used as a natural African Diatomite Industries Compay.
Tel. 020 445 03 98 preservative for protecting stored P.O. Box 32 Gilgil, Tel.050-4015209 or
e-mail : info@organickenya.com grains. You apply 3 kilos of the 050-4015209
The Organic Farmer Nr. 6 September/October 2005 3
Sacco loan has improved our farm
Co-operative societies are beneficial to farmers' produce. In addition to the
farmers. In this issue we provide an produce which guarantees a certain
example of the Mathira Co-operative amount of money regarded as shares,
Sacco. farmers may also choose to increase
their shares by depositing them in the
By Eric Lumosi Asiligwa bank.
Mzee Zacharia Kanyotu is a small Credits
scale farmer whose life has greatly All Sacco members are entitled to
improved thanks to loans he received loans. These may be given out to pay
from the Savings and Credit Co- for school fees, improve farms, and
operative Societies (Saccos). "If it was repay debts, capital to start a business
not for the loans we receive from the or to buy assets. In the Mathira Sacco
co-operative societies, we would not branch alone, the total loan given out
be able to send our children to school, for 2005 amounted to Ksh 5.1 million.
developed our homes, pay for un- "We have been having cases of
foreseen urgent needs or improve our defaults where farmers defect to other
farms", he says. Co-operative Sacco groups without re-
Mzee Kanyotu is one of thousands paying our loans", complained Mr
farmers in rural Kenya who has seen Githinji. He said this was a big hitch in
the benefits of Saccos. For farmers in the development of the bank.
the rural areas, hard cash is normally However, a debt collectors' group has
difficult to come by except through been formed to follow up on those
ventures like these. Saccos are a who default. Alternatively, those who
concrete process of fighting against guaranteed for the loans will be
poverty by developing the hidden and required to re-pay the loans
non-productive financial resources of themselves. According to Mr Wamae
the rural populations. Saccos provide Wanjau, the Baricho Farmers Co-
financial self-help to its members who operative Society accountant, "the Co-
eventually learn to tap their potential. operatives Law Act does not allow one
to join two societies at the same time.
90'000 members This is a punishable offence with up to
For over 30 years, Nyeri Farmers two years imprisonment or a fine of
Sacco has served the farmers in Nyeri Ksh 50,000. When farmers default due
District making a big difference in to bad weather which results in poor
farming. As a result, Karatina is harvest, the farmer will be given an
recognised for its agricultural indefinite time to re-pay the loan".
achievements. The society which
started in 1974 as a union banking Management
section of Nyeri District Co-operative The Saccos are managed by the
Union was transformed to a farmers themselves. They hold an
cooperative society in 1998. "This was annual general meeting to discuss
done specifically to mobilise savings matters arising from the running of
for its members", said the operations the societies. A team of 60 delegates
bank manager Karatina branch, Mr. are elected to spearhead the running
George Githinji. The other nine co Karatina town which is the main of the societies. These then elect
operative branches include: Nyeri, branch. within themselves nine directors who
Mukurweini, Othaya, Ruringa, Mwiga, The Nyeri Farmers Savings Society run the Saccos. They arrange and
Naromoru, Nanyuki including boasts of hosting over 90, 000 organise several meetings through out
members in all of its branches. A lot the year and do not earn a salary for
Saccos to be regulated of water has passed under the bridge their work. Instead, they receive a
In Kenya there are more than 4200 since its conception. Now it has a high seating allowance. "The elected
Saccos, controlling about Kshs110 capital base and a share value of over delegates must meet certain criteria.
billions in members savings and shares. 50,000 members who pay Ksh 100 This includes having shares
There has been no adequate framework membership fee. "At the moment, the amounting to Ksh 50,000 in value.
or legislation to safeguard member's society is stable and has assets such as Without proper management, the
savings and stop mismanagement. As a buildings and land which appreciate in society may end up splitting and
result the Ministry of Cooperative value", Mr. Githinji said. forming other societies. At one time
Development and Marketing is working The Sacco serves coffee farmers, tea we only had one Savings and Credit
on Sacco societies regulatory bill, which farmers, dairy farmers, businessmen Society serving the big Mathira
is currently at the drafting stage. The bill and women, and other small co- Division, but it was split into 13
is intended to regulate Saccos and operative societies. These include the different societies", said Mr Githinji.
ensure they are well managed to serve Baricho Farmers Co-operative Society, "Sacco has to work competitively to
members and protect their savings. It is Kiama Farmers Co-operative society, attract farmers", he adds.
expected that if regulatory mechanisms Mathira Farmers Co-operative Society
are put in place Saccos can move higher among others. The co-operative Savings in the club are foresight's granary
and provide long term financing. (TOF) societies specifically help in marketing and drop by drop, palm wine fills the canary.
4 The Organic Farmer Nr. 6 September/October 2005
2 ft
6 ft Wiremesh or
Hay
Wood offcuts
rack
Water
bucket Feed box outside
outside outside to Head space
to prevent prevent
in wiremesh
soiling soiling
Ramp Feed boxes
Ramp in outside
2 ft 8 ft Droppings pit
2 ft
Ground level Ground level
8 ft
6 The Organic Farmer Nr. 6 September/October 2005
Nothing left to harvest: Infested cabbage Cabbage crop 2 years after releasing wasps (Photos courtesy of ICIPE)
The Organic Farmer Nr. 6 September/October 2005 11
Continued from page 10 the wasps were released in November Climate change
enemies), which are a major feature of 2003 and data collection will begin
Integrated Pest Management. The soon. Uganda was also the second a threat for Africa
project commenced with a survey in country in Africa to have a second
the major cabbage growing areas in natural enemy released - the Cotesia Climate change threatens to increase
Kenya, Uganda and Tanzania, which plutellae, which is appropriate for the number of the world's hungry by
showed that existing enemies were not semi-arid areas. reducing the area of land available for
providing a big enough impact in farming in developing countries, a
control of the Diamondback Moth. KARI takes over report of the UN-Agriculture
ICIPE therefore imported an exotic Rearing, release and monitoring Organizations says. "In some 40 poor,
parasitoid, a parasitic wasp (Diadegma activities are now in the hands of the developing countries, with a combined
semiclausum), already being used in a Kenya Agricultural Research Institute population of two billion, including
number of countries in South East (KARI) Muguga Biological Control 450 million undernourished people,
Asia (Taiwan, Indonesia, Mainland Station. Several districts in Kenya have production losses due to climate
China). The wasp stings the benefited from the release of the change may drastically increase the
Diamondback Moth larvae, lays its wasps, mainly Meru, Nyeri, Embu, number of undernourished people,
eggs, which hatch into larvae, which Maragua, Kiambu, Naivasha and parts severely hindering progress in
feed on the internal organs of the of Nakuru and Nyandarua. combating poverty and food
moth causing death. The wasp's larva In most situations, the released insecurity".
pupates in a cocoon inside the loosely parasitoid will completely control the The severest impact was likely to be
pest without any additional activity in sub-Saharan African countries, which
required by the farmer. However, says are the least able to adapt to climate
ICIPE-Scientist Dr. Bernhard Loehr, change or to compensate for it through
"farmers should regularly scout their increased food imports. In Africa are
fields as there are other pests like 1.1 billion hectares of land with
aphids that might require treatment. growing period of less than 120 days.
Spraying against Diamondback Moth Climate change could, by 2080, result in
is only necessary when there is an an expansion of this area by 5 - 8
average of more than two pests on the percent, or by about 50 - 90 million
scouted plants in the dry season, and hectares, the UN-organization said.
more than three in the wet season". Sixty-five developing countries, home
There are a number of neem-based to more than half the developing
products available in Kenya which can world's total population in 1995, risk
be used in organic agriculture and give losing about 280 million tonnes of
a satisfactory control of potential cereal production as a result of
Diamondback Moths and aphids. climate change. (TOF)
Peter Kamau
Once again farmers are harvesting
their maize crop. It is the dream of
every farmer to harvest much more
than they did last year. But this may
not be the case for many of them.
Although the crop may look healthy
while still in the shamba, much of the
crop will be lost due to pest damage
and the rains. Every year farmers A large portion of maize harvested every year is lost to pests and rotting. Photo TOF
either lose a huge portion of their the shelling. The maize should then ensure infestation of the maize does
harvest, not because they did not use be dried in the sun for a further 3 to not occur during storage. Cow dung
the right inputs but because they did 4 days after shelling. Direct sunlight and fresh eucalyptus leaves can be
not harvest at the right time or take kills weevils which have not entered burned to keep away any pests before
the necessary measures to reduce pest the maize grain; the maize should be storage. Granary floors and walls can
damage. turned and stirred to ensure it dries also be plastered with cow dung for
As we have said before in this news- evenly. Drying also helps bring down the same purpose.
paper, losses to farmers always begin the moisture level to 13 %, which is
in the field. The maize crop is the Natural pest control methods
ideal for long term storage of grain.
most affected, due to poor timing and Construction of store: A good store Diatomite: Diatomite is one of the
poor storage methods and facilities should be well constructed. It should most effective of natural pest control
used by farmers across the country. have adequate space for air circula- compounds. It is a natural preserva-
Many farmers tend to leave the crop tion at the base and also on the upper tive that does not affect the quality
too long in the field where rains and part; pests prefer a warm environ- of grain. It is made up of millions of
pests attack the crop even before it is ment and will keep away if the store fossilized microscopic plants, called
harvested. Most of the maize varie- is well ventilated. It is recommended diatoms, which have sharp edges
ties grown at the beginning of the that a store should have 40 to 50 % which pierce insects, killing them. It
rainy season in mid-March and April open space for the stored grain to dry is not poisonous to both animals and
are ready for harvest by October and properly. The store platform should human beings. The Kensil F grade
November. In areas where the crop be raised up to 60-90 cm above the of diatomite is the most appropri-
has been knocked down by wind ground to allow for air circulation. ate (it costs Ksh 350 for a 20 kg bag).
and has come into contact with the Cleaning: Weevils reside in cracks The recommended application rates
wet ground, decay and pest damage in the wood of the store; they can are 3 kg of diatomite to one tonne of
is always faster. Right now, weather remain there until the next harvest. maize, wheat, oats, rice or sorghum.
forecasts indicate that rains will Thorough cleaning is therefore nece- It is applied directly to the grain and
increase in November and December. ssary before fresh grain is stored to mixed with a shovel.Wash off the diat-
This means that farmers who harvest omite and dry the grain before con-
late will lose a considerable portion of Battle sumption.
their crop. against rats Various plants can also be used to
control pests in stored grain. Research
Reducing post harvest losses
Farmers should take the following shows that neem oil can repel The
Apart from wee- Larger Grain Borer. When applied at
measures to reduce losses during vils, rats and
harvest and storage: the rate of 20ml/ kg of maize neem
mice are trou- oil has been found to prevent repro-
Sorting: Before storage, the maize blesome pests
should be sorted out to remove the duction of the LGB and to drastically
that bring huge reduce damage to stored maize. The
cobs that have already been damaged losses to farmers
by insects and mildew (mould). effect of neem oil has been found to
because they eat large quantities
Research shows that sorting can help last for up to 6 months.
of maize especially during storage.
reduce the damage by up to 36 %. Pyrethrum dust (Crysanthemum
Rats can be controlled by use of Cinerari): Flowers can be picked
Drying: The maize should be dried traps and rat poison. Fixing of rat during a hot day and dried in the
for a few days before storage. Drying guards on raised stores can stop shade. They are then crushed into
gets rid of excess moisture which is the rodents from access to the store. powder and mixed with grain. Pyre-
responsible for decay during storage. The rat guards look like a collar thrum powder from plants in general
Shelling: Shelling helps to check fitted around the pole (see photo). are said to reduce pest damage to
pest damage. Since most pests prefer Farmers should take great care when maize and other cereals. Wash the
maize which is still on the cob for easy using rat poison to ensure children, grain and dry before consumption. The
movement. If a farmer has to apply pets and livestock do not come into ashes mixed with grain are known to
pesticides, this should be done after contact with the chemicals. give 4 to 6 months protection.
4 The Organic Farmer Nr. 18 November 2006
Thank you for the SODIS article Photocopies: In the July issue of The
Organic Farmer, we advised farmers
In the last issue of The Organic Farmer, in need of past issues of the newspa-
SODIS Lead Agency KWAHO (Kenya per that we were no longer able to
we published on this page an article Water For Health Organisation) is send them these copies because we
on a very cheap and easy method to implementing large scale SODIS proj- had run out of most of the issues. We
clean drinking water. However, we ects in Kibera and Mukuru slums repeat here that we can still assist
forgot to mention the Website where of Nairobi. Finally, I am pleased to those of you who need the copies
readers can get more information on by making photocopies of the same
inform you that Elgg, the village and sending them to you. But we
this method (www.sodis.ch). One of where I am living in Switzerland cannot do this for free. Any farmer
the scientists behind this water clean- has made several donations for the interested in getting the copies will
ing method saw the article and wrote The Organic Farmer. At the moment, have to buy stamps worth Ksh. 350
us a letter which we reproduce below: several shops in Elgg sell products
put them in an envelope and send it
to us. We will then send the copies
I am pleased to see a nice short at a slightly higher price to collect to you. We can make copies of all the
article on SODIS (Solar Water Dis- money for your journal. Congratula- issues. Give us your full address.
infection) written by Felix Mbitu tion for the very practical informa-
Murimi and published on page 8 in tion published in The Organic Farmer. Contacts: I am producing organic
fertilizer and would like to have a
your journal The Organic Farmer Nr. database of organic farmers located
17, Sept/Oct 2006. We would like to Martin Wegelin, in Kiambu, Ruaka. I am farming 2
thank you for your efforts and the Dept. of Water and Sanitation in Developing acres bananas and am an organic
well written note. On this occasion, Countries (Sandec) Eawag,P.O.Box 611, CH- farmer. Please contact Silas Mwaura,
8600 Duebemdorf, Switzerland
0722 300610.
we would like to inform you that our
Support Programme.qxp 3/29/2006 4:04 PM Page 1
Support Programme
April 06 Page I
Dear Farmers,
Every week, the editors of The Organic production may take up
Farmer receive questions from farmers to 3 years. During this
wanting to know if they can get conversion period, the
markets for their organically grown farmers can still sell their
farm products. The major complaint produce labelled as "In
from most farmers is that they are Conversion" as long as
forced to sell their produce like any they can prove that they
other conventional produce. They feel are under conversion and
that organic foods have health bene- using only organic
fits, and therefore should fetch more farming methods.
in the market because they are of Most other countries
higher value to the consumer. have official standards for
They are right. But the problem of organic farming. The
marketing is a thorny issue for most famous systems are
farmers across the country. This is that of The Soil Associa-
due to the fact that organic produc- tion (in England) and the
tion is a recently accepted mode of International Federation
agricultural production in the of Organic Agriculture
country. Organic produce is cur- Movements (IFOAM).
rently available in small quantities The Kenya Bureau of tion according to the set standards,
and has thus not made an impact in Standards (KEBS) is a Government but it will also assist with price nego-
mainstream supermarkets, green Department has recently printed the tiations and finding good markets for
grocers, farmers markets etc. In addi- Kenya Standards for Organic Food, their produce. To this end, our news-
tion, there are few consumers of which farmers, who want to sell their paper has had long negotiations with a
organic produce, due to lack of produce as organic have to comply number of market outlets in Nairobi
awareness about the benefits of with. who have expressed willingness to
eating healthy foods, as well as the In order to get fresh produce buy the produce. These include
limited availability of the organic inspected in the field and to be able to Nakumat, Fresh N'Juicy and Kengeles
products. label it "organic", as we also men- chain of restaurants. In future we plan
On the other side, the traders and the tioned in the January issue, the to find more buyers of organic
customers too are in a difficult situa- company EnCert has been formed to produce as the farmers show serious-
tion. Those who are more health con- work as an inspection and certification ness in the venture and increase their
scious are often willing to pay higher body to help farmers to prove to their volumes
prices for food that can be trusted to customers that - yes indeed - this
cabbage or those tomatoes for Farmers' commitment
be natural and without any poisons or
artificial chemicals added. The only instance, have indeed been grown Farmers' groups participating in this
problem so far is: How can they be organically. EnCert has its own label programme will be required to make
sure that the products they are buying which can be used by farmers once their own transport arrangements for
are organically produced? And how certification has been approved. Use of the delivery of their produce to the
do farmers prove that their products an EnCert label will prove to the cus- buyers. We expect the farmers' groups
are organic? Organic produce often tomer that the labelled product is to exercise the utmost care to ensure
looks like any other vegetable or garanteed to be organic. that the products are of high quality
fruits,, or milk or meat. It probably and meet all the requirements of
TOF initiative
tastes a lot better, but consumers organic production. Farmers must
The inspection process has its costs as show a high degree of honesty, trust-
would not know this until they get you can read on the following page.
home and put it on the table. worthiness and transparency. The
And here, our one-year-old newspa- integrity of the system established will
Proof is needed per is launching "The Organic Farmer ensure that the produce is acceptable
To be able to sell their products as Support Programme". As part of its to the buyers. Any farmer found to be
organic, farmers need to prove to the first anniversary gift to farmers, The cheating in the production process, for
buyers that it is indeed organic. This is Organic Farmer (TOF), together with example by using chemicals, will
where the issue of certification comes the Swiss foundation BioVision, has cause their entire group to be disqual-
in. Farmers wishing to sell their arranged to support 10 farmer's ified from the project.
produce as organic have to undergo a groups in the country to help them get The newspaper will arrange a train-
process of inspection by an estab- certification for their organic produce. ing programme for participating
lished certification company. They This capacity building initiative will be farmers' groups to ensure they are
will then be issued with a certificate a milestone for the organic movement familiar with all the procedures of pro-
showing they have complied with all in Kenya. duction and certification requirements
the requirements of organic produc- Not only will TOF help the 10
tion. To convert a farm into organic farmers' group start organic produc- continued on page II
Support Programme.qxp 3/29/2006 4:04 PM Page 2
Support Programme an initiative of The Organic Farmer sponsored by April 06 Page III
Dear farmers,
One year ago, in April 2005, we started
The Organic Farmer newspaper.
When we consider the feedback from
the farmers, mainly through letters,
SMS, e-mails, and field visits, we can
confidently say that the newspaper is
playing an important role in the
Kenyan agricultural sector and in
organic production in particular.
The production of a newspaper of this
nature is a demanding task. However
we are happy to note that the interest of
the thousands of farmers who rely on
the newspaper for information is what
motivates us to apply ourselves and
work even harder in its production. It
also gives us the inspiration to research
It is difficult to replace top soil once swept away by run-off water. (TOF) for more relevant information that
addresses the problems facing Kenyan
Prevent soil erosion now farmers. In other words, we can say
that the newspaper is "farmerdriven".
In our May issue, we are going to give
Soil erosion takes away the topsoil is prevention of soil erosion. Erosion
you an insight into the achievements of
which contains organic matter takes away the topsoil; this is the
and other nutrients essential for most fertile soil that is suitable for
the newspaper and the way farmers
plant growth. agriculture because it contains
want it to appear in future. This will be
organic matter and the essential
done after going through the question-
The Organic Farmer nutrients that help to promote plant
naires which most of you have already
growth. When the topsoil is washed
sent back to us.
"A nation that destroys its soil Like any other serious publication,
destroys itself". This statement from away, the land becomes less produc-
tive and the ability of the remaining
The Organic Farmer has the responsi-
former US President Franklin D. bility of addressing the problems that
Roosevelt in 1937 is still relevant to soil to retain water is also reduced.
face its readers and finding ways to
Kenyan farmers today. Every year Take conservation measures solve them. From the time we started
millions of tonnes of highly produc- Most farmers do not use any soil con- the newspaper, farmers have com-
tive soils are washed away by rains servation measures in their farms. plained that they are not able to sell
and even wind. Poor soil manage- their organic produce. After research,
ment by farmers can lead to poor The Organic Farmer launches an
we discovered that what the farmers
crop yields. Research shows that initiative to assist farmers groups lack is certification to show that their
erosion on a slope can carry away up in certification and marketing. produce meets all the conditions that
to 10 tonnes of soil per acre of slope see insert are required to qualify as "organic".
in a year. Right now, many farmers With support from BioVision, the
have already ploughed their land in This is one of the factors that has con- Swiss Foundation, that supports this
readiness for planting, but one area tributed to the declining productivity newspaper, we have decided as a kind of
they may not have paid attention to of land in many parts of the country. birthday gift, to help farmers in this
Soil erosion is the most serious threat important area: we will assist selected
to soil fertility in all farming areas. groups to become certified as organic
in this issue Soil erosion actually starts during the producers in order to help them market
dry season. This is a time when most their organic produce.
Banana Production 2&3 of the land is left bare after the vege- Moreover, the newspaper has found a
Tissue culture bananas give more tation dries out. Strong winds then number of reliable buyers of your
yields and are disease free. take away much of the topsoil. organic products. In the inside pages of
Organic fertilizers 5 Farmers should therefore ensure that this issue, you will find the details of
A range of natural fertilizers the land is always covered after har- The Organic Farmer Support Pro-
suitable for a organic farm. vesting to stop soil loss through wind gramme.
erosion. After ploughing the land We thank all our readers for their
Agroforestry 8 also, the top soil is loose, which trust in the newspaper and are looking
Fodder tree crops have many makes it vulnerable to erosion (see forward to the success of the new ini-
advantages for a farmer. page 4). tiative to help Kenya's organic farmers.
2 The Organic Farmer Nr. 12 April 2006
MY OPINION
By Richard Koech
The best banana planting method
Many of us are preparing to plant Farmers should ensure they use tious, should be spread as the top
now. A bit of planning can help save disease-free planting material layer to make a basin around the
us a lot of time and money. A clever such as tissue culture varieties. plant.
farmer should by now have decided Use good suckers
The Organic Farmer Banana plants should be planted at
the best crop to grow for the season
considering the size of his land, Banana is an important horticultural the beginning or during the long
weather conditions and the market. crop, providing food and income to rains. In the prepared hole, dig a
He also keeps proper farming Kenya's small- scale farmers. It does central hole about 2 feet deep. Firm
records showing how much he well in most of the agricultural areas the soil around the plant by pressing
spent to buy inputs last year and in Kenya with a rainfall of at least with the feet. The young plants have
what he got in return. Apart from 1000 mm per year and temperatures to be watered regularly as bananas
meeting our food requirements, of 28 c the plants require sunlight. need plenty of water for proper
what we grow should also earn us Shaded areas should be avoided. growth.
some additional income to meet our Banana plants should be planted on Farmers are advised to use tissue
other financial commitments. If it sites that are sheltered from the wind culture bananas obtained from estab-
does not, we should be able to look because heavy banana bunches are lished nurseries (see next page).
for other crops that meet these However, sword suckers from exist-
easily knocked down by the wind.
needs. ing plantations that are disease-free
The plants require deep, fertile and
Richard Koech, farmer in Nakuru well-drained soils. The soil should can still be used. The suckers should
contain organic matter as well as be 1 to 1.5 meters tall. The leaves and
The Organic Farmer nitrogen, potassium and magne- roots should be cut off, especially in
sium. dry weather. A thin layer of the corm
The Organic Farmer is an independent (lower stem) can be peeled off to get
newspaper for the Kenyan farming Planting site
rid of weevils or nematodes. Farmers
community. It promotes organic Land that has been left fallow for at
can split the banana lower stem and
farming and supports discussions on least a year is ideal. The ground
plant the slices. These should be
all aspects of sustainable develop- should have a gentle slope. Steep
covered with loose soil.
ment. The Organic Farmer is pub- slopes, rocky areas and waterlogged
lished monthly by ICIPE sites should be avoided. In windy
and distributed free to areas, agro-forestry and fruit trees
farmers. The reports of The should be used as windbreaks to
Organic Farmer do not nec- reduce plant breakage.
essarily reflect the views of Land preparation
ICIPE.
The bush should be cleared and
The Organic Farmer is sponsored by debris removed from the field and
BioVision, a Swiss based founda- composted. Compost is a source of
tion for the promotion of sustain- organic manure for banana plants.
able development. Since the banana roots are soft, soil Top soil mixed with
manure or compost
www.biovision.ch depth should be approximately 60
cm (2 ft). The preparation should be
Publisher done during the dry season.
International Centre of Insect Hole preparation
Physiology and Ecology (ICIPE) The spacing between plants and
P.O.Box 30772, 00100 Nairobi rows depends on the type of bananas
KENYA being planted. For medium size
Tel. +254 20 863 2000 bananas, spacing of 3 by 3 metres is
e-mail: icipe@icipe.org recommended. Short varieties such
homepage: http://www.icipe.org
as the dwarf Cavendish require 3 by
Editors 2 metre spacing. In level fields, plant-
Peter Kamau, Peter Baumgartner ing holes should be dug in rows
Secretariat along straight lines while on sloppy
Lucy W. Macharia land; holes can be dug along the
Advisory Board contour lines.
Dr. Bernhard Lhr, ICIPE Planting holes should be 2 feet long
Dr. Nguya Maniania, ICIPE and 2 feet wide, with a depth of 2
Dr. Fritz Schulthess, ICIPE feet. The topsoil should be heaped on
Address one side of the hole and subsoil on
The Organic Farmer other side. Mix the topsoil with 2
P.O.Box 14352, 00800 Nairobi
debes of well-decomposed organic
KENYA
Tel. +254 020 445 03 98 manure. The manure should be thor- Preparation of banan planting holes
e-mail : info@organickenya.com oughly mixed with the topsoil. Plant and planting
the banana plant in the topsoil-
Layout
manure mixture around the roots. Source: A guide to planting bananas in
In-A-Vision Systems(k)
The subsoil, which is not as nutri- the East African Highlands, by ICIPE
Nr. 12 April 2006 The Organic Farmer 3
Tissue culture bananas are productive
This method has produced disease
resistant varieties which are
high yielding and take a shorter
period to mature.
The Organic Farmer
Banana production in the country has
been declining in the past two
decades following the spread of
fungal and bacterial diseases in most
parts of the country. The two most
common diseases responsible for the
decline are the Fusarium wilt or the
"Panama disease", and the black and
yellow sigatoka leaf spot disease.
Sharing of planting material between
farmers is responsible for the rapid
spread of these diseases.
To counter this problem, researchers Tissue culture bananas give better yields than conventional varieties. (Photo TOF)
at the Kenya Agricultural Research
Institute (KARI) have now developed These are then grown in special jars rial. One plant can produce up to
superior varieties which are more pro- in a disease-free laboratory environ- 1000 seedlings using this propagation
ductive and are resistant to diseases ment. Hormones and nutrients method.
using the tissue culture method. The required for plant growth are then Tolerant to diseases
method involves selection of healthy fed to the young plants to make them Susan Muli, a researcher at theKARI
shoot tips from the existing banana reproduce. The plants are then split station in Thika, says that any variety
varieties which are then cleaned and further, and put in more jars for large can be propagated and multiplied
split into small pieces. scale multiplication of planting mate- within a short period. The transfer of
diseases is not possible because any
Farmer now grows new banana variety contamination of planting material is
destroyed in the laboratory propaga-
Many farmers who have started tissue tiful orchard with more than 150 tion process. Some of the new vari-
culture banana production have healthy banana mats. At his first eties that have been introduced
reaped great benefits from this new harvest in January this year, he got 35 recently are tolerant to the Fusarium
technology. Charles Kimani, a farmer bunches weighing a total of 850 kg wilt. Tissue culture bananas give
from Kibichiku sub-location in Lower which he sold at the price of Ksh 15 better yields than conventional
Kabete in Nairobi is one of them. Two per kg, earning him a total of Ksh bananas. One bunch can produce up
years ago, he and 42 other members of 12,750. He was voted the best farmer to 13 hands weighing between 35 to
the Murimi Mugunda Self-Help for getting the highest yield while 40 kg. Conventional banana bunches
Group were concerned with the using purely organic production weigh between 15 to 20 kg. Tissue
declining production on their small- methods, during the first harvest cere- culture bananas have also a shorter
scale farms. They approached a brations organized by the Africa growing period of 9 months while
number of agricultural institutions to Harvest project early this year. the conventional varieties take 18
train their members on modern pro- To help farmers get good prices for months or so to mature.
duction methods. One of the NGOs their bananas, the NGO has helped Varieties of tissue culture bananas
they approached is Africa-Harvest's farmers set up a marketing company
Chura Tissue Culture Banana Project, The common varieties being produced
called the Teecee Bell Company Ltd., under the tissue culture method are
which is trying to promote commer- which has brought together 200
cial production of tissue culture the Giant Cavendish, Chinese
farmer's groups in Kiambu and outly- Cavendish, Dwarf Cavendish,
bananas among small-scale farmers in ing districts in Central Province. The
the country. Williams, Kampala, Valery, Grand
company was able to sell more 2.5 Nain and Apple, which are ideal for
"They immediately set up a demon- tonnes of bananas during the harvest desserts. Other varieties include the
stration plot in one of our member's season last January. They attend field Uganda green, Ngombe and Grade
farms and taught us how to dig holes, days and agricultural shows where which are good for cooking purposes.
plant and manage tissue culture they sensitise farmers on banana pro-
bananas. The training made a big dif- duction. Climate and soil requirements
ference to the way we used to tend our Bananas prefer a warm climate with
Farmers interested in buying tissue an optimum temperature of 27
bananas. I removed Napier grass from culture bananas can write to the fol-
a portion of my land and put it under degrees centigrade. Rainfall should
lowing address: be at least 1000 mm and evenly dis-
tissue culture bananas."
tributed throughout the year. They
Today Charles Kimani is one of the Africa Harvest, P.O.Box 642 -00621, require deep, well drained loam soils
most successful tissue culture banana Village Market, Nairobi, Tel.020- with high fertility and organic matter
farmers in his village. He owns a beau- 7124083/1/6/5/2 content (see page 2).
4 The Organic Farmer Nr. 12 April 2006
072
of The Organic Farmer. Your maga- When I read issue No.6, it impressed the organic farming commu-
zine has come at the right time when me so much that I wished I had read nity effectively, we would
15
life is endangered by use of so many your back issues. Now I have formed like to create a database of
41
chemicals. Our group as the name two groups of farmers who are very organic farmers in the country.
suggests wants to deal with horticul- We are interested in:
590
much interested in more information
ture. We have already started on organic farming. Please send us -Your names,
growing grafted avocados through through the above address so that we -Addresses, Location,
the assistance of our agricultural can be updated on new farming -Farm acreage,
extension officer. We would like to methods. -Are you an organic farmer?
have a certificate to make sure that
Daniel Misinga, P.O Box 333, To make it easy for you, we have a
our fruits and other crops will get
Nyamira special telephone number: given
into the market especially exporting
above. All the farmers can provide
without problems. How do we get TOF has converted me these information through short mes-
the people concerned here in
I am a farmer in Kiambu, after saging service (SMS). Come on
Eldoret? I am very much interested in
reading the September/October 2005, Farmers, Tuma jibu. Asante.
the Organic Farming and long live
The Organic Farmer. I was overwhelmed by the quality of
Wilson Kamau Maina,Umoja Horti- information it contained. It encour- SMS ONLY
cultural Group, P.O Box 1027, Eldoret aged me very much especially on
goat production and pest control. I We have learnt a lot
Dear Mr. Maina, have decided to keep dairy goat from On behalf of Kamasakwa Intensive
Information on organic certification and now henceforth and also practice Farmers (KIF), I am impressed to say
marketing was covered in our January organic farming. So if possible feed that since we started receiving copies
2006 issue (No.9). We are now in the me with information on the two of The Organic Farmer, we have been
process of assisting selected farmers fields and also be supplying me with able to learn a lot on organic farming.
groups in getting certification. Read the your monthly editions. You are For this reason I am hereby writing
insert for more details. inspiring and helpful people, excel- to request you to send the newspaper
lent partners to the farmers. I will through our own address. I am a
appreciate you response with a big development worker and extension
Give more on dairy goats heart. officer with the Catholic diocese of
We are a group of about 25 who are Samwel K Mathore, Sakima Green Homa Bay and mainly work with
venturing into dairy goat keeping as Valley Farm, P.O Box 211 00222 farmers. The newspaper would be of
a way of fighting poverty. However Uplands much help to me and my group. Let
we don't have enough information us work together.
regarding the subject. We are How can I get copies? George Otieno Okello, P.O Box 362,
informed that you had covered this I work with farmers groups' and
same very well in your issue of Homa Bay
would like to be able to subscribe to
organic farmer No. 6. We will be very
grateful if you supply us with a few
your publication. What do I have to Farmers liked it
do? I would like between 10-20 It was a great pleasure meeting you
copies of that issue to help us gain copies preferably. Thank you. at Brackehurst farm. We thank you
more insight into the kind of project
Soren Green, for being true to your word that you
that we are venturing into. We as a
would send us copies of. I have dis-
group would be very grateful if you P.O Box 547, Kilifi, 0723 100809 tributed them to farmers here in
include us in your mailing list to help
Othaya and Ndaragua and farmers
learn more concerning organic We use it to help farmers have received their first copy with a
farming and sustainable agriculture.
Thank you very much for keeping us lot of enthusiasm. As a matter of fact
I hope you will address my request.
informed and educated about they thought it was a copy of CTAS
Jeremiah Nduyu, organic farming. We are a Commu- SPORE magazine and they are very
P.O Box 112, 20107, Njoro, Nakuru nity Based Organisation in Rongo happy to learn that they have a mag-
working in collaboration with other azine so good and its locally pub-
self help groups to improve soil-fer- lished. They are asking why they
Paper is very helpful tility by using local available never heard or saw it before. I have
Your magazine is extremely useful resources to increase crop yields. We also distributed the questionnaires
and helpful to anyone interested in are kindly requesting you to send us but since this the first copy they are
becoming a skillful and productive more copies of your newspaper at a loss to comprehensively fill it sat-
farmer. Could you please include my through the above address. We need isfactorily but they have assured me
name in the list of the recipients of your cooperation in this task. they will do their best to be as truth-
this wonderful monthly magazine. ful as they can.
Phillip Dande, Chairman FAARP
Eldad Kanyi Macharia, P.O Box 58 Project, P.O Box 03- 40404, Rongo Stephen Waikwa, P.O Box 543,
10306, Kagio philipdande@yahoo.com Othaya
8 The Organic Farmer Nr. 12 April 2006
072
As a follow-up to what you inquired section. There is also another recent As part of our efforts to serve
from me at the seminar, I am sending one (not enclosed) on organic cotton the organic farming commu-
15
copies of two letters dated 24th June management. I shall enquire from the nity effectively, we would
2005 and 20th July 2005. One was to group leaders who receive the news- like to create a database of
41
your secretariat and the other was paper on whether they are working organic farmers in the country.
590
meant for publication in the editorial on written responses to you on issues We are interested in:
raised in the newspaper on matters -Your names,
In Search of Katumani maize affecting our farmers. I shall defi- -Addresses, Location,
nitely impress on them the need to do -Farm acreage,
Thank you for extra copies, due to
that for you to assess the impact of -Are you an organic farmer?
shortage of the rains in this season,
the newspaper. I would suggest To make it easy for you, we have a
there will be no harvests. Please let us
however that on receiving letters special telephone number: given
know of highland Katumani maize
(two or three) from an individual you above. All the farmers can provide
that matures in 100 days and where
acknowledge receipt in order for the these information through short mes-
farmers can buy it.
writer to know they are receiving saging service (SMS). Come on
John Njoroge, 3N Harvest, 0721 your attention particularly on impor- Farmers, Tuma jibu. Asante.
638034 tant issues.
Dear Mr. Njoroge, J. T. Muriithi Simba, SOHGRO
SMS ONLY
The Katumani variety of maize seed is Dear Mr. Simba Where do I buy EM1?
available at Kenya Seed Company stores Thank you for your advice. Your article Thank you for a copy of the Decem-
in Karatina, Sagana and at Simlaw Seeds on organic cotton production will be used ber issue. I find the article on Page 4
near Globe Cinema round-about along very soon. We get dozens of letters from on the benefit from growth activators
Kijabe street Nairobi. It is advisable that farmers from across the country but we very interesting. My compost lasts
farmers buy their seed early to avoid the cannot use them all due to lack of space, about nine weeks to be ready for use
rush during the March- April planting so we keep them for future use. We hope which limits my supply for each
season. you will be patient. season. However, with the applica-
tion of EM it would appear I should
make enough compost manure for
Tick control chemicals not effective Increasing Knowledge use every season. Please let me know
continued from page 5
I recently came across a copy of your
magazine and learnt that they are where I can purchase the stuff (EM)
ticks by their smell. Cattle which are given out to farmers. I came across from in Nairobi..
regularly sprayed with a diluted the August edition while attending Joseph N Nyamai, Chairperson /
extract of any of these plants hardly my regular weekly extension courses Project Coordinator, MARIODEFA
suffer from tick infestation. In addi- offered by our field extension offi-
tion, the extracts are more environ- cers. I am interested in getting The Dear Mr. Nyamai,
mental friendly. Another two plants Organic Farmer since the courses I EM1 is available in all the major town in
that can be used to repel ticks are the attend do not offer all one needs. Is it agro-veterinary shops. Please get in
Gynandropsis gynandra (Kikuyu: possible to get your last year's supply touch with Edward Kamau of Organic
Thageti; Kamba: Mukakai; Kisii: and continue through this year. Solutions P.O.BOX 59843, 00200
Chisaga; Luo: Akeo) and Ocimum Nairobi or Tel: 0733 998 245. He will
Mrs. Pauline Ondiek, P.O Box 92,
suave (Luo: Bwar; Kikuyu: Mukandu; direct you to the nearest distributor.
30215, Kesogon
Taita: Murunde; Kamba: Mutaa;
Masai: Sunoni; Pokot: Chemwoken). A cover to cover success
The smell of these plants drives Please could you put me in your mailing list. I only have your August 2005
away ticks. If they are grown in a issue and have found it enormously informative and interesting, a cover-to-
shamba, especially around a zero cover success. From this one issue we now regularly make and apply the
grazing area, ticks stay away. This is water extract pyre-thrum pesticide recipe. Have you previously written any-
important since ticks are also dan- thing about the same uses and method of preparation for Tephrosia vogelii. It
gerous to human beings. has been very good against aphids on sukumawiki and broccoli here,
It is also known that indigenous although our main problems here arise from the hot, dry weather that brings
breeds such as zebu are able to resist in the red spider mite plaque. How best do we control the pumpkin fly or
tick infestation more than the exotic "dudu" that stings and lays its eggs in courgette gem squash and butternut
breeds (European breeds). So in squash. Thank you and we eagerly look forward to receiving The Organic
areas where smalls-scale farmers are Farmer throughout the year.
not able to control ticks, it is better to
keep zebu breeds or at least cross- Mrs. Rosalie Faull, Mugie Ranch Ltd., P.O Box 30 20321,Rumuruti
breds rather than pure exotic breeds. Dear Mrs. Faull,
Farmers, do you have your own ways of fighting
We are glad to hear that you have tried some of our plant extracts recipes. We plan
ticks? Please share your experiences with us, so to feature Tephrosia vogelii in one of our future issues. As for the pumpkin pest, we
that we can pass it on to fellow farmers! will research on it and give you the answer soon.
8 The Organic Farmer Nr. 10 February 2006
Organic material is made up of many elements, includ- well as causeing root damage as the roots cannot hardens growth, increasing resistance to pests, disease
ing minerals. By recycling these materials back into our breathe. Drought works in reverse, where plants are and frost.
soils, we automatically include the addition of minerals. unable to access soluble minerals due to lack of water. It Calcium(Ca) is needed for cell division, plant growth
Prevention is the key when it comes to mineral defi- is important therefore to take these factors into consid- and balancing nutrient uptake. Vital to the microbes in
ciencies. Mineral deficiencies are quite hard to confirm eration when diagnosing our plants. the soil.
Nitorgen
deficiency
Poor growth. Leaves Soil may be naturally deficient, particularly acid soils, Apply Minjingu rock phosphate.
turn bluish purple poor chalk soils and in areas of high rainfall. Cold
starting from the tips. weather can cause a temporary deficiency.
This deficiency can be
Nr. 14 June 2006
mistaken with
drought, root dam-
age, or nitrogen defi-
ciency.
Phosphorus
deficiency
Leaves turn yellow Most common on light sandy soils or those with low Improve soil structure. Use plant-based
from the edges. clay or high chalk content. potash e.g. comfrey leaves or comfrey liquid.
Growth is affected. Apply well rotted compost or manure, add
wood ash to compost heap (do not add
directly to soil as it is very soluble
Potassium
deficiency
Beans Symptoms Cause Prevention
Lower leaves turn yel- Shortage of available nitrogen in soil can occur on any Build up organic matter levels in soil. Grow
low starting from the soil but is more common on light soils low in organic green manures to reduce leaching of nitro-
tips. Plants are matter and where rainfall is heavy. Cold weather can gen from soil. Grow nitrogen-fixing green
stunted. Flowering or cause a temporary shortage. Wood shavings and similar manures. Apply composted green waste and
fruiting may be woody material added to the soil may cause 'nitrogen animal manures. Mulch plants. Apply nitro-
reduced or delayed. robbery' where soil microorganisms are using up all the genrich organic liquid fertilizers
available nitrogen to help them break down the woody
material first.
Nitorgen
deficiency
Poor growth. Young Soil may be naturally deficient particularly acid soils, Apply Minjingu rock phosphate.
leaves are small and poor chalk soils and in areas of high rainfall. Cold
dark green. Plants weather can cause a temporary deficiency
have short internodes
and reduced branch-
ing.
Phosphorus
deficiency
Leaves turn yellow Most common on light sandy soils or those with low Improve soil structure. Use plant-based
from the edges. clay or high chalk content. potash e.g. comfrey leaves or comfrey liqui
Growth is affected. d. Apply well rotted compost or manure,
add wood ash to compost heap (do not add
directly to soil as it is very soluble
Potassium
deficiency Vegetables Symptoms Cause Prevention
Poor growth. Leaves Shortage of available nitrogen in soil can occur on any Build up organic matter levels in soil. Grow
are pale green, in soil but is more common on light soils, low in organic green manures to reduce leaching of nitro-
brassicas leaves may matter and where rainfall is heavy. Cold weather can gen form soil. Grow nitrogen fixing green
have tints of yellow, cause a temporary shortage. Wood shavings and similar manures. Apply composted green waste and
red or purple. Lower woody material added to the soil may cause 'nitrogen animal manures. Mulch plants. Apply nitro-
leaves are effected robbery' where soil microorganisms are using up all the genrich organic liquid fertilizers
first. Flowering and available nitrogen to help them break down the woody
fruiting may be material first.
reduced or delayed.
Nitorgen
deficiency
Poor growth Soil may be naturally deficient particularly acid soils, Apply Minjingu rock phosphate.
Leaves turn bluish - poor chalk soils and in areas of high rainfall. Cold
green with purple weather can cause a temporary deficiency
tints, but not yellow.
Nr. 14 June 2006
Symptoms first Acid soils. For immediate effect, foliar feed with Epsom
develop on older Magnesium is easily washed out of light soils by heavy salts (available at most chemists ) diluted at
leaves, then spread to rain. Over use of high-potash feritlizers can make mag- 200g per 10 litres of water after flowering.
younger leaves. nesium unavailable to plants Reduce use of potash fertilizer. If pH is too
Leaves turn yellow, high use dolomitic limestone to reduce aci-
although sometimes didty
red, purple, or brown,
between the veins and
around the margins,
whilst the veins
remain green.
Magnssium
deficiency
The Organic Farmer
5
6 The Organic Farmer Nr. 14 June 2006 Nr. 14 June 2006 The Organic Farmer 7
Choosing the right cattle breed
Ronald Nyabuya from Kitale is interested in livestock keep- Friesian, Guernsey or even Jersey. What are their advan- I have formed group We need market
ing. "We want to know how to rear modern breeds of tages and disadvantages compared to traditional cattle?" We are a group of 1800 members who
Dear Farmers,
This is to inform you that I have As part of our efforts to serve
072
Unfortunately, it would be unwise to However, exotic breeds are geneti- already formed a group of 25 members grow French beans in Kamukuywa the organic farming commu-
make a decision based on the financial cally predisposed to produce opti- who have a lot of interest in organic location Kimilili Division Bungoma nity effectively, we would
15
advantages alone, especially when mum yields of either beef or milk, farming. Please do supply us with the District. But the problem is that we like to create a database of
41
considering organic production. I buy- which are far greater than our local newspaper as a group through my lack market for the produce. Please organic farmers in the country.
ing a cow, one must look at the overall breeds and also fetch a better sale price address. I promise to be distributing it assist us get the market for our farm- We are interested in:
590
picture including organic require- when sold for breeding stock or milk to them immediately I get it. ers who are exploited by middlemen
who the buy the produce at around -Your names,
ments, environmental conditions, dis- production. Ideally, a local farmer Paul Muema Kimanzi, P.O Box 263,
Ksh 20 per kilo. I belong to Nama Self -Addresses, Location,
ease resistance, markets for products, would need a breed that will produce Kitui Tel. 0721 691 798
Holstein-Friesian -Help Group with around 20 mem- -Farm acreage,
operational costs and animal manage- like an exotic one but which will be as
Black and white, common in many bers. I attended the organic work- -Are you an organic farmer?
ment requirements. resilient and cheap to maintain as a
local breed. Middle of the road Kenyan dairy herds; major dairy Cattle breeds continued from page 6
shop at ICIPE 2004 and it really To make it easy for you, we have a
Rearing cattle the organic way
crosses of any exotic with native breed breed in the US and most Western helped me in organic farming. I special telephone number: given
Organic standards restrict the routine above. All the farmers can provide
will produce an animal with some countries; largest volume producers request you to assist us get buyers of
use of preventative medicines, the use these information through short mes-
immunity and tolerance of local cli- of milk of any breed. our produce. We need buyers who
of synthetic herbicides, minimum saging service (SMS). Come on Farm-
amount of purchased feed, minimum matic conditions. This would be a can supply us with seeds and buy our
preferable option for a local farmer. It crop at reasonable prize. We have ers, Tuma jibu. Asante.
proportion of forage in ruminant diets
and prohibit the use of certain high will, however, produce less milk than been exploited by a company from
protein feeds. This is to ensure the ani- the exotic breeds. From these crosses, Nairobi called who pay Ksh20/= a SMS ONLY
mals live at optimum health under one can then crossbreed them further. Zebu kilogramme. We also want buyers
The offspring of poor yielding cows who can offer good prices for our know of any donor who can assist us
natural conditions (see page 1). Small local cattle mainly raised for financially or through farming mate-
Healthy animals cost less to care for very rarely produce good yielders. beef. It has less milk than Zahiwal; goats and sheep. Your paper is okay
Another option is that crossbred bulls and contains useful information. We rials give us the contact or make us in
and provide by products that are also has a humped back. It is the touch with any of such organization.
healthy. can be raised for beef. Exotic bulls are Jersey hardiest of all native cattle breeds. do not want to miss a copy. Just pub-
too expensive to raise and grow very Golden brown in colour with a white lish every month. Wish and hope to meet you.
In Kenya we have many diseases
affecting our cattle. Foot and mouth, slowly, as they are not genetically ring around their nose; their milk has Ambrose Majani, P.O Box 70 Benson Maina, Ikinyukia Self Group
Anthrax, East coast fever, Tsetse Fly designed for beef production, if they the highest level of milk solids (pro- Kamukuywa P.O Box 125, S. Kinangop
(Nagana), brucellosis, as well as many are descendants of a diary cow. It teins and minerals) and vitamins, as enyongesa2000@yahoo.com
other tick-borne diseases. Different cli- would be wise to seek advice from the well as butterfat, of any breed of cat- I need back issues
matic conditions also affect the health Department of Livestock extension tle. It is easier to manage than We are selling seeds A friend of mine last month gave me
and productivity of our livestock. services in your area, armed with the Guernsey. I thank you for keeping us in touch a copy of your newspaper and it was
Some local breeds of cattle are more knowledge of requirements for with you and other fellow farmers wonderful. Let me thank you very
resistant to diseases than others. The organic production. Ask for informa- Zahiwal through the TOF newspaper. Also by much for your effort to teach an ordi-
advantage here is that mortality and tion on maintenance and feed require- Large local cattle mainly raised for publishing our article on growing nary man simple and health ways of
veterinary costs are low. Purchase and ments, dipping schedule, and the beef but also used for dairy. Milk pro- purple vetch. We are now selling the farming. Mine request to you is,
sale price of indigenous breeds is breed you choose to keep. It is very duction is average. It has a hump like beneficial seeds to farmers around please put me on your distribution
lower and so too is milk production important to know the cost implica- a Boran. our country. Some come from list and please send me already
compared with exotic breeds. tions before starting, and also to iden- Karatina, Elburgon and as far as issued newspapers and also as you
tify the potential markets for your cat- Kitale. We use the few issues to have distribute to others remember me.
Exotic breeds costs more
tle, milk or beef and even manure! a discussion agenda in our meetings Thanking you in advance.
Exotic breeds require a lot of care and
their maintenance costs are high in Rearing cattle and we have started mobilizing and Joseph K Njeru, P.O. BOX 927,
comparison as they are not adapted to Rearing healthy cattle requires good Guernsey making awareness on organic to EMBU,
local conditions. They succumb to grazing land, or access to healthy for- Closest to the Jersey in the butterfat other farmers outside our group. It is jkinyua@Mungania.ktdateas.com
local diseases quite easily. To reach age, and access to clean fresh water. content of milk; larger and heavier our suggestion if you organize field
their potential yields of beef and milk, You would also require a secure area boned than the Jersey. days on organic farming we may Consider me
their feed needs are greater than native for calves and a milking shed for the Boran reach more farmers also if possible I am an agricultural extension worker
breeds too. They also cost more to pur- dairy animals. Keep in mind that if A local breed, the same size as Zahi- arrange for inter group visits. We use and have lots of interest in organic
chase as well as the costs of their your cow is healthy, your maintenance wal. It is mainly raised for beef both conventional and organic farm- farming. Could you please be send-
semen through artificail insemination costs will be lower. A veterinarian although is also used for milk, and ing methods due to the available ing me a copy of your monthly publi-
services. close to your area is useful, especially will yield more than Zebu. market in our area. If you please cation of the organic farmer maga-
if you are a beginner. Some cattle ill- zines. I will be grateful to be receiv-
Su Kahumbu nesses strike very quickly resulting in Breed Origin Climate Use Size Costs ing a copy of the same.
answers your mortality if not noticed early. Vigi- Holstein
exotic cool dairy large high Grace W Mburu, P.O Box 6, Kiria- Ini,
questions lance will tell you if an animal is ill, Freisian
Muranga
signs of which may be a raised tem- Jersey exotic cool dairy small high
perature or reluctance to feed, drink or Ayrshire
Write to Dual purpose breed, both good milk Guernsey exotic cool dairy medium high Send copies
even stand. It is wise to have a ther- I intend to start practicing organic
The Organic Farmer mometer close at hand. Learn how to production capacity and quality in Ayrshire exotic cool dairy/beef medium high
P.O. Box 14352 terms of butterfat content and milk farming, please send me past and
use this as most animals may not show Zebu exotic hot arid dairy/beef small low future copies of The Organic Farmer.
00800 Nairobi Kenya signs of a raised temperature, which solids. It is easier to manage than Hol-
Tel: 020 445 03 98, 0721 541 590 stein-Friesian and good for small Zahiwal exotic hot dairy/beef large medium
could indicate the need for medical Githinji Muthima, Yes farmers group
e-mail: info@organickenya.com scale farmers. Boran exotic hot dairy/beef large medium P.O Box 162, Subukia.
attention.
8 The Organic Farmer Nr. 14 June 2006
072
your effort to make us more knowl- munity services are happy to have the organic farming commu-
nity effectively, we would
1
edgeable in farming, keep it up. I received several copies of the organic
like to create a database of
541
came across your March issue farmer newspaper January 2006
through a neighbour, after reading a issue. Thanks a lot and there materi- organic farmers in the country.
We are interested in:
590
topic on seeds I was really impressed als will strengthen our sustainable
because we only rely on local ones agriculture component in training -Your names,
called 'moshi'. If the shops do not and sensitizing our farmers in this -Addresses, Location,
have genuine labels as we saw in the semi arid area of Kenya, as the coun- -Farm acreage,
picture then we do not buy the seeds. try goes organic in farming. This is an -Are you an organic farmer?
Already I have sent a letter to the assurance that the information and To make it easy for you, we have a
western seed company and the lot experiences will be disseminated to special telephone number: given
number I planted. With this remarks the farmers and be of help. Thanks above. All the farmers can provide
I say thank you for enlightening the again for being associated with you. these information through short mes-
farming community. My group We need more support and collabora- saging service (SMS). Come on Farm-
through you will benefit. Thank you. tion in terms of material and experi- ers, Tuma jibu. Asante.
Mark Otieno Owuor, P.O Box 45, ence sharing.
Homabay Tel. 0735 691140 John Mutua, For Director UCCS SMS ONLY
email: uccsack@swiftkenya.com
Copies not enough We use newspaper to
Thank you for the farmers' newspa- Learning new methods
per you sent to our group. Please we teach farmers
The Multi-plant International Medic-
would like to have more copies for I am very glad when writing this let-
inal Conservation is a community
our group and other groups because ter for the work you are doing for us.
project with 30 members. We came
when we received them all the 24 I am a volunteer field educator in our
across your November 2005 issue and
member wanted but only 5 members group but you have made our work
the farmers were very much inter-
received the copies you sent. easier because we get some of the
ested in the information it contained.
Presently we are training farmers in details from the organic newspaper
We request you for monthly copies of
our location. Each of the blocks and our member are happy for that.
the newspaper to enable our farmers
require copies of the newspaper to Secondly, as you can see in the fig-
learn new agricultural methods. P.
update their skills. Please send us ures we have given in the question-
Your assistance will be so useful to
more copies, preferably 200 copies. naire crop yields are not very high
this community.
Later we will provide you with a list because we are in a semi arid area at
of farmers who have received the Joannes Samikwo, P.O Box 50 30201, the border between Nyeri and
copies. Endebess Laikipia. So we need additional
Evans Konjae, Obwanchani youth Let us work together advice on crop production and live-
group, P.O Box 18, Karota. stock keeping.
We thank you very much for your
The members are grateful for the
Black ants ... continued from page 6 wonderful and educative agricultural
work you are doing to educate them
magazine that we received for the
the problem is disastrous, one can first time last month through V.I on new farming methods.
spot spray the aphid with a Agro forestry project in Kitale. The Haron Mwangi Gichama,
pyrethrum based spray. I like Nabwami Community Based Organi-
pyrethrum, as it breaks down within zation (NACOBAO) is a non-profit Nairutia Primary School,
hours and does no damage to mam- organization operating in Machewa P.O Box 175, Mugunda Via Nyeri
mals. Alternatively, you can sprinkle Location, Saboti Division in Trans-
the aphids with diatomite; this will Nzoia District. It is an umbrella of 24 I have received copies
not kill them immediately, however self help groups drawn from the
and they may still walk off, spread- Division. The organization has 275 Thank you very much for your quick
ing viruses until they die. The sharp registered members, A chairman, sec- response in sending me 50 copies of
crystals of the diatomite shred the retary and treasurer have been The Organic Farmer. I got them in
bodies of the aphids, causing them to appointed from amongst the mem- good time and in good condition.
lose their body fluids and leading to bers. These officials run the activities I can assure you that they are being
eventual death. If the problem is not of the organization on a day-to-day put to good use and will be read by
severe, look around for ladybirds on basis. We therefore request for part- many farmers in the various groups
your other crops and transfer them to nership and a monthly supply of The in my location. I hope that we will
your plants with aphid problems. Organic Farmer Newspaper for each continue to receive this publication
Ladybirds feed on aphids; however it group. Your assistance in this matter and other information that can be of
is their larvae that do most damage to will be highly appreciated. assistance to our farmers.
aphid. The larvae of the lady bird
beetle is small an speckled black and David Were Masibo, Chairman, Chief Joseph K. Mutai, P O Box 69,
white. email: nabwaids@yahoo.com Kaptagat.
8 The Organic Farmer Nr. 13 May 2006
MY OPINION
Any food that contains essential
Disease remains in crop residue
nutrients such as vitamins and min- There are many methods,
erals, promotes our health and the including crop rotation, to reduce
general well-being of our families. the spread of grey leaf spot disease.
Many farmers know this fact but
they ignore it. Despite being the pro- Dr. Z. M. Kinyua
ducers of very nutritious farm prod- It is estimated that the grey leaf spot
ucts, very few farmers rarely con-
(GLS) disease can cause yield losses
sume the products. Instead they
take them to the market for sale. For of between 30 to 50%. Higher yield
example, it is common to find a losses have been recorded in other
farmer selling all eggs and milk, countries, where the disease has had
leaving none or little for their mal- a longer existence. The level of leaf
nourished children. They will then damage caused by the disease and
buy a kilo of sugar, soap and other the resulting yield losses are higher
household items which they think when the fungus attacks maize plants
are more important. Of course, we early in the growing cycle.
need the money, but let us take care Unfavourable environmental condi-
of our families' health first. tions also contribute to its develop-
Michael Barasa, farmer Bungoma ment. Severe levels of the GLS dis-
ease are particularly prevalent under
The Organic Farmer prolonged conditions of high relative An infected maize leaf. (Photo TOF)
humidity (which is common under
The Organic Farmer is an independent cloudy, misty weather conditions) Duma 41, and SC Simba 61 have been
newspaper for the Kenyan farming reported to have some tolerance to
and moderate to high temperatures.
community. It promotes organic the disease. These varieties may be
farming and supports discussions on These conditions encourage rapid
multiplication of the fungus, thus tried in areas where the problem is
all aspects of sustainable develop-
ment. The Organic Farmer is pub- leading to the development of the common. In the meantime, sound
lished monthly by ICIPE disease. management of crop residues is seen
and distributed free to Early recognition as part of an integrated approach
farmers. The reports of The The earliest noticeable symptoms of against this disease.
Organic Farmer do not nec- grey leaf spot are small yellowish Destroy crop residues
essarily reflect the views of dots which are the size of a pin-head The fungus that causes the disease
ICIPE. on maize leaves. Slightly advanced mainly survives within infested
The Organic Farmer is sponsored by symptoms include small, necrotic maize crop residues on the soil sur-
BioVision, a Swiss-based founda- (dead), pale brown or yellowish- face. Removal and destruction of
tion for the promotion of sustain- brown wounds that are largely rect- such residues after harvest would
able development. angular in shape and generally run therefore help to kill the fungus, thus
parallel to the leaf veins. The wounds reducing the level of disease during
www.biovision.ch subsequent cropping seasons. Crop
may have a whitish-grey cast over
them. This happens when the fungus rotation is also very important. Fac-
Publisher
that causes the disease has matured tors that favour the development of
International Centre of Insect
Physiology and Ecology (ICIPE) to produce spores. Such spores, the grey leaf spot disease include
P.O.Box 30772, 00100 Nairobi which act as seeds for the fungus, are over-crowding of plants with poor
KENYA easily dislodged and carried by wind air flow and low sunlight penetration
Tel. +254 20 863 2000 to cause new infections on leaves. among plants, improper soil nutrient
e-mail: icipe@icipe.org The development of the disease is and irrigation management, and
homepage: http://www.icipe.org more readily noticeable around the poor soil drainage.
Editors tasseling stage of maize plants. The Farmers unable to identify disease
Peter Kamau, Peter Baumgartner symptoms become more easily recog- Effective management of grey leaf
Secretariat nizable when the leaves become spot requires a concerted effort
Lucy W. Macharia blighted, especially during the later among farmers within affected areas.
Advisory Board stages of crop growth. However, investigations carried out
Dr. Bernhard Lhr, ICIPE Research on control measures by KARI in partnership with CAB
Dr. Nguya Maniania, ICIPE Since the grey leaf spot disease is rel- International have revealed that the
Dr. Fritz Schulthess, ICIPE atively new in Kenya, a lot of vast majority of maize farmers do not
Charles Kimani, Farmer, Wangige research towards its control is being recognize the grey leaf spot symp-
Address planned. Breeding of resistant maize toms on their crops. As a conse-
The Organic Farmer hybrids and varieties is high on the quence, the farmers make little or no
P.O.Box 14352, 00800 Nairobi research agenda of the Kenya Agri- effort to control the disease or even
KENYA cultural Research Institute (KARI). seek more information about it. This
Tel. +254 020 445 03 98 This requires considerable time and lack of information and awareness is
e-mail : info@organickenya.com resources. to blame for spread of the GLS dis-
Layout Varieties such as Kakamega syn- ease in most of the affected maize-
In-A-Vision Systems(k) thetic 1&11, KH634A, H614, SC growing areas in the country.
Nr. 15 July 2006 The Organic Farmer 3
Why don't Kenyan farmers earn enough?
Despite working hard to Because the available land has to pro-
improve their income, Kenyan vide food for an increasing number
farmers face many problems in reali- of people, it is getting overused, and
zing their goals. the soil's fertility and productivity
are declining. As a result, the soil is
Anja Bengelstorff becoming useless for farming pur-
poses, erosion occurs more fre-
Farming is a daily, labour-intensive quently and severely, and the semi-
task, and many Kenyans and Kenyan arid and arid portions of land are
farmers are hardworking people. growing. According to Joseph Kar-
However, according to a Government iuki from Agrisystems, only 20% of
statistic, 87 % of all poor households the Kenyan land is suitable for farm-
live in rural areas, where their main ing today. Furthermore, the rainfall
activities are in agriculture, yet about in Kenya is less available than in our
half of all Kenyans might not have neighbouring countries. He therefore
enough food for their families. We strongly suggests that farmers be
need to take a closer look at how trained in conservation techniques.
farming in Kenya is practised.
The importance of the agricultural and not enough training
sector in Kenya is clear: It provides Another reason why agriculture is
the livelihoods for close to three- not keeping pace with population
quarters of the population, it growth, if not the most important
accounts for 60% of the country's one, is the fact that Kenyan farmers
export earnings and contributes 26% do not consider their profession as a
to the Gross Domestic Product (GDP) business. "Most of them see it as a
directly, plus another 27% indirectly way of life", Joseph Kariuki says.
through linkages with other sectors Another expert, Reimund Hoffmann
such as manufacturing and distribu- from the German Technical Coopera-
tion. During the first two decades tion (GTZ), which promotes the Pri-
after Independence, the economy vate Sector Development in Agricul-
recorded an impressive growth rate ture, agrees. "We have to see the dif-
of 6%, with the agricultural sector ference between farmers and rural
playing the dominant role. However dwellers", he points out. One reason,
this declined to only 3.5% in the both say, is the lack of sufficient agri-
1980s and to even less in the late cultural training, not least in the busi-
1990s and early 2000s, to only 1.3%. ness aspects of farming. Kariuki
What has happened? stresses another point: "Yes, there are
many farmers' groups, but they are
Marketing neglected
scattered and not organised on a
For too long, the experts agree, the higher level. A higher degree of
Government's policies have focused organisation would enable them to
too strongly on producing agricul- better access markets, to negotiate
tural goods, and by far not enough with middlemen from a stronger
attention has been paid on marketing position than individual, uncoordi-
them. This means that vegetables, nated farmers' groups can do. As a
fruits and other crops were produced larger group, they could make bigger
in large amounts, but the farmers investments at reduced costs. They
were not able to find enough buyers. need a stronger voice for their cause."
Talking to farmers all over Kenya, He admits, however, that the funds
TOF knows that this is still one of the are lacking here as well, both on the
biggest obstacles in farming. For a the consultancy firm Agrisystems
Ltd. knows that despite the good side of the farmers and the Govern-
long time, there was not a single ment. Yet something can be done.
expert in marketing in the Ministry of will, however, funds are lacking to
make these plans come true. Kariuki advocates for transforming
Agriculture. It is only recently that the farmer who now pays his or her
the Government took action in this To complicate matters further, the
agricultural sector is currently gov- small annual membership fee to their
regard. In its ambitious "Strategy for group and then leans back, "from a
Revitalizing Agriculture", launched erned by about 130 pieces of legisla-
tion, many of which are obsolete/out mere spectator to an active partici-
in 2004, the Government acknowl- pant" of their farmers' group. If, for
edged the key role of domestic mar- of date, or inconsistent. The issue of
land ownership is another "hot example, they suggest that the fee
keting and promised to give priority should be increased for the purpose
to developing the infrastructure and potato" which needs to be worked on.
of investments for the group, the
to the training of farmers. In addi- Soil quality declining individual farmer will be more inter-
tion, the Ministry of Agriculture now Apart from governmental regula- ested that the money is used respon-
has an Agribusiness Division. tions, the natural conditions in Kenya
Agronomist Dr. Joseph Kariuki from are raising problems for farmers. continues on page 7
4 The Organic Farmer Nr. 15 July 2006
raise the annual growth in the agri- ers' group, please send us (with
cultural sector to 3.1% per annum by
2007 and to 5% thereafter. Every sin- An eye opener sms) your contacts. We shall get
back to you!
gle Kenyan farmer should be I would like to say that a lot has been
involved. done by your efforts on the publica- Tuma maoni yako! Asante.
8 The Organic Farmer Nr. 15 July 2006
072
point... continued from page 5 for your continued effort to educate
us on farming tips. I read The Organic
the organic farming commu-
nity effectively, we would
15
Farmer the first time when I came like to create a database of
essential. Using chemical pesticides,
41
across the Nr. 7 November 2005 issue. organic farmers in the country.
fertilizers, herbicides and other chemi-
We are interested in:
590
cals, results in damage to these I went through the magazine and
microorganisms, thus creating imbal- found it so enriching to us farmers. I -Your names,
ances. It is unfortunate that the solu- read much on Napier cultivation and -Addresses, Location,
tions to these imbalances result in found it interesting and discovered -Farm acreage,
worse imbalances. When land is the disease "napier stunt". I also -Are you an organic farmer?
totally destroyed and considered learned much about soya beans, that To make it easy for you, we have a
worthless it is abandoned. And then soya is very nutritious, especially special telephone number: given
immediately slowly but surely nature when mixed with sorghum, maize above. All the farmers can provide
starts to repair the damage. flour to make highly nutritious ugali these information through short mes-
Some of the microorganisms living in and porridge. Please, we are an orga- saging service (SMS). Come on
the soil include bacteria, which can nized group of 30 members and Farmers, Tuma jibu. Asante.
take nitrogen from the air; these bacte- would like to learn more about
farming from The Organic Farmer.
ria live in nodules on the roots of legu-
Give us more on crop rotation, dairy
SMS ONLY
minous convert it into soluble forms
that plants can use. Beneficial mycor- goat farming, organic fertilizers and tion, Kuresoi Division of Nakuru
rhizal fungi also are attached to the generally on how to improve our District. We read a friend's copy and
roots of plants. They help the plant farming methods. Again, keep up took much interest in it. This is
absorb more water and nutrients and the good work! because we grow cereal crops and
in return the plant provides food for Wilson Kamau, Kakimari Self horticulture. In our area, the
the fungi. These fungi are very sensi- Group, P.O Box 203, Rongai, Nakuru common crops are potatoes, beans,
tive to fungicides and prefer soil that is and cabbages. We have many prob-
high in organic content. ICIPE is helping farmers lems due to fungal and bacterial dis-
Plant nutrients I am grateful to ICIPE and The eases and insect pests. We request
Organic Farmer. The two institutions you to send us monthly copies to
Plants require both macro and
are really working hard to support assist us in our farming. Thank you.
micronutrients. The common
farmers countrywide. It should be Absolom Chebochola, Tegunot
macronutrients are:
well noted that we are facing so Farmers Group, P.O Box 356, Molo
Nitrogen (N) fuels the growth of
leaves and shoots many problems in farming. Some of
Magnesium (Mg)- important in the these are poor markets, expensive We need it for Library
production of chlorophyll labour, sustaining production and I am a Kenyan citizen aged 46, apart
Phosphorus (P)- important for root use of chemicals. I would request the from being a farmer at Stoo Mbili,
growth two bodies to hold regular work- Njoro, I am also the Adult education
Potassium (K)- vital to flowering and shops in our region inorder to officer in charge of Lare Division of
fruiting, also hardens growth, educate farmers on modern methods Nakuru District. One of the objec-
increasing resistance to pests, dis- of agriculture. tives of the Department of Adult edu-
eases and frost. Joseph K. Kinyanjui, PO Box 125, cation is to increase the levels of liter-
Organic agriculture ensures a more South Kinangop
acy in the division through the provi-
or less healthy balanced diet for our sion of basic reading skills and at the
crops. Therefore, the organic farmer Useful for our field school
same time creating a reading culture
generally does not need to be con- On behalf of "Life class" Nyasi farm, I
cerned about the precise levels of plant among the rural farming communi-
request you to send us copies of The
foods in their soils. Following natures ties by encouraging learning as a life
Organic Farmer. Beneficial discus-
example, rather than feed plants sions were witnessed in our last class long process. To achieve this we have
directly, we aim to recycle the plant when we received a copy of the instituted a small resource centre
and animal wastes and feed these to newspaper from a friend; that day's where farmers borrow reading mate-
the soils. Microorganisms in the soil attendance was fair because we had rials. It is for this reason that we
then break down the organic material 22 farmers attending. Please assist request form you reading materials
into nutrients that become available to this group by sending us the newslet- for the center and especially The
plants. The soil structure is also ter. Thank you. Organic Farmer newspaper, which
improved through this process. Bulky John Sprite, Kiminini division, P.O addresses problems facing farmers in
organic feed containing a wide range Box 1781, Kitale the division. We will appreciate.
of essential plant foods and trace ele-
ments is best for the soils. They may be We face pest problems Thank you.
incorporated directly into the soil, or We thank you for starting a newslet- Stephen Mugi Wagathanga,
composted or used as mulch (see The ter for Kenyan farmers. We are a self- Appointed Time 98, P.O Box 760,
Organic Farmer, April and May 2005). help farmers' group in Toito Loca- Njoro
8 The Organic Farmer Nr. 11 March 2006
Dear farmers,
First of all, we would like to wish you
and your families a happy and prosperous
New Year, good health, excellent harvests
and sufficient rains throughout the year.
Finally, the Kenyan economy is slowly
recovering. Since agriculture is the
backbone of the country's economy,
farmers have all reasons to be proud of
having contributed to this recovery. Let us
redouble our efforts! We need to be more
practical in taking up challenges that
confront us in our day-to-day farming
activities. This is the only way we can
solve our problems. We need more action
and less talk. That is the reason why we
are pushing for the marketing of organic
products in Kenya (see pages 4 and 5).
Even though the organic farming sector is
still very young, it has a bright future.
At this time, we are lacking clear
Su Kahumbu's farm is certified as organic information of the potential and the needs
of the organic farming community.
All our readers know Su Kahumbu, the prominent organic farmer from Therefore we would like to ask you for a
Limuru, who also answers questions from you farmers. In mid-December last favour:
year she received the Certification of Registration from Musa Njoka, director First, to get a reliable idea of the
of a Kenyan Certification Company, EnCert. This is a big step for the local number of organic farmers in Kenya,
organic farming community, which is struggling to market their organic please let us know whether you are an
produce, as you can read on pages 4 and 5. (Photo TOF) organic farmer. Simply send us an SMS
(see details on page 7).
Early land preparation important Secondly, in order to do a good job, The
Organic Farmer would like to know what
Many farmers wait until it is too late to stage determines the quality of you as farmers think about our
harvest the farmer will get at the end newspaper. Are you satisfied with the
prepare their land for planting. of the next season. topics we write about? Do you understand
By The Organic Farmer At this time, farmers have plenty of the articles? What kind of articles would
organic material, mainly maize and you prefer or wish to read? Do you miss
In the farmers calendar, the month of bean residues that remained in the
January is important. This is because reading about any topic, technology for
shambas after the harvest. What often instance?
it is just after the harvest when most happens is that farmers release their
farmers prepare the land for the next animals to graze in the farm fields for
To help us improve our services to you,
crop. Proper land preparation at this a short time. Then they burn these we have prepared some questions. The
materials. The burning will be done so questionnaire has been sent to around
that the farms can be ploughed in 800 farmers in all parts of the country.
readiness for the planting season. We will be grateful if those of you who
What farmers might not know is get the questionnaire would fill it as
In this issue that this material is in fact very straightforwardly as possible and send it
essential organic manure that back to us soonest, at least before the end
Poultry keeping supports a lot of life in the soil, such of January. You will not meet any costs
Indigenous chicken can be as worms and microscopic bacteria, because we provide an addressed and
made more productive. Page 3 which help release food for the plants stamped envelope, in which you will put
in a balanced way. the questionnaire and post it.
Fight aphids and cutworms Early land preparation, however, has We thank you all for your cooperation
Diversity on farms takes care of many advantages for the farmer. One and are looking forward to your responses.
the natural enemies and pests. Page 6 advantage is that it loosens the soil, Your proposals will help us to improve
making it easy for the plants roots to our newspaper, to become more involved in
Making your own pesticide penetrate. Early digging also helps the a direct dialogue with you and to cater
Marigold plant extract is an circulation of air in the soil, which is even better for the growing needs of the
effective organic pesticide. Page 8 essential for plant germination and organic farming community.
growth. (See page 2)
January 2006 ver 5.qxd 12/20/2005 9:34 AM Page 2
MY OPINION
By Isaac Maina Munyari
Soil care increases fertility
Proper soil cultivation growing crops from seeds, which are
Have you ever planted crops in a methods can improve its slow to germinate, such as onions,
former cowshed? And what did you quality and productivity and carrots. This is especially so
discover? You got a very nice and where weeds are a problem. Make the
healthy harvest. This is a good By The Organic Farmer seedbed and allow the first weeds to
example for farmers. One can see, Good land preparation practice appear, use a hoe to remove them,
that farmyard manure is very involves taking care of the soil to then plant the seeds you want.
important for soil fertility. A lot of ensure it contributes to increased farm
farmers have a lot of such good Benefits of mulching
productivity. Working on the soil the Manure is best composted before use
experiences. But do we really share right way can improve its capacity to
the knowledge with others? We on the crops. Add bulky plant material
retain water and allow the circulation of such as straw if not already present.
should share information, especially air. Water and warmth in the soil is also
when we are going organic. Up to Fresh manure should not be used
important for plant germination and directly on the soil because the
now, we are a minority in the growth. There are many ways a farmer
country. But things will change. It nitrogen in the ammonia it releases
can prepare their land for planting, but can be harmful to the plants. Fresh
will change even faster if we work each depends on the type of crops they
together. manure can also attract pests. Avoid
are planting and the type of soil they manure from town sewage as it may
I. Maina is a farmer in Subukia. are working on. contain disease causing agents such as
For an organic farmer, it is important parasites and harmful bacteria.
to add organic matter into the soil
The Organic Farmer before preparation of the seedbed.
Mulch is any loose material such as
straw, leaves or dry grass that is placed
Nr. 9, January 2006 Organic matter includes crop around the plant to protect the soil
The Organic Farmer is an residues, green manure and farmyard from over-drying and to control
independent newspaper for the manure. The organic matter should temperatures. Recommended mulches
Kenyan farming community. It be dug into the top layer of the soil are crop residues, dry grass, dry leaves,
promotes organic farming and (to a depth of 15 to 20 cm). dust, old compost and old manure.
supports discussions on all aspects of Take care during cultivation Green vegetation should not be used
sustainable development. The because it takes a long time to break
Organic Farmer is published monthly
Soil cultivation has many advantages
and disadvantages. One of the down and does not allow water to
by ICIPE and distributed penetrate the soil. It also attracts pests
free to farmers. The reports
benefits is that it encourages the
activity of soil organisms; it also helps and fungal diseases.
of The Organic Farmer do Mulch in the proper amount is used
not necessarily reflect the
to reduce evaporation and penetration
of the water into the soil. Weeds and after a seedbed is planted. Too much
views of ICIPE. mulch prevents adequate airflow and
soil pests are controlled with good
The Organic Farmer is sponsored cultivation while soil hardening, encourages pests such as termites in
by BioVision, a Swiss based caused by previous cultivation is dry areas, or fungal disease. Mulch
foundation for the promotion of repaired. only in the dry season and apply it two
sustainable development. Soil fertility can be affected by weeks after seedlings develop.
cultivation methods used. Therefore Mulching has many advantages. It
www.biovision.ch farmers need to take care to ensure helps decrease water loss through
there is minimum disturbance of the evaporation. It results in increased
Publisher soil life during cultivation. Working water retention and keeps the soil
International Centre of Insect on the soil will always affect its cool and moist. Soil temperatures are
Physiology and Ecology (ICIPE) structure in one way or another. In maintained and erosion is minimised.
P.O.Box 30772, 00100 Nairobi Africa for example, continuous There is increased presence of useful
KENYA cultivation speeds up the decaying of microorganisms in topsoil as a result
Tel. +254 20 863 2000 organic matter, which can lead to loss of organic matter while weed growth
e-mail: icipe@icipe.org of essential nutrients needed for plant is reduced.
homepage: http://www.icipe.org growth. Cultivation leaves the soil If possible farmers should carry out
fragmented and exposed to erosion soil tests to determine the level of
Editors that is why manual cultivation is acidity. If this is not possible,
Peter Kamau, Peter Baumgartner preferred to the use of machinery, as consistent use of organic matter can
Secretariat it does not disturb the soil. Other regulate the level of acidity in the soil.
Lucy W. Macharia methods a farmer can use to improve
Advisory Board the soil are outlined below:
Dr. Bernhard Lhr, ICIPE
Dr. Nguya Maniania, ICIPE Weed management
Dr. Fritz Schulthess, ICIPE The aim of weed management should
Address be to keep weeds under control rather
The Organic Farmer than to eliminate them completely.
P.O.Box 14352, 00800 Nairobi Weeds help form a good mixed
KENYA environment. There are several
Tel. 020 445 03 98 methods of weed control, including
e-mail : info@organickenya.com using a hoe or hands to remove
Layout: weeds. Weeding immediately before
In-A-Vision Systems(k) planting is a useful technique when
January 2006 ver 5.qxd 12/20/2005 9:34 AM Page 3
Marketing
.....continued from page 5
Marigold
must realise that our foot is already in This very useful plant is well
the door. The potential is out there! known all over in Kenya.
The common name is
Awareness campaign Tagetes minuta, because of
Kenya urgently needs an awareness the smell it is also named
campaign which highlights the "stinky weed"
advantages of organically produced Plant parts used: Flowers,
vegetables. There is limited leaves, and roots
knowledge of the benefits of organic
products among local consumers in Mode of action:
Kenya. Nearly all buyers of organic Insecticidal, repellent,
foods live in urban areas and a large fungicidal, nematocidal
percentage are expatriates. There is
need for a serious awareness Although there are no
campaign for local consumers known bad effects on
through the Kenyan media, says Su human beings, clean poperly
Kahumbu, the organic farmer from the untensils before and
Limuru who answers questions from after preparation and
our readers. We have to lobby much applying, wash your hands
more for organic food, declares John and do not have a direct
Njoroge, Director of the Kenya contact with the crude
Institute of Organic Farming extract.
(KIOF). There is a need for stronger
links between the producers and the Materials Preparation How to use Plant pests
consumers. KIOF is already working Fill-in drum with 1/2- Coffee berry
towards this end, and this lobbying Fermented Dilute the filtrate
should be done by KOAN. marigold extract 3/4 full of flowering with water at a ratio disease. Rice
plants. Leave to stand of 1:2. Add 1 tsp blast.Tomato
Andrew Botta has the same opinion. Whole flowering for 5-10 days. Stir blight. Root
He is the co-ordinator of Meru plant Soap, Water, occasionally. Strain soap in every liter knot
Herbs, a company producing organic Strainer,Drum before use. of the extract nematodes
products which is certified by the
British Certification Authority Soil Marigold water Pound the leaves. Dilute the filtrate
Association (see label on page 5). Once extract with water at a ratio Ant
more, consumers demand certified Soak the pounded of 1:2
Mexican marigold leaves in hot water. Aphid
organic vegetables; the pressure leaves, Soap. Hot Add 1 tsp soap in
mounts on the shopkeepers to offer water Mortar and Leave to stand for 24 every liter of the Grasshopper
such food, Botta says. pestle Strainer,Pail hours. Strain. extract
Cooperation needed Marigold/
The situation at present is unclear. tomato extract Add 20 liters of
Grind the leaves. water to the filtrate. Aphid
Many traders take advantage of the
lack of certification. They are selling 1 kg of marigold Add 1 tsp soap in Bean pod
leaves 1 kg of Add enough water. borer
products from anywhere as organic every liter of the
and are therefore cheating consumers. tomato leaves 20 lt Strain. extract. Spray on
of water. Grinder, Leaf beetle
This attitude will soon change due to the target pests.
demand caused by informed Soap, Strainer
consumers. This will finally allow the Marigold and
farmers to get the due respect and chili extract Finely chop the plant Dilute the filtrate
prices for their efforts. and the chilies. with water at a ratio
500 g of whole of 1:2 Most
To get there, farmers, traders and all plant. 10 hot chili Soak them in water agricultural
organisations supporting organic pods. 15 liters of overnight. Add 1 tsp soap in pests
farming need to work together. water. Knife, every liter of the
Sometimes it appears as if these Strain. extract.
organisations jealously try to defend Soap, Strainer,Pail
their positions against each other and Marigold, chili,
miss out the overall interest of the garlic, onion Chop 2 handfuls of
thousands of small-scale farmers they spray marigold leaves, 2
pieces of chilies, 3 Add four times
claim to support. Our paper, The 2 handfuls of amount of water to
Organic Farmer, will continue to gloves, garlic, and 2 Most insect
marigold leaves, 2 large onions. the extract.
provide as much information on these pieces of chili, 3 pests
problems and act as a forum for Place in a pan of Spray or sprinkle on
garlic cloves, 2 water and bring to affected plant parts.
exchange of ideas. We are able and large onions,
willing to work with all the relevant boil. Let it cool.
Cooking pan, Pail, Strain.
interested bodies to achieve this Strainer
objective.
Nr. 20 January 2007
Thank you, J.T. Muriithi Simba, for b) a balanced rotational cropping We need more on plant
your much appreciated comments, to break the pest and disease cycles;
c) proper attention to hygiene
extracts
highlighting some areas I had omitted I am the chairman of the Kaponpon
in my response to Sylvester. Sulphur within the holding to minimize the Youth Group for Sustainable Devel-
is indeed allowed by most, if not spread of pests and diseases. opment. We were happy to read last
all, certification bodies. Our cheapest, Our safest recourse if we choose months newspaper which was the
most natural, and in most cases avail- to use any restricted substance is to first for our group. The paper has
able way of using sulphur is to make ensure that we use adequate record- actually attracted our attentions very
a foliar spray using nettle (thabai) for keeping to prove the application much. Farmers do respond positively
this purpose. This information has rates, dilutions, etc. to the ideas in this newspaper. There-
been mentioned in several editions of Personally, I have never used fore, keep on sending us more copies
The Organic Farmer. any copper salts and chose to grow and if possible increase the number
cherry tomato types that are more in order to reach more members.
Standards are different resistance to blight. However, I do If possible give us more informa-
The use of copper Sulphate and have a farmer in Wangige who is tion on important tropical diseases
copper oxychloride according to currently producing tomatoes suc- and how to treat them with plant
the Soil Association Standards is cessfully using copper oxychloride, extracts because we want to become
Restricted and requires approval and I shall be relying on his records organic farmers. Even we, the Pokot
from the Certification Department which shall be inspected by EnCert people have some herbs that we use
before use. The East African Stan- to assure me and any other organic to control a variety of diseases. We
dards, soon to be enforced, have trader or consumer that he is within also need more information on dairy
conditions of no more than 8 kg/ha the recommended limits. goats.
per year for any copper salts. EnCert
Milk is not always useful Samson Kuyo, P.O Box 211, Kapen-
states the following: Copper salts are
Thank you for the information on guria
also restricted and may be used only
in the case of immediate threat to the study that was carried on milk.
the crops. EnCert further states that I too have used milk and realize it is
coppers salts may be used under the not effective when the disease is in a
following conditions From January progressive stage. I shall do a little
2006 up to 6 kg per hectare per year. research and see whether further
As you can see, different standards statistics from the same study were
allow for different applications. Most found. I also wonder if different dilu-
standards also recommend that pests tion rates of the milk make a differ-
and diseases shall be controlled pri- ence in the spread of the disease, and
marily by a combination of again would like to ask any success-
a) an appropriate choice of species ful organic tomato farmers to share
and varieties; their findings with our readers.
Nr. 20 January 2007
Paper changing
agriculture in Kenya
We are among the beneficiary orga-
nizations that receive The Organic
Farmer magazine regularly here in
Kitale. Information on sustainable
agriculture gained from the news-
paper is now at the fingertips of our
staff. Besides training local commu-
nities, we have also devised a way
through which all partner farmers'
groups get access to the vital infor-
mation through the magazine. We
now have a library where we stock
the magazine; we lend the farmers'
groups each of the monthly issues.
After reading, they return it back Participants attending a training programme on Organic Agriculture Development visit Su
to us and we give them some more Kahumbu's farm in Tigoni. They were drawn from 14 African countries (Photo TOF)
copies. Our librarian ensures that all
new copies have been circulated to all members, I request you to send more of international movements of species
our farmers' groups. copies of the newspaper to our group. of plants and animal products? Is it
To guarantee excellent utilization We are 20 in number. We hope you will posible for ICIPE scientists to estab-
of the newspapers, our staff usually assist us. Thanking you in advance. lish a center of field research here in
make follow-ups to check if the san Pedro del Parana?
Beatrice Nyaga, P.O Box 69, Siakago.
farmers are following the advice as We can discuss practical details of
stipulated in your magazine. I am I need back issues such a venture. Congratulations for
glad to inform you that the influence the nice work you are doing.
of this resourceful magazine is great
for our field school Our telephone numbers for contact
My group is Midzimitsano Farmers
and the impact is overwhelming. It are: +595 742 20151 / +595 975 659202
Field School. I have read the May
has improved not only the knowledge Fr Pascal Kinoti, svd, Coordinator
2006 issue of The Organic Farmer from
and skills of our staff but also the Pastoral Social- San Pedro del Parana
a friend; I am very much interested
production capacity of the farmers. Itapua, Paraguay
in getting copies right from the first
Farmers now are able to formulate
publication. I hope that my request Dear Father Kinoti,
their own botanical pesticides with We will forward your request to ICIPE.
will receive your consideration.
less supervision from our staff in con- Editors
trolling different types of pests and Francis Ngonyo Hinzano, P.O Box
diseases. This has reduced expenses 285, Kilifi Request for newspaper
and increased the profit margin, espe-
We hereby request you for the above
cially for smallscale farmers who for Farmers in Paraguay mentioned newspaper. We are a
decades have not been able to meet
the cost of chemical pesticides. ask for help group of six farmers from Nyambaria
On behalf of the YRREC and the Receive greetings from the district sub-location, North Kitutu location
entire community, I give a lot of credit of San Pedro del Parana Paraguay, Manga Division Nyamira District who
to the farmers magazine, the editor, South America! Im a Kenyan miss- want to know more about organic
sponsors and all other contributors ionary working in Paraguay. I work farming. We came across the Septem-
whose effort has enabled the newspa- with the Pastoral Social promoting ber/ October 2005 issue from a friend.
per to be an important tool in trans- organic sustanable rural farming. We We hope you will be sending us the
forming agriculture in the country. train our members on how to control newspaper on a monthly basis.
Keep sending us copies. pests and weeds without using chem- Nyauncho Nyangena, P.O Box 1165
ical herbicides and pestides. When I Kisii
Moses K. Tenai, Coordinator, Youth was recently in Kenya for holidays,
for Rural Reconstruction and Envi- a friend of mine passed me some
ronmental Conservation, P.O. Box past issues of The Organic Farmer. I
4541 Kitale Tel. 0724 523 676 enjoyed all the topics you write on.
Some four months ago, the field
We want organic agricultural technicians came across
poultry production the problem of stemborer which
affects sugarcane and maize. I was
I would like to thank you for The so delighted on reading about its
Organic Farmer magazine that is very control using the predator Telenomous
educative to farmers. On behalf of isis! How can we get it here in Para-
Kwinyinyia Farmers Field School guay taking into account restrictions
Nr. 21 February 2007
Birds are useful in organic farming Tissue culture bananas. Do you need
organically grown tissue culture
About three years ago, I had to visit bananas as from January 2007? Contact J
a friend in Nairobi. Since it was too G Njoroge 3N-Harvest, P.O. Box 82 Saba
early, I decided to while away the Saba Tel. 0721638034.
time in a local bookshop the first Organic Vegetables: I have organically
time in my life! Of course, on the shelf grown capsicums, butternut, carrots,
were books about agriculture, flowers and courgettes. Interested buyers can
and vegetables. I opened a book and get in touch with me at the following
found something very interesting. I address: Joseph Njoroge, P.O. Box 52542,
read that a pair of blue tits (a type 00100, Nairobi, Tel.0721 647 618
of bird) will collect up to 15,000 cat-
erpillars to raise a brood (raise their Conventionally certified seed: Benjamin
young ones). I also read that birds Lugano, the certified seedling grower
need a place to stay and to build their from Kitale, will be operating a stand
nests, and that the ideal habitat (living at this years Eldoret Agricultural Show
place) for birds is hedges. which opens on February 27. He will sell
Traveling home, I thought about the following fruit seedling varieties to
birds and hedges. Some days later, Blue tit feeding its young interested farmers: Hass and Fuerte vari-
I made some cuttings from a titho- Source: Organic Gardening eties of avocado, passion; Kent, Harden
nia bush somewhere in the corner In January, your newspaper brought and Tommy varieties of mangoes, tree
of my shamba. I planted them, and a series about agroforestry. You wrote tomatoes, oranges- Washington variety,
now, around two years later, I have a about the benefit of fodder shrubs paw paw, apples- ann variety. For details
very nice hedge of tithonia, making like calliandra, so I planted some of farmers can get in touch with him at:
boundaries between different parts theses bushes. Now they have grown Lugano Horticultural Farm Enterprises,
of my shamba. They produce won- into a thick hedge. The leaves I feed P.O. Box P.O. Box 323, 30200 Kitale Tel.
derful flowers, and a lot of birds are to my four cows. They just love the 0733 990 574.
going in and out. Since I read in The leaves of the calliandra, and the birds Articles wanted. Do you have some-
Organic Farmer about the benefits of like these bushes. It is such a nice thing interesting you would like to share
tithonia for composting, I regularly experience to listen to the birds sing with other farmers? From now on, The
cut the leaves and throw them into early in the morning. Organic Farmer will award gift items for
the compost. Phillipp Maina, Karatina every article published. Karibuni.
Plant extracts: safe and cheap For example, there are some varieties
of crops that take a short time to grow.
If you are growing maize, for instance,
When farmers use plant extracts in the soil. Aphids, for example, can it is always wise to select varieties that
pest control, they save money and be easily controlled by use of soapy suit the climate in your area. Last year
protect the environment. watera very simple control measure we met a farmer in the drier parts of
that any farmer should be able to Nakuru who did not harvest anything
The Organic Farmer apply. This is exactly what we are from his maize crop; when we asked
As soon as young plants emerge from trying to tell you on pages 4 and 5. what maize variety he had planted, he
the soil, various enemies often wait There is only one problem we have said he had opted to plant H614, as it is
to destroy them. Sometimes these noticed with the way in which farmers high yielding. We told him that variety
enemies, in the form of pests, are use plant extracts: A farmer will apply is only suitable for high potential areas
much more powerful than the young, the extract only once and expect the in the district and regions such as Trans
weak plants. There are several organic Nzoia or Uasin Gishu, which receive
methods that can be used to control TOF on air! adequate amounts of rainfall.
pests on the farm. A wise farmer will On Thursday evenings, Every year the farmer should sit
always look for the most cost effective you can hear The Organic Farmer in the Kiswa- down and plan what he/she intends
hili Service of KBC Radio from 8.30 pm to to grow and where. Due to the fre-
way to control pests on their crops. 8.45 pm. The programme is shared with the
The use of plant extracts is one such Agricultural Information and Resource Centre. quent changes in weather patterns, a
method. These natural pest control Learn more about organic farming by tuning in wise farmer should be able to plan and
products are not only easily available, to this programme. decide the best crops they can grow
but the farmer will not incur any cost Every Thursday, starting from 8.30 pm! each season and which have a higher
in preparing them. Some of the extracts chance of survival should the weather
pest to disappear. Farmers should change. For every region in the country,
will also provide essential nutrients to
understand that plant extracts do not our research institutions have developed
work in the same way as chemical varieties that can do well in those par-
pesticides. They have to be applied to ticular areas. The farmer only needs to
Cash crop 2 the affected crop several times (some- talk to the agricultural extension offi-
Lack of clean passion fruit seedlings times up to three times a week) until cials in their area or visit and talk to the
research institution to know this. A drip
has led to the spread of Fusarium wilt the pest problem is controlled. When
making plant extracts, farmers should irrigation system can help farmers grow
disease. vegetables and fruits during the dry
also ensure the solution is concen-
Natural fertilizers 6 trated highly enough to be effective. spells. We cannot change the weather,
How to rear earthworms and boost A very dilute solution will not give but we can change our farming prac-
soil fertility in your farm. good results. tices and get good returns.
Nr. 24 May 2007
We need information costs money. If you send us the stamps, Send plant extracts issue
We request you for some copies of the money we would have used to buy I want to be put on your mailing list
The Organic Farmer and to be put in stamps for postage is used to do the pho- to get The Organic Farmer monthly.
your mailing list. If possible, send us tocopying for you. I am associated with one of the
each copy of the past issues. We are
interested in biointensive agriculture
More on organic farming schools in the Thika area and with
several small-holders, all of whom
and doing the little we know, but Lildai Development Group is a regis- expressed great interest in your Sep-
need to be equipped with additional tered group and we reside in Bomet tember/October issue, which was lent
knowledge which we can use to prac- District. I would like to request for to me by a friend. Everyone has been
tise in our farms. We will appreci- The Organic Farmer magazine for my particularly interested in the plant
ate any other information on organic group. The main activity of the group extracts special in the centre of the
agriculture. is farming. Right now we are under magazine. There is an ICIPE shop in
Benson Wasike, P.O Box 9, Kapsara training under the Farmer Field School Thika town. Perhaps you could send
To get past issues, your group will have programme. them several copies each month so
to send us postage stamps worth Ksh 350. The Chairman, that the farmers can collect on their
Since we no longer have past issues we Lildai Development Group, own. Some members of the Earth-
have to photocopy them for you and this P.O. Box 608, Sotik watch team, who do a lot of work
with small farmers on the Kinangop
and elsewhere, also expressed great
Breeding earthworms is easy interest in your magazine. Thank you
continued from page 6 for your very interesting and helpful
3. Layer the remaining materials, publication.
and the system will cause waterlog-
filling the drum almost to the top, ging, which will kill the worms. You Mrs B. Boy, P.O Box 270, Thika
starting with the maize stalks, dry will then have to reconstruct it from
grass, soil, green materials, mbolea, scratch. Newspaper is useful
and soil. The final layer should be We hereby kindly request you for
the dry leaves; this will act as mulch Introducing the worms The Organic Farmer magazine since
against evaporation. Dig four holes about half-way through we found it helpful to our farmers.
Remember, worms do not like deep the moistened materials and intro- Through a nearby group we read one
compost as it heats up. Try to keep duce a few worms into each hole. of your issues and it assisted us, most
materials at about 20 cm (8 inch) Cover the holes. especially the article on DBM. The
depth only. group has 20 members and would
Feeding like your assistance. Thank you.
Now the worm housing is almost
ready. If we were to introduce the Feeding the worms is very important. Daniel Kemei, Muungano Self Help
worms at this stage, however, they Once or twice a week add a few hand-
would die, as it is too dry. We must fuls of kitchen or garden fruit, food Group, P.O Box 41, Moiben
and vegetable waste to the holes in
therefore pour water over the interior
the unit, the same way as you intro-
Send us newspaper
contents until we have ensured ade- We are a young organic group by
quate moisture throughout the entire duced the worms, then cover. Do not
the name Makiki Organic Group. We
materials. This is also a good test to put this on top of the mulch as it will
are registered and we have under-
see if your drainage works properly. attract flies and rodents.
gone three basic courses conducted
On adding water, you should see Extracting the juice: After about a
by KIOF. We have been reading your
the excess run out of the drainage month, your unit will be ready for its
newspaper through friends whose
hole at the bottom of the tank. If this first juice extraction. Pour 20 litres of
supply seems to be unreliable. We are
does not happen, something is wrong water gently over the entire system,
currently 15 and would be grateful if
collecting the run-off in a bucket
you could include us in your mailing
under the drainage hole. Dilute this
list. Thank you.
liquid 1:10 with water and use as a
foliar feed, as a pour-on or through Richard Musembi, Makiki Organic
your drip system (be sure to strain Group, P.O Box 1292, Kangundo
off any particles first). For this size
of unit, one can collect juice once a
month.
Things to note:
Make sure your wormery never
runs dry.
Construct a shelter over the system
to protect from rain and sunshine. A
One drum makes two units. The photo shows low mabati roof is good.
a tap in the front as a drainage and collec- Make sure no vegetation is touching
tion hole. This is not necessary and can be the unit, otherwise siafu will find their
replaced with a hole at the base of the drum. way in. Tuma maoni yako! Asante.
Nr. 24 May 2007
A farmer gets sent to jail, and his wife Organic nitrogen is best
is trying to hold the farm. Shes not
very good at farm work, so she writes All plants need nitrogen. Organic
a letter to him in jail: Sweetheart, I farming has many ways to add this
want to plant the potatoes. When is important nutrient to the soil.
the best time to do it? The farmer The Organic Farmer
writes back: Honey, dont go near
that field. Thats where all my guns Farmer Paul Macharia in Nakuru
are buried. When the prison warders likes organic farming, as he writes to
read the letter, they all run out to the our newspaper. But if I plant hybrid
farm and dig up the entire potato field maize, I need to use artificial fertiliz-
looking for guns. After two full days ers containing nitrogen, such as DAP, Lablab: Nitrogen fixing
of digging, they dont find one single urea or CAN, to get a good yield. manure, so it cannot be washed away
weapon. The farmer then writes to Otherwise my harvest will be so little, and so goes slowly into the soil and
his wife: Honey, now is when you
that I will not even recover the cost to the roots.
should plant the potatoes.
of the inputs. Nitrogen is the key to a Organic and sustainable farming
A farmers joke
good harvest. does not allow the use of chemical fer-
In one way, Paul is right. Even the tilizers. Sustainable agriculture is the
handbook of the International Fed- approach to agricultural production
eration of Organic Agriculture Move- that stresses the improvement and
ments (IFOAM) says that chemi- preservation of the soil while increas-
cal fertilizers offer large amounts of ing productivity. Organic farming
nutrients to the plants in an easily feeds the plants indirectly by feeding
available form. They can lead to an the soil with organic matter. It is the
impressive increase in the yield. On main nutrient for the plants. Organic
the other hand, these fertilizers are manures usually contain all required
not only expensive (1 bag now costs nutrients in sufficient amounts and in
Ksh 2000/=), but they also disrupt the a balanced composition. Deficiency of
natural growth and development of a single nutrient can in most cases be
plants. avoided by applying compost, animal
Damage to soil structure manure and other organic sources.
They do not feed the soil, but merely Organic soil improvers
supply a limited range of nutrients to Green manure: Green manures are
the plants themselves. Oversupply plants grown to improve the soil.
of nitrogen leads to a softening of These plants may fix nitrogen, protect
the soil from drying, improve soil
which are more sensitive to diseases structure via roots, suppress weeds
and pests. In addition, soluble nitrates by fast growth, and control pests by
may reduce the numbers of beneficial harbouring predators. Fallowing is
soil organisms which are essential recommended to create a rest period
for stabilising soil structure. This can for soils. They may be ploughed back
result in increased soil acidity and a into the ground or cut and left to use
tendency to erosion. as a top mulch or may be cut and
Feeding the soil used in the compost pile. Examples
of good green manure plants are
Another real problem of using chemi- amaranthus, crotalaria, lablab, beans,
cal fertilizer is that about half of the peas, purple vetch, lupin, mustard
applied nitrogen fertilizer usually or rye.
gets lost through runoff, leaching and Animal manures: These manures
evaporation. If there are strong rains must be well rotted or composted
or long dry periods, the efficiency before use. They are best incorpo-
of nitrogen may be even lower. This rated together with the bedding of
is the reason why farmers often mix the animals, as this will have most
these fertilizers with compost or with of the nitrogen that is in the animal
urine. The bedding will also provide
bulk, which will further improve the
soil structure.
Compost: All garden vegetative waste
can be composted. Animal bedding,
cereal straw, maize stalks, etc. are all
good. Additional inputs like wood
ash sprinkled between layers of mate-
rial, as well as bone meal and/or
rock phosphate are added if required.
Desmodium: Nitrogen fixing (Photos TOF) continued on page 3
Nr. 25 June 2007
side
side
840
880
beehives; the Kenya Top Bar Hives pentry skills or if they can follow the
(KTBH) and the Langstroth bee hives instructions given here on how to
bottom
which are very efficient in terms of build it.
the quantity and quality of honey Advantages of the KTBH
they can produce. The two hives also 20 280
Easy to check for ripe honey. top end
make honey harvesting and bee man-
Easier to harvest than the traditional bar side
agement easy for farmers.
483
log hives on the top of a tree.
On this page, we briefly give details
Easy to manage the bees during
on the two types of beehives. More
scarcity of flowers and dry weather, lid
information can be obtained from 32
since food for bees and water can be
585
books or from an experienced bee-
provided during such adverse condi-
keeper.
tions to maximise honey production
The Kenya Top Bar Hive (KTBH). Honey extraction is easy compared 960
This is the most common hive in to log beehives or to Langstroth hives,
Kenya. The cost of a KTBH is about as there is no need for special equip- lid
ment. end
end side
The hive keeps swinging and cannot side
be easily attacked by the honey badger wire
(a nocturnal honey-eating animal). It
bottom
side
can fill very quickly in the honey
side
season. comb
Disadvantages
The combs in KTBH are not sup- Drawing of a Kenya Top Bar Hive
ported; therefore, combs tend to break (measurements are in millimetres) Source:
if not handled carefully. Baraka Agricultural College Workshop
Beeswax is harvested with honey, The volume of the KTBH is fixed,
forcing bees to build more wax to so the hive can fill very quickly in the
replace harvested combs, which honey season.
P. Luthi results in lower honey yields but more Whichever hive a beekeeper chooses,
Kenya Top Bar Hives hang on a tree branch harvested wax. the most important thing is that they
are building up their own skills,
The Langstroth hive can give more honey capacities and knowledge. Even the
This is a fairly modern hive (see photo Advantages best hive cannot be productive if a
on page 1). It is also called a frame hive beekeeper is not able to manage it
The frames make the combs very well to get a good harvest!
since it has frames where the combs strong, especially when transported.
are fixed. It has a brood chamber It produces high quality honey
where the queen lays her eggs. She is and high yields since combs are not
Important tips
restricted from moving to other cham- Grease the posts on the wire loop
destroyed.
bers by a wire (the queen excluder). In to prevent pests from getting into the
It allows harvesting of other high-
the super chamber (above the brood beehive. Cut any vegetation below
value hive products such as propolis,
chamber) is the honey storage area. the hive for the same reason.
royal jelly, etc.
The combs are formed on the frames Never use poisonous material
and not on the bars as in KTBH. For Disadvantages for smoking bees while harvesting
harvesting, the frames with honey- High initial costs. honey. Some farmers use foam mat-
filled combs are removed and har- They are more complicated to tresses, human hair, wild fungal
vested using a centrifugal equipment. manage and they require more spare material, cypress or tephrosia leaves
Langstroth hives are relatively expen- parts such as frames, foundation to smoke. These are dangerous and
sive, and cost an average of KSh 4,000. starter sheets, etc. spoil honey quality. Use only the
You can buy them at the two institu- A centrifugal machine is used to allowed material for smoking.
tions mentioned above or from private extract honey. They are not easily For packing, use clear food-grade
companies such as Honey Care Africa available in Kenya and are expen- plastic or glass jars.
(020 574 448) or African Beekeepers sive to purchase, although groups of Maintain a high standard of clean-
(0722 700 226) farmers can share or even rent one. liness.
Nr. 25 June 2007
Radio programme Our soils improved ili nizidishe maarifa zaidi kwa yale
We are a registered group dealing ambao yalikuwa. Sina ujuzi nao
helped us know you with dairy goat breeding under the kwa vile ni mara yangu ya kwanza
Khwisero United Farmers Organi- Dairy Goat Association of Kenya. As kuwasiliana nanyi tuzidishe ushiriki-
zation is a communitybased civil an organized group of 25 members ano kwa shughuli zote. Sina la ziada
society organization currently operat- we would be grateful to be sent your ila hayo.
ing in four sublocations of Khwisero educative magazine. We learned Ronald Ben Nzomo P.O Box 78, Mar-
Division with the following objec- about it from a friend and found it iakani
tives: useful because we also practise other
- Access to marketing systems of their farming activities in our farms apart I heard you on radio
products from goat breeding. For instance we I am a small scale farmer, and became
- Access to modern farming technolo- do poultry keeping, dairy farming, interested in organic farming after lis-
gies maize, potatoes, carrots and beetroot tening to your programme Kipindi
- Soliciting for assistance from the growing among other crops, using cha sikio la mkulima. Now, please
government and other well wishers EM compost and plant extracts. This can you send me the magazine. I
and addressing food security within believe this will help me much in
group is in Malewa location, Kipipiri
our divisions. organic farming.
On farming technologies, we col- Division of Nyandarua District. As an
organic farmer, I have experienced soil Lawi Mutuma, P.O Box 6383 00300,
laborate with research organizations Nairobi
such as ICIPE, KARI, KEFRI, AATF improvement in texture and fertility
etc. to reduce striga weed, which is a since I started using EM and compost
major problem affecting food security in my farm. Also helpful insects like A valuable magazine
in this region. In your programme earthworms, sugar ants which attack We are farmers in Ol Joro Or
W Orok,
ok, Nyan-
aired over the radio, you mentioned aphids and cutworms in the farm have darua District. We have found The
The Organic Farmer magazine of April increased tremendously. Thank you. Organic Farmer magazine very helpful.
which featured mushroom farming. Mwangi Kimani, Kimuru Dairy Goat, We are interested in becoming organic
Our group is very much interested P.O Box 5, Wanjohi farmers. Include us in your mailing
and wishes to kindly request if you list.
could be sending us copies of your
Tumejifunza mengi Peter Kambo, Oraimutia Primary,
monthly publication. We will ensure Nikiwa msikilizaji sugu wa kipindi School, P.O Box 344, Ol Joro Orok
that they reach all members of our cha sikio la mkulima kila alhamisi,
group. We enclose a copy of our reg- nimeweza kuwasikia mkizungumzia More on zero grazing
istration certificate. kuhusu kilimo hai. Ama kwa kweli We recently received a copy of your
Drecky E. Okeno, P.O Box 125-50101, nimeweza kujifunza na kujiongezea very useful magazine from another
Butere maarifa mengi ambayo ninajaribu group in Kangundo. We would like
Dear Drecky, we will send you the issue on kuyatimiza katika mradi wa kijamii to receive future copies of the maga-
mushroom growing. Let us know about your ninaoendesha. Hivyo basi ili kuweza zine as our 25 members were all very
experience in the fight against striga. We kufaridi vyema na kuweza kuwan- impressed by the quality of articles
are very interested to know more about the ufaisha wanakijiji wenzangu hasa and the many useful tips for dairy
problem. kutokana na mbinu bora za kilimo farmers. Please kindly put us into
hai, naomba mnitumie nakala moja contact with somebody who can
Northern leaf blight a problem au zaidi ya The Organic Farmer hati- advise us whether we can conduct our
continued from page 5 maye mko huru kuutembelea mradi zero grazing in an organic manner,
be resistant to Turcicum leaf blight. huu ili kujionea yale ninayoyafanya what advantages there will be, and
It is a late-maturing variety suited to mathalani ufugaji wa mbuziwa the costs sacrifices involved.
highland areas (between 1800 2200 maziwa, ngombe wa maziwa, ufugaji Soo Nzioka, Itethye Ngutethye Group,
m). More information on availability wa nyuki, ufugaji wa kuku wa mayai P.O Box 814, Machakos
of EH05272 seed may be obtained na mengineo mengi. Asanteni sana. Dear Soo, we will send you some copies of
from KARIs Maize Breeding Pro- Ali H Kimani, Care for the Earth Farm an article we carried in our magazine in our
gramme or Dr. George Ombakho Project, P.O Box 34-40602, Ndori March 2007 issue. We hope this will provide
(Email: irmaktl@africaonline.co.ke). your group with the information you need.
You may also assess various variet- Tushirikiane
ies that are available to you for their Kwanza pokeeni salamu zangu nyingi
tolerance/resistance to the disease sana, nina wapongeza sana kwa kazi
by planting them in portions on the yenu nzuri sana ambayo imetueli-
same field; select the most promising misha vilivyo ikiwa kwanza mimi ni
ones (the ones that show no sign of kijana ambaye ninajishughulisha na
the fungus) for large-scale planting in kazi ya shamba, kama vile upandaji
subsequent seasons. mboga na mimea ya migomba nita-
furahia sana nitakapoona tunashiriki-
* Dr. Kinyua is a plant pathologist at the
ana vilivyo kupeana usaidizi kwa
Kenya Agricultural Research Institute,
kazi hizi zetu. Kwa upande wa lile
NARL), Nairobi.
toleo nitashukuru sana nitakapopata Tuma maoni yako! Asante.
Nr. 26 July 2007
The E.A. Organic Mark is a step forward Good tips for seed selection
We would be grateful if you include
The concern of Su Kahumbu (TOF, could gang up and refuse to inspect us in your mailing list. We have been
July 2007) is justified, but with some and certify on the E.A Organic Stan- reading The Organic Farmer maga-
reservations of what might tran- dard would be a scenario which could zine through others and it has been
spire on consultative forums before impel us to consider encouraging the very useful to us. The February 2007
the implementation stage. It is my formation of more certification bodies issue really updated us in selecting
view,that it could be too early to in the E.A region. Allowing the for- the right seeds for the season. Johari
worry on the outcome of the launch mation of more certification bodies enterprise is composed of 10 peasant
of the E.A. Organic Mark. It is impor- would create a competitive service farmers and businessmen. We grow
tant to note that the final draft of E.A. providers situation. cereals, vegetables and fruits.
Organic Standard has not yet been Involve the ceritification bodies Lawrence J Opondo, Johari group,
perused, debated and ratified by the
East African legislative assembly. It is possible that Tancert, Ugocert and P.O Box 242, Sondu
Encert participated in the formulation
Certification requirements of E.A Organic Standard; their own Students need magazine
The three certification bodies such as standards should by now be revised On behalf of Young Farmers' Club
Encert-Kenya, Ugocert-Uganda and to incorporate the requirements of the in Netima High School, I would like
Tancert- Tanzania, mentioned by Su E.A. Organic Standard. It is encourag- to request you to send us a copy
Kahumbu are presumed to be recog- ing on our part to note from Mr. Musa of the above magazine to help our
nized and acceptable by their respec- Njoka, the CEO of Encert, that their club, which is involved in horticul-
tive countries. They would automati- organic standard is already revised to tural projects in our school. We badly
cally qualify to oversee the certifica- accommodate the requirements of the need access to information on organic
tion process based on the E.A. Organic E.A Organic Standard. It is assumed farming.
Standard. I do not foresee any objec- that Tancert and Ugocert have also
updated their standards. Mr. Nyongesa Wanyonyi, P.O Box 24,
tion on the use of the certifying bodys
Malakisi
symbol and that of the E.A. Organic Co-operation needed
Mark on products certified in accor-
dance with E.A. Organic Standard. To have an Organic Standard and Send me magazine
The future E.A. Organic Accreditation its Mark for the region is a major Kindly do send me a copy of The
Committee should be able to ascertain step forward towards uplifting the Organic Farmer magazine. I am an
a reasonable and affordable charge economic base of our communities. enthusiastic farmer and an ardent
payable by the certification bodies for This could also create the necessary listener to your radio bulletin on KBC
the use of the Mark. The cost of the and important international recogni- every week on Thursdays between
Mark would most likely be passed by tion of our capacity to initiate and 8.30-8.45. Congratulations!
the certifying body to the producer manage a well-organized and signifi- Kennedy Messo, P.O Box 142-50241,
who in turn could raise the selling cant organic industry. It is therefore Kipkaren River
price to the consumer. The cost impli- important that all organic stakehold-
cation of the E.A Organic Mark is ers should support that initiative. Magazine informs us
therefore crucial. J.T Muriithi Simba, SOHGRO P.O Box 12 I am an organic farmer practising sus-
The insinuation by Su Kahumbu 10230 Sagana 0726 593 818 tainable agriculture with my family
that the three certification bodies SOHGRO@yahoo.com members. So I request for monthly
copies of your magazine. I will appre-
Mushroom-story helped us Good training g material ciate most because it will keep us on
We hereby kindly request to be put on Mutuambay Self Help Group is our toes and be alert with regard to the
your mailing list in order to receive undertaking farming activities in benefits of organic farming, sustain-
monthly copies of The Organic Farmer Meru North District. Our activities are able agriculture, as well as sustainable
spread in two sub-locations Morega development in our community.
based organic group by the name and Anjuki. The group has started
Rila Wamukota Natwati, P.O Box
Makerecha Organic Group. We came projects which are on-going and are
1996, Kitale
across a copy of your magazine from doing well. We collaborate with agri-
a friend of a member in the group. It cultural extension staff. We also intend
happened to be the April 2007 issue to start beekeeping projects.
on mushrooms and you can never We have decided to get informa-
imagine how much it has assisted tion from your institution on organic
us because that is what we are cur- farming technology, now that our
rently dealing with. We are 15 active group has become a source of informa-
members in the group who are inter- tion for the members and our neigh-
ested in becoming more knowledge- bours who highly rely on chemicals
able on organic farming. Your consid- in their farms and homes. We shall be
eration will be highly appreciated. ready for whatever feedback.
James Gacheru, Rebecca Thairora, P.O Box 182 60607,
P.O Box 521-00902 Kikuyu Mikinduri Tuma maoni yako! Asante.
Nr. 27 August 2007
In honour of sukumawiki
While enjoying their popular daily coli, spinach, leeks, or capsicums; it
meal of ugali and sukumawiki (the is also not prone to diseases. Suku-
vegetable that enables one to survive mawiki was initially very marketable
during the week), many Kenyans may but of late farmers have flooded the
not know how sukumawiki came to markets with it, leading to depressed
be such a common vegetable on our prices. On the other side, sukumawiki
dining tables. At the beginning of the would never have become so popular
20th Century Africans relied heavily if so many people in Kenya did not
on the various indigenous vegetables live in poverty. The popularity of
which have now been discarded in sukumawiki variety is synonymous
favour of sukumawiki (or kale) and with poverty. With one bunch selling
cabbage. Sukumawiki has become at a price of Ksh 5/=, a low income
one of the most common vegetables earner is assured of a meal. Apart
in Kenya following introduction by from salt and some onions, you do
agricultural extension personnel. It not need many ingredients, and it
has a lot of nutritional benefits; and does not take long to cook. Until such
is said to contain most essential vita- a time that Kenyans can increase their
mins and proteins. earnings and afford a variety of foods
or develop a desire for traditional
Common man's food ones such as kunde, sucha or even
Apart from this, sukumawiki is very sagaa, which enjoy good prices in the
easy to grow as it does not require a market, sukumawiki will continue to
lot of inputs and work to grow like enjoy a dignified place on wananchis
other exotic vegetables such as broc- dining tables.
transport their vegetables to other for Ksh 400; he sells it in Kangemi for before they get spoilt. Elijahs neigh-
markets such as Nairobi, it would still Ksh 900. He pays Ksh 60 per bag for bour Simon Gitonga says that five
be difficult to sell. This is because the the transport, Ksh 5 to the loaders for days before our visit, a bag was going
vegetable market is dominated by each of the 30 bags on his own small for Ksh 500, but even then, he only
middlemen who operate like a cartel lorry, and Ksh 10 per bag for bringing made a profit of Ksh 350 a bag. The
or the mafia: They are ready to do the bags to the retailers in Kangemi. two traders sometimes sell cabbage
anything to protect their interests. The total costs a day are Ksh 14,250. and agree that the earnings are more
From our research two issues If he sells all the 30 bags for Ksh 900 a or less the same. The traders cannot
become clear: First, small-scale bag, Joe remains at the end of the day tell what the price for the day will be,
farmers rarely get the real value for with a profit of Ksh 12,150. as this keeps on changing depending
their produce. This is the most impor- Chege Gichinga, a trader at the on demand and supply.
tant reason for the increasing poverty Kangemi market, travels every two The way out
in most rural areas in the country. days to Naromoru near Nanyuki. He
Secondly, most small-scale farmers do buys between 2600 to 3000 pieces of Our research have shown us the dif-
not even try to find ways of avoiding cabbages at Ksh 11 apiece and hires ficulties that small-scale farmers face
middlemen and traders by taking the a lorry at Ksh 13,000 to deliver it to to earn a living from their shambas.
produce directly to retailers. Kangemi, where he sells each piece at There are alternatives, as we have
between Ksh 20 25, depending on mentioned in the editorial on page
Super profit for traders the size of the cabbage and season. In 1. The way out might not be easy
Three hours later we are at the a week he makes two or three trips for small-scale farmers, but it is still
Kangemi market in the outskirts of that earn him a weekly net profit of better to try them than to remain in
Nairobi. The lorries and pickups with between Ksh 30,000 40,000. poverty.
cabbages and sukumawiki and other On this day,
vegetables are offloaded in Kangemi. Elijah Muiruri
Here also many retail dealers are buys a bag at Ksh
buying the produce they will sell 900. On his small
during the day. Joe, a trader, buys a stand in Kangemi,
bag of sukumawiki in soko mjinga he ties the veg-
etables into small
bundles, which
he sells at Ksh 5
a bundle, making
him a profit of Ksh
250 for every bag
he sells. Sometimes
he cannot sell all
the sukumawiki,
so he has to sell
the vegetables at a
throwaway price
Nr. 28 September 2007
All about...
Raising chickens can be a good busi- A brooding room must be kept free
ness if you take care of them, and keep from draught at a constant tempera- What do you need
proper records and strict hygiene. ture of 35C, and must have suitable at the beginning?
bedding that enables the chicks to Depending on the type of chickens
Su Kahumbu
excercise their feet through gripping. you choose to rear, it is wise to have
Before buying your chickens, you all of the necessary equipment avail-
Bedding
should do some preparations. Wash able and in clean working condition
out all feeders and sun-dry before The bedding in the brooding room may before you purchase the chicks. The
introducing the first water and feeds. be wood shavings or straw bedding. If following items are necessary for
Also, heat the room for two hours or raised on flat slippery flooring, the approximately 200 chicks of either
so depending on the room size before chicks develop week tendons in their layers or brooders.
introducing the chicks. feet that cause problems as they gain A secure, draft free brooding
I use a small stone house approxi- weight. Fast-growing broiler chicks room with a source of constant heat
mately 2.5m x 2.5m for my 200 chicks, may develop spraddle leg, which is and good ventilation.
and cordon off one third of the room a combination of weak feet tendons 4 small water feeders for first
for the first two weeks with a wire coupled with vitamin deficiency. This 2 weeks, gradually increasing in
mesh frame, gradually moving it back can be seen when chicks refuse to number as the chicks grow.
and increasing the bird floor area as stand and instead sit back with their 4 grain feeders, gradually increas-
they grow. I use 2 x 250Watt brooding feet spraddled forwards in front. To ing in number as the chicks grow.
lamps for the entire 4-week period, avoid this, one can add a few drops Clean, dry bedding material
gradually raising the lamps to accus- of cod liver oil to the chick water once wood shavings or straw.
tom the chicks to cooler temperatures a week for up to 5 weeks. Be sure not A packet or two of Coccid (avail-
by a few degrees every week. to add too much as this may result in able from any agro vet shop).
runny stools. Chick mash produced by a reli-
Brooding The bedding must always be dry, so able animal feed manufacturer.
When choosing chicks, normally one must always keep a look-out for Two bottles of E.M. (Effective
sold as day-old, look out for listless water spillage. Wet bedding can cause Micro-organisms). (See page 6.)
ones and those that may have oozing the growth of fungi and bacteria that
umbilical cords. These will be prob- will effect the chicks, as well as being lamps slightly until they are comfort-
lematic and are better exchanged for a cause of chilling the young birds. able. If the chick's start to huddle or
healthy bright-eyed ones before you Water feeders and grain feeders for crowd into each other away from the
bring them home. chicks should be checked and cleaned lamp, it may be that the lamps are too
Like the young of all animals, regularly, as very young chicks are high and the chick's are cool. In this
chicks require brooding or incubation susceptible to diseases brought about case, lower the lamps.
during the first few weeks of their through contamination of these imple- The first week of a chicks life is
lives. Both layers and broilers may ments. the most important. It is this period
be brooded together, say 100 of each. As the bedding becomes soiled, that will determine the chicks future
However, it is best to start off with rather than remove and add new, top potential. It is thus very important
the layers for two weeks before intro- up the bedding it with 4 inches of to keep a keen eye, ear and nose on
new material at 5-day intervals. Some the situation in the brooding room.
ducing the broilers, as broilers gain
organic producers believe this allows Observe the chicks often and look for
weight much faster and may crush
the bacteria that destroy the eggs any unsual behaviour. Chicks with
the slower growing layers.
of the coccidiosis parasite to grow sunken eyes and arched backs with
in number, causing a natural reduc- drooping wings and ruffled feathers
tion in the parasite prevalence. It is
are sign of illness.
also more cost effective. The resulting
The same is true for smelly, bloody
deep litter also creates a blanket of
stools. At a very early stage, blood
warmth on the floor.
in the stool could be an indication of
Observations coccidiosis, a parasite that effects the
When introducing chicks to your gastrointestinal tract of the chicks. If
brooding room on the first day, sit noticed early, this can be prevented
back for an hour or so and observe with Coccid and may not affect
them. They should be quite inquisi- the chicks in the long term. If left
tive and active and will start pecking unchecked, coccidiosis can result in
around happily as they investigate up to 40 percent mortality of the
their new surroundings. After feeding flock. Cocciddiosis is spread by chicks
a little they will begin to huddle picking up the eggs of the parasite
around the warm areas and start to through litter of other chicks. In some
sleep. If using lamps, the birds will cases, chicks may build up immu-
form a round yellow carpet like a nity, however good litter (bedding)
patch beneath the lamps. If the lamp is hygiene is the best control. Vinegar
too hot, the chicks will be panting and (half a cup to 5 litres of water) can
Lack of space and minerals causes stress and the area under the lamp will remain also be added to the chicken water to
pecking (cannibalism) in chickens. chick-free. If this is the case, raise the control bloody stool.
continued on page 5
Nr. 28 September 2007
...chickens
Keep an eye on the outside tempera-
tures also, as on sunny toasty days,
one can reduce the brooding tem-
peratures and allow windows to be
opened.
Hygiene
Always stay alert for illness, dis-
eases and signs of stress. Deal with
these as soon as possible, as chick-
ens are quite fragile. Hygiene is of
the utmost importance when raising
poultry. It is therefore extremely
important to avoid contamination of
any sort, whether it is through the
feed, water or handlers. As part of
our biosafety measures, we have a Nesting box should be clean and comfortable for the layers; Inset: an ideal nesting box
pair of boots dedicated to the chick
housing. Handlers must first wash immediately and gives us time to Nesting box
hands and change shoes for the desig- ignite a longer-lasting lamp. Layers must also have access to a
nated boots before entering the chick Lighting can be expensive and specially designated area where they
housing, and these boots must never unnecessary, thus we phase the lights can lay their eggs. If not, they will
come out onto the external area. This off after one week. Most commer- drop them all over the shamba. When
boot control is practised at all levels cial breeders leave lights on to allow making a nesting box area, allow one
of chicken production. Illness and chickens to feed for 24 hours, in the nesting box for each five chickens. I
disease in chicken production are belief that they gain weight faster. have a shelving system: two shelves
predominantly spread through han- I personally believe chickens need high without partitions but covered
dlers via hands and shoes. Biosafety to sleep and are stronger and better on the sides. The shelf is thus dark
measures can reduce mortality and weight gainers when rested and less and allows hens a little privacy. I also
disease spread by up to 60 percent. stressed. If you observe chickens in cover the shelves with straw and make
On a larger scale, when rearing permanently lighted rooms, they sure not to have straw anywhere else.
chicks and older birds on the same trample over each other as they head (I use shavings or maize stalks for the
property, it would be wise to have for the feeders, waking and disturb- bedding floor). This prevents chick-
separate handlers dealing with each. ing each other continuously. ens from laying on the floor, which
Cross contamination, especially from Weaning from brooding heat they would do if the material used on
older birds to chicks, can be a risk.
Broiler chicks are ready to leave the the floor were the same as the nesting
If only one handler is available, the
brooding room when they no longer material.
chicks (which are more fragile) should As the chickens grow whether
have signs of yellow downy feathers
be handled first.
on their heads. You will notice with broilers or layers always keep an eye
Lighting broilers as they feather out that the out for illness, diseases and signs of
stress. Deal with these as soon as pos-
Young day-old chicks are terrified head normally is the last area with sible, as chickens are quite fragile.
of the dark. When lights are put baby chick yellow fuzz. Once this is It is important when raising chick-
off, they begin to scream! They then gone they are ready to move on and ens that you remember that happy,
begin to huddle together for comfort need a lot more space as now they
healthy chickens are less stressed and
and in so doing, the weaker ones are begin to grow quite quickly.
crushed and killed. If brooding with Our chickens are removed into a cheaper to deal with than stressed
lamps, the light they emit is suffi- large secure shed which is especially chickens. More about feed, water and
disease control on page 6.
cient, however should the power go secure from rodents and predators
off, you will need to have a very quick as well as birds of prey. They have
back-up plan. This can be in the form outdoor access to a large area covered
of a kerosene lamp, or a china lamp. in netting where they can come out
For extreme safety measures, we have to enjoy the sunshine, grass, insects,
a solar lamp back-up that comes on etc. I feel this helps to keep the chick-
ens happy and less subject to stress-
related activities like fighting and
pecking, which can have fatal conse-
This feeder,
quences.
developed by Layers need to take a little longer in
KARI, Naiva- the brooding room before they, too,
sha is hygienic must be removed to a larger space.
and reduces feed To maximise on the quality of eggs,
wastage. make sure layers also have an outside
(Photos TOF) run, with plenty of greens in their
feed. A dirty waterer: they should be kept clean
Nr. 28 September 2007
It is very difficult to pin-point the and give you a correct diagnosis and
disease from which your chicks could the best method of treatment. Some- be affected. Regular vaccination can
times the doctor may even recom- protect your chickens against coccidi-
mend a laboratory test if they cannot osis because the bacteria responsible
identify the disease. are always present in the soil. One of
Fowl typhoid is a serious problem the best ways to avoid this disease is
which is very difficult to eradicate. to make sure the poultry sheds are
The best thing to do when the disease kept as clean as possible at all times.
strikes is to clear the whole stock of Wash the floor regularly with organic
chickens in the homestead and avoid acaricides such as neem powder to
bringing any new stock for up to 4 keep the disease at bay. The following
months. By the end of this period, vaccinations are important to prevent
the disease-causing bacteria will have diseases:
cleared and any new stock will not Marek: This is an injection admin-
continued on page 7
Nr. 28 September 2007
We will distribute maga- Fighting poverty would like you to organize tours and
field days for farmers to learn about
zine to groups Lack of knowledge has contributed to
new methods of agricultural produc-
hunger and poverty in Kenya. We are a
Intmunity tion. Also, we would be grateful if you
church-based group and have started
Services (IDCCS) Ltd is a faith-based can provide us with more information
passion fruit growing and would like
organisation involved in sustainable, on growing of desmodium seed.
to go organic. We came across your
participatory and integrated com- David Kamotho, P.O Box Makimen,
magazine through a friend and it is
munity development programmes in Via Sotik
very informative. We are 20 members
agriculture, health and water sanita-
and request you to be sending us your We will improve yields
tion. As a keen listener to your radio
monthly copies to help us improve on
programmes, I wish to request for We are a small village in Kitui. We
farming.
The Organic Farmer magazine. Our
J. K. Kungu, P.O Box 335, Matuu
office covers Kuria, Migori and Rongo owing to our small pieces of land.
Districts and we will make it avail- I read with great interest! We discovered that your newspaper,
able to common interest groups (CIG) The Ministry of Agriculture gave me The Organic Farmer has a lot of useful
involved in organic farming. IDCCS your March 2007 issue and I went information to enable small farmers
mainly partners with CIGs by offer- through it with much enthusiasm. I to get maximum production by using
ing technical trainings to farmers. For write to request for a few copies of it, the latest information you provide in
the benefit of our health, environ- say 10 to enable me and a few farmers your articles. We would appreciate if
ment, sustainable crop production benefit from your information. I shall you could send us copies so as to keep
and appropriate utilization of natural be grateful. ourselves abreast with the new trends
resources, which reduces cost of farm in farming; otherwise we have been
J. K. Arap Kirui, P.O Box 152-20210,
inputs, IDCCS works with CIGs in borrowing a copy each month from
Litein
sustainable agriculture. Your maga- friends. Thanking you in advance.
zine will definitely be beneficial to our Solving farmers problems Gabriel Wambua, P.O Box 189, Kitui
agriculture office and to the commu-
nity, as we will guide them towards Thanks for the good work you are Helping young farmers
implementation of the various topics doing. Actually, the magazine has
come at the right time because it is Following your frequent educative
covered. Kindly send us 4 copies for programmes over the radio about
onward delivery to farmers. We will solving most of the farmers daily
problems. Though I have not been organic farming, Isanga Horticul-
be grateful. tural Farmers hereby request for The
in this field for long, I experienced
Gordon Abwajoh, P.O Box 483 40400, a hard start and needless to say the Organic Farmer magazines. This will
Suna, Tel.0723 458690 going has been tough all through. teach, educate and highlight impor-
From a distant friend, I learnt of your tant information to our young farmers
monthly publication and just wish on new farming techniques and new
Chicken diseases... that you include me in the mailing list plants. It is our hope that you will
Continued from page 6 send us the magazines to boost our
of this wonderful newspaper. I would
be very grateful if you consider as I knowledge on new methods of pro-
istered at the hatchery on young
want to start organic farming. Other- duction.
chicks.
Newcastle: These are inter-nasal wise kudos ICIPE and Biovision. Daniel Nandasaba, P.O Box 1437
drops applied to the eyes at 2 or 3 Peter Gakungi Gichure, P.O Box 598, 50100, Kakamega
weeks and repeated at 18 weeks and Nyahururu Listening to radio
after every 6 months. We, the Riziki Development Group
Fowl Typhoid: This is applied as an Paper should be read members hereby humbly request for
intra-muscular injection at 8 weeks in worldwide copies of The Organic Farmer maga-
high-risk areas and 18 weeks in less I thank you for your magazine which zine. We have been duly listening to
risky areas. has educated me a lot about organic your radio programmes.
Fowl Pox: This is applied in the wings farming. I have been reading it from
Kenneth Onyango Abuya, Riziki
at 8 weeks in high-risk areas (e.g. the a friendly neighbour, I also have
Development Group, P.O Box 124,
coast and Kisumu) and at 18 weeks in contact with farmers who keep dairy
Kadongo
other less risky areas. cattle and goats. Please provide us
Gumboro: It is applied in drinking with more information on breeding
water at the 4th and 14th day. of high milk yielding dairy cattle. I
Our own chickens, fortunately, are will also be grateful if you can send us
produced vaccine-free and as yet we monthly copies of the newspaper to
have not had any problems. It could improve our knowledge. I hope that
be that we are in an area that does not the newspaper is reaching farmers
have a lot of disease pressure, though in other parts of the world in order
I like to believe it is because our birds to spread this useful knowledge. We
are raised in a stress-free healthy envi- are grateful to you for sending the
ronment, resulting in happy birds magazines to farmers in our region,
with good immunity! with whom we have been sharing. We Tuma maoni yako! Asante.
Nr. 28 September 2007
For 5 kg milk produced above the target, add 0.5 of each individual ingredient.
Production system is semi-intensive. (Source: KARI, Naivasha) Tuma maoni yako! Asante.
Nr. 29 October 2007
Dear farmers,
In this newspaper, we have laid empha-
sis several times on the need for farmers
to be more creative in order to remain
competitive and get good returns from
their farms. It appears, however, that
many farmers have continued to prac-
tice farming as they have done in the
past.
If you look around your neighbour-
hood, you will find farmers growing the
same type of crops they grew 10 years
ago. This is regardless of whether these
crops give them the desired yields and
income. Take for example farmers in the
Through tiny holes in these pipes water flows directly to the plant roots (TOF) maize-growing areas of the country; in
these regions, you will find farmers
Every drop for the plant who have grown maize in the same field
for the last 30 years. As you have read
The increasing demand for water by availability is the limiting factor to in this newspaper, this practice wears
agriculture calls for more efficient plant growth, farmers have to devise out the soil and thus it cannot support
use of this resource for instance other ways to minimize the risks of a good harvest.
through drip irrigation. rain-fed agriculture. Another practice that is not wise is
More and more farmers have "copy-cat" farming. If one farmer
Philomena Nyagilo become aware of these problems and grows tomatoes and makes good
Water is a crucial element vital to life are installing irrigation systems on returns in a particular season, every
on earth. Every farmer knows quite their farms. The most efficient system farmer in the neighbourhood will
well that if there is no water, there are of irrigation is drip irrigation, which switch to tomato growing. What hap-
no plants growing and there is no we feature in this month's edition of pens is that all these farmers will har-
food. The water taken up by the roots The Organic Farmer (see pages 4,5). In vest and deliver the tomatoes to the
of a plant is combined with nutrients the next issues we will explain meth- market at the same time. This flooding
from the soil and carbon dioxide ods of water conservation. of the market with the same product
from the air to make food, while lowers its demand, and in the process
some water is lost to the atmosphere Dairy goats in great pushes down the price. Agricultural
product markets are very dynamic and
through a process usually called demand by local farmers prices change every day. It takes a
transpiration.
Water is therefore an essential After our story on dairy goats in clever farmer to understand the market
resource to the farmer. Its manage- September last year, many farmers trends and only grow what is likely to
ment to a great extent decides how have written to us requesting for sell at a particular season. This is the
successful a farming enterprise is or information on where they can buy only way farmers can survive in this
can be. Smallscale farmers in Kenya the goats. This clearly indicates that market environment.
depend on rain to satisfy the water the demand for the goats is very high Diversification on the farm has many
requirements of their farms. Unfortu- among our farmers. The problem is advantages if it is carried out in a
nately, this rainfall is often low, that very few farmers have managed planned way. Different crops take dif-
erratic and unreliable. Since water to get the goats for breeding pur- ferent nutrients from the soil. Crop
poses. Government agricultural insti- rotation helps to balance the various
in this issue tutions do not have any for sale
either. Except for a few places such
nutrients needed to improve soil fertil-
ity and maintain plant health. In mixed
as Nakuru District, where farmers farming, where livestock and crop pro-
Maize production 3
have come together to start a breed- duction are practised, farmers have the
Farmers can make more
ers' association, there are no orga- advantage of the livestock converting
money from sale of green maize.
nized dairy goat breeding associa- crop residues into meat and milk.
Do we need greenhouses? 6 tions in the country.
In organic farming greenhouses It is easy to understand why many What we are saying is that Kenyan
may not be necessary. farmers want dairy goats. They are farmers have enough resources at their
easy to handle, while their milk is disposal. If these resources are well
Helpful but dangerous 8 highly nutritious. On page 2 of this planned and utilised, it is possible to
Tephrosia can help control most issue, we give you more information greatly improve the overall producti-
pests if farmers use it correctly. on how to take care of them. (TOF) vity of the farm, including income.
2 The Organic Farmer Nr. 16 August 2006
MY OPINION
While it is obvious that population
Dairy goats need proper care
increase is to blame for increased Proper management of dairy goats der into small pieces so that the goats
sub-division of available agricultural can help improve their health and can chew them easily. If more than one
land, I believe the trend is not good and productivity. type of forage is available, goats will
for the development of agriculture in digest the roughage more efficiently.
the country. The subdivision has led The Organic Farmer This forage can include potato vines,
to acquisition of unviable agricul- Dairy goats require a high standard of maize stalks, sorghum, and waste
tural units that cannot help improve vegetables, among others. Clean
management for them to give good
food production. The government is fresh water should always be avail-
to blame for this problem. Most of returns to the farmer. Lack of know-
ledge on goat management is a prob- able. A block of salt should also be
our farmers have only been trained hung up in an accessible place for the
to produce food. No effort is made lem for many farmers. From the many
farmers we have visited, it is evident goats to lick.
to impart knowledge on value addi- It is important to know how a goat
tion which could help create jobs that farmers do not maintain the ani-
mals to the expected standards. Most feeds; it has a big stomach in compari-
and reduce pressure on land. A son to its body size, which is what it
major overhaul of the agricultural of the goat sheds we have seen are not
sector is needed to change the atti- kept clean the way they should be. uses to convert its food into milk. It is
tude of the farmers for the benefit of Most farmers house the goats in such more efficient in converting dry
the country. tiny sheds that the animals do not roughage into milk than a cow, but it
Peter Karimi, a farmer in Nyeri have enough room for rest and move- must have good quality clean, dry for-
ment. Lack of hygiene also exposes the age at all times. The amount a goat
eats will depend on its size. If there is
The Organic Farmer goats to diseases and pests. Dairy goat
a lot of waste, either the animal finds
owners should observe the following
The Organic Farmer is an independent guidelines to ensure the goats are the food unpalatable or the quantity is
newspaper for the Kenyan farming too much. A 45 kg goat should be con-
comfortable and productive.
community. It promotes organic suming up to 7% of her body weight,
farming and supports discussions on Housing
in this case 3.2 kg daily.
all aspects of sustainable develop- Except for drinking water, dairy goats
A goat should not only eat roughage.
ment. The Organic Farmer is pub- do not like wet conditions. The ideal
It is important to add concentrate to
lished monthly by ICIPE home for a goat should be dry and
and distributed free to the feed to increase milk production.
clean. A simple way of doing this is to
farmers. The reports of The Dairy meal should be added and fed
build a goat house with a raised tim-
Organic Farmer do not nec- when it is still fresh. The amount of
ber floor that ensures good drainage
essarily reflect the views of concentrate should depend on the
and allows the free flow of urine and
ICIPE. amount of milk being produced. A
faeces through spaces left in the tim-
small quantity should be fed to a preg-
The Organic Farmer is sponsored by ber. This waste is valuable crop
nant goat in order to build up her
BioVision, a Swiss-based founda- manure that can be used to fertilize the
body reserves and help in the devel-
tion for the promotion of sustain- garden. Always remove waste pro-
opment of her unborn kid.
able development. ducts twice a day.
Dairy goats are very selective of what Dairy meal rations should be divided
www.biovision.ch into two, with half being given in the
they eat and will often not eat or drink
anything that is dirty. That is why their morning and the other half in the
Publisher evening. A dry female should get 0.5
International Centre of Insect water, fodder and feed boxes are
located outside the house, to prevent kg of dairy meal, a female producing 1
Physiology and Ecology (ICIPE) litre of milk should be fed 1 kg of dairy
P.O.Box 30772, 00100 Nairobi contamination.
Goats are inquisitive and intelligent meal, 2.0 litres - 1.5 kg, 3 litres - 2.0 kg,
KENYA 4 litres - 2.5 kg and 5 litres - 3.0 kgs of
Tel. +254 20 863 2000 creatures and should be allowed to see
dairy meal daily.
e-mail: icipe@icipe.org what is around them. It is important
homepage: http://www.icipe.org that the farmer allows them to go out Breeding
Editors every day for exercise and to browse One healthy buck (male goat) can
Peter Kamau, Peter Baumgartner on whatever plants are available. One serve up to 30 females in a season. It is
Secretariat important practice of organic farming uneconomical to keep a buck for a
Lucy W. Macharia is to allow the animals to move freely. whole year to serve only a few
Advisory Board No goat will perform well if it is con- females. It is advisable for farmers in
Dr. Bernhard Lhr, ICIPE fined in a room. one area to form a breeding group and
Dr. Nguya Maniania, ICIPE Feeding purchase a buck to be used by each
Dr. Fritz Schulthess, ICIPE The food intake of a dairy goat is member when needed.
Charles Kimani, Farmer, Wangige higher than that of local breeds. This is Rearing and milking
Address mainly because its productivity is also Kids reared naturally stay with their
The Organic Farmer higher. The amount consumed by a mothers until they are weaned at 4
P.O.Box 14352, 00800 Nairobi dairy goat depends on the individual months of age. Since most farmers
KENYA goat's selective habits. However, if purchase dairy goats to provide milk
Tel. +254 020 445 03 98 good quality forage is available, it will for the household, the kid should be
e-mail : info@organickenya.com often eat more. If the forage quality is separated from its mother at night and
Layout low, the refusal rate is often higher. It the goat milked in the morning to pro-
In-A-Vision Systems(k) is always advisable to chop green fod- vide milk for the family.
Nr. 16 August 2006 The Organic Farmer 3
Green maize can raise farmers income
The government fears sales of green Kenyan farmers suffer between 15 50
maize can interfere with per cent in postharvest losses. Farm-
the country's food security. ers who sell green maize overcome all
these losses and get a maximum return
Peter Kamau on their investment.
Aloisia Kirembu is a maize farmer Money for every cob sold
with a difference. Unlike many far- Japheth Wanyama, a social economist
mers in Wamuini area in the outskirts at the Kenya Agricultural Research
of Kitale town, she specializes in the Institute (KARI) in Kitale says research
production of green maize. She is undertaken by the institute shows that
lucky because there are several the returns from sale of vegetable
springs on her 9-acre farm. This maize are much higher than dry
enables her to grow maize on 2 acres maize. He says that at a spacing of
all the year round through irrigation. 75cm by 30cm, a well tended maize
When the green maize is ready for field can produce more than 44,000
harvest, middlemen from Kitale maize cobs. Most varieties of maize
town, Kiminini trading centre and can produce up to three cobs, which
places as far as Bungoma town flock means that the yield can be much
her farm to buy it. higher. Assuming the price of one cob
"Sometimes they come as early as 6 is KSh 5 then a farmer can make up to
a.m and almost fight over the maize if KSh 220,000 in one acre of maize. He
I do not have enough, she says. The said in practice, farmers earn between
maize is later sold in open air markets KSh 150,000 to 200,000 per acre. Most
and to roadside maize roasters in farmers selling dry maize earn less
Kitale town and neighbouring dis- than KSh 25,000 per acre. However,
tricts. the production of green maize is con-
"Growing green maize is profitable. fined to farmers whose farms have
Sometimes I can make as much as five river frontages where maize can grow
times the amount of money I would at any time of the year. The only other
make from dry maize on 1 acre. The producers are large-scale farmers who
yield would be much higher if I grew can afford to install irrigation systems
hybrid varieties, but I prefer growing for maize production. KARI economist
traditional varieties as they have a bet- Wanyama advises farmers who want
ter taste that is popular with my cus- to get good returns to practise correct
tomers", she adds. On her farm the timing and plant early so that the
first crop is planted at the beginning of There is always a market for green maize maize matures when the prices are
January while the second is sown in favourable in the market.
August. Apart from the 2 acres costs Ksh 3 per cob. A different crop
can also be planted immediately after Government controls sale
reserved for green maize, spaces left
the maize is harvested, which also However, Wanyama notes that the sale
by harvested maize, cabbages, pota-
fetches extra money. The maize stalks of green maize can have serious conse-
toes or beans are immediately cleared
are very valuable as they provide fod- quences in the household and on
and planted with a new maize crop;
der for her four dairy cows and also national food security if it is encour-
this ensures there is always some
improve the quality of the farmyard aged. He says the good prices can be
maize growing as an intercrop on the
manure. It is easy to see why she does encouraging to those who could end
other parts of the farm to keep her cus-
better than other farmers. They have up selling all their maize, leaving none
tomers supplied throughout the year.
to wait until November to start har- for their families. The good earnings
She prefers chicken and farmyard
vesting, since most of them do not sell from green maize production can be
manure to fertilize all her crops.
the maize immediately, they have to very tempting and there is fear that it
Postharvest losses to farmers wait for 1 or 2 months before they can can be practised at the expense of
Aloisia Kirembu is not alone; many shell the maize and sell it to the national food production, says
farmers in the maizegrowing areas of National Cereals and Produce Board, Wanyama. But if the money is prop-
TransNzoia and Bungoma districts where payments may be delayed for erly utilized it can really boost income
have discovered the advantages of up to 6 months. Those who are not for most of the poor farmers.
selling vegetable maize. There are sev- able to wait due to pressing financial This is the reason why the govern-
eral reasons why many farmers are needs such as payment of school fees, ment is forced to impose a ban to con-
turning to vegetable maize produc- land preparation or farm inputs are trol the sale and roasting of green
tion. One reason is that maize can give forced to sell at low prices to middle- maize from August every year to
much more money when it is sold men. ensure farmers do not sell all their
green than when it is dry. For example, Unlike dry maize, there is no danger maize at this time. He adds that many
during the MayJune season, one ear of pest damage and rotting in green farmers often plant early-maturing
(cob) goes for Ksh. 5 while in the July- maize. Research findings by the varieties which they sell as green
August season when the crop is United Nations Food And Agricul- maize while the late-maturing ones are
maturing in most growing areas, it tural Organisation (FAO) show that later sold as dry maize.
4 The Organic Farmer Nr. 16 August 2006
We need support ent by far. We have booked one male Excellent and informative
and one female goat from Mukur- I have just finished reading the Febru-
I am an organic farmer living in the weini Nyeri and they will be brought ary 2006 copy of The Organic Farmer.
most remote part of West Pokot Dis- on the 15th of this month for demon- May I congratulate you all on an excel-
trict, Sigor Division. I hold a certificate stration because they are a bit expen- lent magazine, with some very infor-
in Bio-intensive Agriculture from sive and we fear that they may not do mative articles. I would be very grate-
Manor House Agricultural Centre, well in this area. ful if you could please add my name
Kitale. But am not employed. Cur- to your mailing list, as per the address
rently, I have managed to come up Rachael Nduriri, Gikingi Church
Group, P.O Box 1334, Nyahururu at the end of this letter. I work with
with a small grass root group called various communities all over Kenya
Kapon-pon youth group for sustain- Tel.0720 616435
and also in Malawi, doing workshops
able development (KAYG-SD) which on sustainable and organic agricul-
operates with limited resources and ture, water harvesting, tree planting
therefore requires support. and health matters. The Organic Farmer
Samson Kuyo, Mbara Primary, will be of such help to me and the
School, P.O Box 211, Kapenguria communities I work with. If I may be
Dear Mr. Kuyo, so brash as to ask for at least 2-4 copies
Thank you for your initiative in starting each month? If you have any spare
a group. Although the newspaper is cur- copies of the magazine from last year I
rently giving part assistance to selected would be so grateful to have them, as
farmers groups to facilitate the market- I feel I have missed out on a lot of
ing of their organic produce, we do not information! He that plants trees
give financial support to farmers groups loves others besides himself. My very
because all our funds go to the produc- best wishes.
tion of the newspaper-Editor Organic material is not waste (TOF) Grete Davey, Box 285-00204,
Athi River, Kenya,
Will dairy goats survive? Waste management kikoken@wananchi.com
I take this opportunity to thank you The Green Towns organization was Cell. +254 (0) 722 243 774.
for TOF newspaper. I understand the initiated in the early 1990s and has
shortage and postage. Our members projects in over 48 towns with varied More organic substitutes
regional projects that are aimed at In our area now everyone who has
have accepted to share the copies. heard about your newspaper has
They are 14 in number. I have dis- conserving the towns sustainably
with respect to the environment. One reduced the use of chemical fertilizers
tributed all and the farmers are and pesticides. Many have started
always anxious. About the milk of the key areas of intervention is
waste recycling and utilization. organic farming. Why don't you give
goats, we would like to know us organic substitutes to chemical
whether there is a problem with cli- Organic waste, being over 70% of
most urban waste, necessitates its use dewormers, vitamins and even vac-
mate because when we compare cines?
Nyahururu and Nakuru, it is differ- in agriculture. Through our farmers
network we have been able to train Aruba Farmers Group,
urban and periurban farmers on the P.O Box 596, Kitale
greenhouses... continued from page 6 skills.Your newspaper The Organic Good for arid areas
Farmer has complimented our work Our geographical area as stated in
afford to take down such an expensive
because farmers experience many the questionnaire is semi-arid. Some
investment. Her greenhouses are full
problems. Working together with of the organic methods can assist our
of diseases and pests that she is now
you will make us reach more farmers. farmers. Please assist us to get past
frantically trying to control with syn-
This will enable them acquire skills in issues and ensure we do not miss any
thetic poisons. It will never make
organic farming and improve food other issue of this educative maga-
financial sense to leave her houses
security. We will therefore be grateful zine.
vacant. Pest problems are to be
if you can increase the number of Samwel Maina Mburu, Arutani Self
expected. Most greenhouse produc-
copies to serve the more than 200 Group, P.O Box 85, Nakuru
tion is monocropping, therefore there
farmers in the programme.
is an abundance of food for those pests
that survive on the crop. They will
Elijah Githee, Green Towns, P.O Box
766, Nakuru
Dear Farmers,
therefore breed very successfully.
Looked at another way, if I were to
072
ing they would breed in massive num- ers' group, please send us (with
bers. I would plant a greenhouse full am satisfied. The magazines are
helpful, educative and full of advice sms) your contacts. We shall get
of tomato plants as food for insects. So back to you!
then, is it not natural that pest prob- Francis Ndungu Kungu P.O Box 69
lems are common in greenhouses? Solai Tuma maoni yako! Asante.
8 The Organic Farmer Nr. 16 August 2006
Dear farmers,
In Kenya, many cabbage and sukuma
wiki (kale) growers have suffered losses
because of the diamondback moth
(DBM). Our newspaper has written
two articles on the wasp that kills the
pest. The wasp was discovered and
imported from Taiwan by scientists at
the International Centre of Insect
Physiology and Ecology (ICIPE) in
Plants solve farmers' problems Nairobi. ICIPE, with assistance from
KARI, has released a lot of these wasps
Organic farmers have a wide range of natural methods for fighting pests and in the important cabbage-growing
diseases on their crops. In this issue, our newspaper brings you some of the areas in the country. In most of these
plants that can be used to prevent these problems instead of applying harmful regions, the diamondback moth has dis-
chemicals. This is the right way to protect the environment and our future. appeared, and farmers are harvesting
healthy cabbage.
The moth is still a problem in some
parts of the country, as our newspaper
is still getting letters from farmers seek-
ing assistance from ICIPE on the same
issue, since their cabbages are affected.
Feeding and housing a dairy cow ICIPE is willing to assist, as you can
read in the answer given by Dr. Bern-
The Organic Farmer they keep and maintain their milking hard Loehr, a scientist at the institu-
herds. While the well established tion, who coordinated research on the
All over the country, farmers are now farmers get as much as 30 litres from diamondback moth (see page 6). While
trying to rebuild their milk herds in a single cow per day, most ordinary we admit that the problem is still there,
order to sell more milk following farmers get an average of 6 litres it is important to note that farmers can
increased prices from the newly from one cow (see The Organic Farmer make the problem worse by using
revamped Kenya Cooperative Nr. 14, June 2006). chemicals to control the diamondback
Creameries (KCC). However most The difference in milk production moth. These chemicals kill the wasp,
farmers may not realise their milk has a lot to do with the way farmers but not the diamondback moth, which
production targets due to the way feed and manage their animals. hides under the leaves of the cabbage.
Many farmers cannot see the rela- This means that if the farmers did not
tionship between feeding and milk
in this issue production, and if they do, then they
use chemicals, the wasps would do their
work, which is to lay their eggs in the
lack the most basic knowledge on larvae of the diamondback moth and in
Pushing out stemborer dairy cattle management. Take your- this way kill them.
Are you one of many Kenyan maize self as an the example - if you cannot
farmers who lose much of their yield eat for the whole day, then you will
Our newspaper has on many times
every season to stemborers and the not have the energy to perform any
warned of the dangers of using chemi-
witchweed striga? On page 5, we work on your farm. In the same way,
cals. There are many natural ways to
explain how you can fight these pests, a cow cannot produce enough milk
kill or to expel damaging insects from
double your harvest, and earn addi- unless it is given adequate and qual-
the farm (see the article on push-pull
tional income, by using the push-pull ity feed that provides it with all the
for stemborer control on page 5). This is
strategy. In this strategy, the plant essential nutrients.
why we have published a special insert
desmodium plays an important role. The zero grazing sheds that many
in the centre pages on important plants
farmers put up nowadays are like
that can be used in the fight against
prison cells, with up to four animals
pests and diseases.
put in one small enclosure. The ani- As you can see in this issue, we have
mals have no room for movement prepared additional pages for you. In
and rest. The sheds have no drainage September, we will take a break as we
to allow the free flow of urine and did last year, so we will not have an
animal waste. If the animals are not issue in October. This will give us time
comfortable, they become stressed, to reflect and plan on future articles for
and this affects milk production and the newspaper. It will also provide us
even their health. For more informa- with the opportunity to visit some of
tion see pages 2 and 3. the farmers groups in the country.
2 The Organic Farmer Nr. 17 September/October 2006
MY OPINION
Sometimes it is difficult to believe
Requirements of a cowshed
that farmers will ever get fair prices Philomena Nyagilo make a paste of red soil, cow dung
for their farm produce. The recent and ash, and smear this paste on
hike in fuel prices has led to a hike When building a cattle shed, most the sides and bottom of the pit;
in transport costs. While the cost of farmers do not consider the space, then allow it to dry. Repeat five
production has continued to rise, size and number of the animals to be times to build up a leak-proof
the price given to farmers for their kept in the shade. They build the layer.
commodities has remained the sheds too small to allow the free Each cow should have its own
same or even reduced. A big bunch movement and the behavioural cubicle. The cubicle floors should
of spinach vegetables is sold for needs of the animal. Building a shed be made of dry soil, as cattle prefer
only Ksh 40 in the supermarkets. is therefore not only hammering to lie on soil rather than on cold
Also, despite a government ban on together some timber. Building a concrete.
the use of extended bags for potato shed costs money, so farmers should For calves, put in temporary barri-
packaging, traders are back into the avoid mistakes and consider several ers of wood to make smaller pens.
game of farmer exploitation. Travel- demands of their animals: The calves' pen floor should be
ing to Nairobi recently, I could see The shed should be close to a reli-
mountains of extended potato bags. raised about 4 cm and be made of
able source of clean water, and if wooden slats, to help keep the
It seems there is no end in sight to possible near your fodder farm.
farmers problems floor clean and protect the calf
The roof can cover the whole pen from diseases.
Phillip Kiget, a farmer in Molo
or just animal cubicles and should A stall for use as a milking area
slope away from the pen so rain- should be set aside.
The Organic Farmer water doesn't fall into the pen. It Provide troughs for water and feed
The Organic Farmer is an independent should be high enough for a person in the walking area and the calf
newspaper for the Kenyan farming to stand up. pen. A trough should also be pro-
community. It promotes organic The walking area should have a vided in the milking area so that
farming and supports discussions on floor made of concrete or hard- the cow can feed even
all aspects of sustainable develop- packed soil. Concrete is easy to during milking.
ment. The Organic Farmer is pub- clean. The floor should slope
lished monthly by ICIPE gently towards a channel lead-
and distributed free to ing to a manure pit outside the
farmers. The reports of The pen and should not be made too
Organic Farmer do not nec- smooth, otherwise the cattle
essarily reflect the views of are likely to slip on it.
ICIPE.
To hold the manure,
The Organic Farmer is sponsored by dig a large
BioVision, a Swiss-based founda- e n o u g h
tion for the promotion of sustain- manure pit
able development. and line the
channel lead- Suggested further reading:
www.biovision.ch
ing from the More Forage, More Milk,
Publisher walking area to Technical Handbook No. 33,
International Centre of Insect the pit with con- Published by RELMA, Nairobi
Physiology and Ecology (ICIPE) crete. You can also 2005.
P.O.Box 30772, 00100 Nairobi
KENYA
Tel. +254 (020) 863 2000
e-mail: icipe@icipe.org
homepage: http://www.icipe.org
Editors
Peter Kamau, Peter Baumgartner
Secretariat
Lucy W. Macharia
Advisory Board
Dr. Bernhard Lhr, ICIPE
Dr. Nguya Maniania, ICIPE
Dr. Fritz Schulthess, ICIPE
Charles Kimani, Farmer, Wangige
Address
The Organic Farmer
P.O.Box 14352, 00800 Nairobi
KENYA
Tel. +254 (020) 445 03 98
e-mail : info@organickenya.com
Layout
In-A-Vision Systems(k)
Nr. 17 September/October 2006 The Organic Farmer 3
If done well, zero grazing is profitable
Proper feeding and housing
of dairy animals increases milk pro-
duction and income for farmers.
Philomena Nyagilo
"The scarcity of land and animal
destruction of crops made me realize
the importance of practising zero graz-
ing." With these words, James Kamau
Kungu explains why he changed to
zero grazing. Kamau, a farmer in
Kibichiku, Wangige area, is one of
those many farmers in Kenya who
have embraced the practice of keeping
and feeding their cows in a pen, by
providing forage and not allowing the Proper feeding and housing of dairy cows can increase their productivity (TOF)
cows to graze freely in the fields.
It requires labour stems and with the banana stems and Zero grazing reduces the number of
leaves from my farm. It was a good pests such as ticks and intestinal
Population growth and urbanization
decision to change to zero grazing", he worms, since the animals do not
in Kenya have reduced pasture land
says. graze on infested pastures.
available for grazing; this has
James Kamau started off zero graz- There is enough milk for the house-
degraded the environment due to
ing in 1986. He now has 3 heifers and 2 hold nutrition and for sale, hence in
overgrazing and deforestation. As a
cows; he has sold 3 bulls in the past 5 return, enough money to buy for-
result, smallscale farmers have
years. He has a constant supply of age for cows during the dry period.
adopted the system of zero grazing,
milk; his cows give around 40 litres of In case of a disease outbreak, it is
which is an eco-friendly practice for
milk per day, which is enough for the easy to control.
animal husbandry if dairy cows are
family income and nutrition. Kamau It reduces damage to crops caused
kept in good living conditions.
prefers imported or cross-bred cows. by grazing cattle.
Kamau says: "It is an intensive
"They grow faster and produce a good The farmer is assured of manure,
method of farming that produces a
amount of milk if well fed". However, made up of cow dung and urine,
lot of milk from a small amount of
he adds, "If the cows are not properly which sustains soil fertility where
land. But it requires sufficient labour
fed with the right quantities and at the fodder and crops are grown.
to provide forage and maintain the
appropriate time, during all stages of "If you feed your cows well, the price
unit."
growth to maturity, their milk produc- of milk is usually high enough to meet
The labour constraint to the use of
tion drops. The same happens if they the costs of production and make a
fodder is closely tied to the size of the
are not kept in a clean shed". profit", he says. On the other hand,
farm. Kamau has planted Napier
Numerous advantages money is required in order to build
grass, improved Kikuyu grass from
James Kamau is convinced that zero and maintain the shed and manure pit;
South Africa and Kakamega grass in
grazing is a good and suitable system labour is also involved.
his half-hectare (1 acre) farm; he also
for smallscale farmers in Africa. He A farmer should be ready to cut and
grows bananas and maize. "I cut the
points out a lot of advantages: carry the feed, and fetch water for the
Napier grass and mix it with maize
animals. James Kamau is in a good
position with respect to water: he
Standards for organic animal husbandry pumps the water from a nearby river
up to his zero grazing shed in the
In organic farming, zero grazing is ture, an open-air exercise area or run, homestead.
allowed under the conditions set by whenever the physiological condition
the organic standards of the Kenya of the animal, the weather and the Feeding is important
Bureau of Standards. Farmers should state of the ground permit. This means A constant supply and sufficient quan-
ensure that the environment and the that landless zero grazing is not tities of good quality forage is a basic
facilities are adequate for the size and allowed. necessity for increased milk produc-
number of the animals, so as to pro- The farmer should ensure sufficient tion and keeping the animal healthy.
vide for the behavioural needs of the fresh air, water, feed and natural day- "Without good food, not a lot of milk is
animals. Some farmers keep their ani- light to meet the needs of the animals; produced", says Kamau. Forage
mals in crowded sheds without ade- where animals require bedding, ade- includes all plant materials used to
quate space for free movement. We quate natural materials must be pro- feed livestock. Leguminous forage is
should not forget one thing: If you vided. very important. It improves soil fer-
stress the animals, their milk produc- Access to resting areas, shelter and tility through its ability to fix nitro-
tion drops. protection from sunlight, high or low gen, and the quality of feed is higher
temperatures, rain, mud and wind are because it contains proteins. Some of
Organic standards demand that: ways to reduce animal stress. the protein-rich forages include
There should be sufficient free The animals social structures must lucerne, desmodium, calliandra,
movement and opportunity to express be maintained by ensuring that herd lablab or leucaena species. For an
normal patterns of animal behaviour. animals are not kept in isolation from energy feed, maize germ, bran and
All animals should have access to pas- other animals of the same species. other cereal milling by-products are
good for the animals.
4 The Organic Farmer Nr. 17 September/October 2006
Repellents: African
marigold, black jack,
Diamondback moth tephrosia, garlic, crotalaria, Maize smut
chilli and peppers, eucalyp-
tus, tomato.
Insecticides: African
marigold, black jack,
tephrosia, lantana, garlic,
tea, papaya, pyrethrum,
Stemborer crotalaria. Maize Streak virus
Antibacterial: African
marigold, garlic, tea,
tomato.
Antifungal: African
marigold, garlic, papaya,
crotalaria, tithonia, sweet
Cutworm potato, tomato, oleander, Mosaic virus
rhubarb.
Nematicide: Cassava, ole-
ander, garlic, papaya.
are currently 6,000 farmers in Kenya nurseries, bee keeping and horticul- If you have any questions or
and 300 in Uganda who use the ture. The group is registered by the ideas for articles, or if you
15
approach with great success. Apart Department of Social Services and would like us to publish
41
from higher maize yields, many farm- has 32 members. We will be grateful experiences about your
ers make a significant additional if send us monthly copies of the shamba or within your farm-
590
income from selling Napier grass and newspaper. ers' group, please contact us
desmodium as forage, investing the Rulas Mosoh Barango, Muungano (sms!). We shall get back to you!
new assets in buying dairy cows or Youth Group, P.O Box 319, Nyamira
using it to meet family needs. Tuma maoni yako! Asante.
Tel. 0735 913 319
8 The Organic Farmer Nr. 17 September/October 2006
Biofuels compete with food crops Organic Farmers Market: The Kenya
Since the price of fuel is rising daily, Organic Agriculture Network (KOAN)
experts predict that the end of the will be holding an Organic Farmers
fossil resources is not far away. There- Market on Saturday December 15th in
fore people have begun to talk about Nairobi City Park.
biofuels. This is fuel produced from It will feature fresh produce, pro-
sugarcane, maize, wheat or other cessed products, natural health and
crops. Many governments now place beauty products and green Christ-
great hopes in the production of mas gift shopping. Entrance will
energy from biomass. But at the same be free. Entertainment will include
time, the opponents voice their con- live music, acrobats, Childrens
cerns with increasing urgency. They entertainment, an art gallery and a
point out that, above all, the energy Fueling vehicles instead of feeding children solar cinema showing environmen-
crops will compete with food crops tal films. To exhibit at this exciting
within closed nutrient cycles: nutrients
for limited land and water resources. event, contact Samuel Ndungu at
extracted from the soil are returned
Especially in Africa, where millions of 0721-949546 or Wanjiru Kamau at
by applying compost, mulching or
people are faced with food insecurity, 0733-573752, or send an email to
manuring.
it is a crime to use land to produce koansecretariat@elci.org.
By contrast, in crop production for
biofuel while thousands of people are
fuels, nearly 100 percent of the biomass
(sugarcane, maize, wheat, etc.) leaves Q Questions? Go to Infonet!
dying daily because of hunger.
IInfonet
f t is
i an
Soil fertility affected the farm, making it necessary to bring
information plat-
Adrian Mueller, a scientist at the in external inputs to counter the risk
form for organic
Center for Corporate Responsibility of soil fertility degradation, which
farmers. What-
and Sustainability at the University of would be disastrous for the traditional
ever you would
Zurich (Switzerland) adds an aspect weak African soils. The global energy
like to know
that usually receives less attention and problem, however, cannot be over-
about the ecolog-
that is important for organic farmers. come by shifting to biofuels. The only
ical methods for the control of pests
Mueller says that large-scale produc- way out to meet this challenge is to cut
and parasite infestations of plants,
tion of energy crops contradicts the energy consumption. (TOF)
humans and animals Infonet will
principle of sustainable organic agri- Source: inforesources No.4/07. Interested have an answer. You just go to the
culture in a very fundamental way. farmers can order the study of Adrian Internet, either at home or at a cyber-
In particular, Mueller argues that Mueller at the TOF-office, write an e-mail to: cafe and type in: www.infonet-biovi-
organic agriculture seeks to operate info@organickenya.com sion.org
N.B: If the place is very cold at night it is advisable to hang gunny bags on spaces with chicken wire. In hot areas
front ventiation should be made as big as possible i.e space with chicken wire can be 2 metres from the top.
Source: A Livestock Extension Manua, Revised Edition 2003.
Nr. 32 January 2008
Interested in watering plant It is good for training As a farmer who believes in organic
I refer to David Osiakos letter, Umoja I am pleased to inform you that I have farming, I hope to receive it for more
Forest Conservation Group, which had the opportunity of reading some information. Please also send me the
appeared on the October 2007 issue, past copies of your magazine and I plant extracts special issue.
about a watering plant. I am interested do appreciate the various articles and Andrew Oriedo, P.O Box 1493, Kitale
in getting it. Can he tell me how I can technologies which are being applied
get it? Alternatively, if is difficult to in organic farming. I am a technical Magazine is helping us
send it to me all the way to Kilifi, he officer and I have farmers groups in We are a group of farmers called
can give me its botanical name so that Kilifi and Malindi districts growing MEROF (Mt Elgon Rwandet Organic
I may try to get it from Gede forest various horticultural crops, especially Farmers) and are 96 in number. This
which is near me. Francis Hinzano, African indigenous vegetables. We are magazine is very educative and we
P.O. Box 285, Kilifi training these farmers groups using have been reading it from a friend
the Farmer Field School approach working with the ministry of agri-
We need past issues culture. We kindly request that you
We are a Community- Based Organiza- on how to grow these vegetables by
organic methods. If you send us a send us a few copies of the magazine
tion composed of small-scale farmers. to improve our knowledge and skills.
We are residents of Kinamba location copy of your monthly magazine, it
will further broaden our knowledge Andrew Mukung, Chairman MEROF,
in Ngarua division of Laikipia West P.O Box 240, Cheptais
district. We read issue Nr. 23, which on the various methods and technolo-
had the information on mushroom gies available for organic farming and
growing, soil conservation, liquid this will be of great benefit to the large
manure, organic methods of weed farming community we are working
control among and every member with. Martin Mwakangalu, P.O Box
appreciated the information contained 16, Mtwapa
there in. We would be delighted if you
could send us all the past copies and I need plant extract issue
continue to send us the future copies I wish to request you to send me
of your magazine on organic farmer. your monthly magazine as from this
Francis Looremata, Boma Beekeepers, month. I received a copy of your
P.O Box 82, Kinamba magazine from Etang Kenya Ltd.
Few people know organic food Rabbits for sale: I have more than
The Organic Farmer 300 rabbits for sale. Anyone inter-
ested can call Tel.0724 857 878
Although the market for organic prod- Kenbrow Chickens wanted. I need
ucts is expanding at the rate of 20 100 day-old Kenbrow chicks. Please
percent every year, a large section of call Z.K. Mburu Tel 0722 257 796
the Kenyan population does not know Soybean processing: I do soybean
what organic food is all about. A well- processing and use. Kindly contact
coordinated and sustained campaign me on Tel. 0727 180 840
is needed to educate the local consum- Training: Ikinyukia Self-Help Group
ers of the benefits of eating organic in collaboration with KARI-Muguga
foods. trains farmers on baling of purple
Women know more than men vetch hay. Farmers interested with
training can get in touch with the
A survey conducted by organic agri-
group. Contact the chairman Tel.
culture movements in East Africa last A vegetable stall along Nairobi-Naivashs road 0724 492 456
year on consumer attitudes and pref-
The survey found that, apart from Dried Mushrooms: We have 150 kg
erences towards organic foods, shows
being enlightened, the high income of dried Oyster mushrooms for sale.
that awareness of organic foods is very
groups consumed organic foods Interested buyers can get in touch
low especially among the low-income
because they had more purchasing with us. One Acre Fund Tel. 0736 798
groups in the region. Although 40
power and therefore could afford to 214, Email:
percent of the consumers knew about
choose the type of food they wanted. horticulture@oneacrefund.org.
organic food, none had tasted it. Those
who had tasted it did not know that Awareness was slightly higher among
it was organic while a majority of the women than men and tended to match
consumers did not even know what the educational level of the respon-
organic food was. Most of the respon- dents, with those who had secondary
dents in the survey could not give any education being more informed on
reason why they did not eat organic the benefits of organic food than those
foods. For any awareness campaign who had a lower level of education.
to succeed, messages about the advan- A lot of cheating
tages of eating organic food should Organic farmers and the consumers
link the food to the health benefits need to be made aware of the integ-
that consumers stand to gain from rity system which ensures that both
eating it, says Samuel Ndungu, the farmers and retailers sell products that
KOAN National Marketing Develop- are really organic. One way to do
ment Advisor. this is to ensure all organic products
carry labels that distinguish them from
Training is necessary conventional farm products. Currently
Following increasing demand for there is a lot of cheating where farmers
local organic food products by offer conventional produce as organic.
exporters, a number of local com- This may erode the confidence of the
panies are training farmers groups consumers. Efficient quality control
to produce various products. One systems need to be put in place to The Plant Extracts Special which appeared
of these is Earth Oils which has ensure that organic standards are in Sept/Oct 2006 is now available in
contracted farmers in Nanyuki to maintained. English. Interested farmers can order.
plant the tea tree for extraction of The findings from the survey show
essential oils for the export market. that organic agriculture movements Questions? Go to Infonet!
need to intensify their awareness cam- Infonet is an
The company provides farmers with information plat-
paigns on the benefits of organic food
training and seedlings. It also assists form for organic
through aggressive advertising in the
them to pay for the organic certifica- farmers. What-
local media, trade fairs, exhibitions
tion. The company ultimately buys and any other means that will get ever you would
the product for oil extraction. An the message to the wider population. like to know
ICIPE project is also working with If the campaign succeeded, it would about the ecolog-
more than 1000 farmers in Mwingi not only widen the market for organic ical methods for the control of pests
district to process organic honey food. It would also encourage more and parasite infestations of plants,
for the export market. Another very farmers to go into organic production humans and animals Infonet will
successful company is Meru Herbs and also make it affordable for them have an answer. You just go to the
which has trained a lot of farmers to pay for certification to be able to sell Internet, either at home or at a cyber-
in the region and sells a bulk of its their produce in the local and interna- cafe and type in:
products to Europe. (TOF) tional markets at a higher price. www.infonet-biovision.org
Nr. 33 February 2008
Qualities: The variety does not fall in Highland medium altitude MALINDI rust and ear rot. It
VOI
windy conditions, it is resistant to cob
Drylands and semi-arid
Coastal low lands
can remain green for
MOMBASA
rot, rust, Grey leaf spot disease, stem a long time.
and leaf blight.
Variety: KH 600-14 E Kenya Seed
Variety: H614 D KARI Altitude: 1800 2500 m asl
Altitude: 1500 2300 m asl Variety: H6210 Kenya Seed Rainfall: 1000 2000 mm
Rainfall: high Altitude: 1700 2100 m asl Suitable growing areas: Slopes of
Suitable growing areas: Trans Nzoia, Rainfall: 1000 2000 mm Mount Elgon, Trans-Nzoia, West
Uasin Gishu, West Pokot, Keiyo, Suitable growing areas: Trans-Nzoia, Pokot, Uasin , Nandi, greater Kericho,
Marakwet, Laikipia, Nakuru Uasin Gishu, West Pokot, Keiyo Mara- Nyeri, Laikipia, lower Nyandarua
Yield: 38 bags/acre kwet, Laikipia, Nakuru. Yield: 38 48 bags/acre
Qualities: Most popular variety in Yield: 50 bags / acre Qualities: The variety has good rust
the country, can withstand sudden Qualities: Can withstand strong and blight resistance, it can also with-
climatic changes and does well even winds, it is resistant to cob rot, rust, stand Grey leaf spot disease.
under poor management. Grey leaf spot, stem and leaf blight.
farmers forum
I want to train farmers in organic farming
I work with the Ministry of Agricul- offer any kind of financial support. I
ture in Nandi district. I have great can get someone to train farmers and
interest in organic farming. I practice occasionally supervise the work. He
it on a very low level on my kitchen has done a course on organic farming.
garden and try to educate fellow Eliseba Lelei, P.O Box 180, Kapsabet
women to try it on their gardens. We
have a farm that we want to convert You have a good idea aimed at helping
to organic farming in order to create farmers, however the only way we can
awareness to the surrounding com- assist you is to provide you with addi-
munity, through training, visits and tional information to educate them on
demonstrations. I am writing to ask organic farming. We are a small organisa-
for more information on how I can go tion with limited resources, we are there-
about setting it up and the require- fore unable to offer any kind of financial
ments. I would also like to know if you support to farmers groups.
A hanging garden We can share experience I need to learn more
It is simple and labour free and attrac- We acknowledge the receipt of 30 I write to sincerely thank you for
tive to the eyes. Portable kitchen copies of TOF magazine for the putting me on the mailing list of
gardens can be erected around our month of January. We are grateful farmers who receive the TOF maga-
houses. Mobilizing local resources that you honoured our request in zine. I am happy to inform you that
such as top fertile soil, manure, December 2007 to have some more I am now more knowledgeable than
compost, empty sugar bags, gravel, copies. We have already distributed I was before reading the magazine.
small stones and empty Kasuku oil all the copies to farmers and they The magazine is indeed a blessing
tins with top and bottom sides open, are pleased by the amazing farmer to farmers. If it is possible, please
farmers are now able to grow veg- innovations and experiences in the send me special issues on the fol-
etables, organically for their kitchen field of organic farming. You will be lowing: Pests, diseases and deficien-
needs. Spinach, sukumawiki and receiving our Mbeere experience on cies in plants, plant extracts, ecologi-
tomatoes intercropped with pests dry land farming. cal methods for the control of pests
repellant plants can do well using and parasite infestations of plants,
this method. Peter Mbogo, P.O Box 202, KADI
Embu Tel. humans and animals. I would also
How to make it like to know the full address of KIOF.
Identify leveled sites around the TOF good for my school William Tiyoy, P.O Box 2540, Kitale
house where roof water falls into the I am an agricultural teacher in St.
Mukasa school. I have been reading Write to KIOF P.O. Box 34972, 00100
bags directly. Mix the top fertile soil
The Organic Farmer magazine from a Nairobi Tel.0733 799 072
well with well-prepared compost. At
the centre of an open bag, place the friend and have found it very useful More on poultry keeping
Kasuku tin upside down with an for teaching agriculture in school. Thank you for the good work you
open narrower bottom up. Fill the Please if possible, send us some are doing. Actually, the magazine has
Kasuku tin with stones .Around the copies. They will assist our students taught me a lot. I came across a copy
tin and inside the bag, carefully fill to improve in agriculture. of September 2007 from a distant
the mixed soil to the height of the C. W. Wamalwa, P.O Box 1123, friend and just wish that you include
tin. Slowly and gently pull up the Webuye me in the mailing list. I would be
tin to the level of the soil in the bag. very grateful if you consider me as
Fill the tin with stones and repeat the Saving on input costs I want to start poultry keeping and
same with soil. The upright stand- We have found your organic magazine zero grazing. Inform me on how to
ing bag is now full to the top. Pour very beneficial. Most farmers who construct the poultry house of 100
water gently on the stones and soil read TOF spend less in input costs in chicken layers and the requirement.
is made wet from top to the bottom. farming. To reach more farmers, we Irungu M Murimi, P.O Box 1713,
Using a sharpened stick the size of have decided to introduce one more Thika
your thumb, pierce well-spaced holes information desk in our division. We
all round the bag from top to bottom. therefore request for more copies.
Into these holes, gently plant your John Sprite, Nyasi Unit, P.O Box 1781,
vegetables and add water. A three Kitale
to six months sustainable kitchen
garden is ready. It requires less water, We require past issues
no cultivation and no labour. To scare I would like a copy of the plant
birds and chicken from eating leaves extracts special and all the past issues.
and fruits; slurry from cows, goats I sincerely like to thank you in for
and sheep can be applied on the open supplying me regularly. I hope you
top of the bag and outside. will continue sending the magazines.
J. G.Njoroge, 3N Africa, Sabasaba Mafuta Farm, P.O Box 79, Moiben
Nr. 35 April 2008
So many problems with tomatoes!
Rain. I have a problem with tomato bushy humid and hot conditions.
Allow for optimum aeration around
growing here in Kenana farm, Njoro.
I think thats because of heavy rains. your plants to avoid these condi-
Please assist. tions. Prune lower aging leaves from
Tomato plants do not like a lot of tomato bushes often, make sure to
water. Once established, tomato identify the spidermite problem early
plants can be watered twice a week and deal with it before it becomes
and preferably at the soil level, using a bigger problem. Plant hygiene is
jerry cans or drip irrigation. Sprin- important, mites can be spread on
klers splashing on plants also allow clothing, tools, and pets that are used
for the dispersal of pests and disease. on the plants or simply brush against
Our soils also harbour soil-borne dis- the plants.
eases that affect our tomatoes and can Bacterial wilt . I grow toma-
be spread by too much water. Tomato toes in a green house and they suffer Good mushrooms (above)
seedlings in particular do not like from bacterial wilt. Please help. Ogal False mushrooms or Coprinus (below).
to be crowded or narrow, and suffer Opiyo
from dampening off which is notice- Unfortunately bacterial wilt is soil
able when entire lines of seedlings borne and extremely difficult to
start to collapse. remove. It is advisable for you to rotate
Check with your agronomist to the growing in your greenhouse for
ensure you have the best suited the next three years before returning to
tomato variety for your area, and planting any of the same family type
i.e. potato, egg plant, pepper. Bacterial
ensure to provide the plants with a
wilt can be spread through infected Mushroom need
lot of nutritious compost during the
growing period. seedlings, contaminated machinery, great care to grow
contaminated water sources, infested
Spider mite . Help! I am facing soils taken with seedlings from field
I have grown mushrooms but they
wither immediately after germina-
a spider mite problem in tomatoes. to field.
Tel.0710 671 228 tion. What could be the problem? Tel.
To check for Bacterial wilt, slice
For spider mite problems, a good through the stem of the plant and sub- 0723 727 885
solution is to use an organic insec- merse the cut end in a glass of clear The problem with your mushrooms is
ticide like pyrethrum extract. Make water. If you see white liquid stream- not withering. Indeed what is growing
sure you spray early in the morning ing in strands into the water, then this in your substrate (growing medium)
or late evening to avoid killing ben- is confirmation of infection. is a fungus called coprinus. It starts
eficial insects. Spider mites love thick growing in place of mushrooms when
Su Kahumbu the substrate preparation process is
Protect your chicken against disease outbreak done in the wrong way. When making
How often should chicken be immun- gramme a poultry farmer can put the substrate you should make sure
ised? Tel.0728 426 351 in place. However, we can give you that it is well pasteurised (well boiled)
It is difficult to recommend a fixed information on a range of chicken for at least 6 hours to ensure that
vaccination programme for chicken diseases common in Kenya and the all the bacteria are destroyed. After
because different areas experience recommended vaccinations: pasteurisation, you should drain the
different levels of disease incidences. Marek: An vaccination against this water to ensure that the substrate is
The seriousness of a particular disease disease is administered at the hatchery not too wet. Ideally, the conditioning
and its status in an area will deter- before you take the chicks for rearing. of the substrate involves draining it
mine the type of vaccination pro- The vaccine is given only once. for a period of about 12- 24 hours in a
Newcastle: The vaccination is inter- room that is well sterilised to ensure
nasal drops applied to the eyes at 2 or no bacteria are reintroduced into the
3 weeks and repeated at 18 weeks and medium. When sure that you have
thereafter every 6 months. done all that is required, you can then
Fowl typhoid: The vaccination against introduce the spawn. The problem
fowl typhoid is given at 8 weeks and with your mushrooms is that they
later after 6 months. It administered were underpasteurised and in this
through drinking water or an injec- conditions the mushrooms cannot
tion in the birds muscle. One vaccina- grow. The fungus (see picture) takes
tion is adequate for entire life of the advantage to grow when the right
chickens. conditions for its growth are created.
Fowl pox: This is applied to the wings Before going into mushroom pro-
at 8 weeks in high risk areas (e.g. duction, it is important that farmers
Coast Province and Kisumu) and at 18 get training before starting, to reduce
weeks in less risky areas. any chances of failure. It appears that
Gumboro: It is dissolved into drink- most farmers have already gone into
ing water at the 4th and 14th day. mushroom production without ade-
Gumboro can be repeated whenever quate knowledge on production, pro-
there is a threat of re-infection. (TOF) cessing and even marketing. (TOF)
Nr. 35 April 2008
a 08 B.P. 0932
Cotonou, Republic of Bnin
Fax: (229) 35 05 56
Tel: (229) 35 01 88
Braima James
International Institute of Tropical Agriculture, Plant Health Management Division,
Cotonou, Bnin
John Yaninek
International Institute of Tropical Agriculture, Plant Health Management Division,
Cotonou, Bnin
Ambe Tumanteh
Institut de Recherche Agronomique et du Dveloppement, Ekona, Cameroon
Norbert Maroya
Institut National des Recherches Agricoles du Bnin, Niaouli, Bnin
Rasaq Salawu
Ogun State Agricultural Development Project, Ogun State, Abeokuta, Nigeria
Alfred Dixon
International Institute of Tropical Agriculture, Crop Improvement Division, Ibadan,
Nigeria
Joseph A. Kwarteng
IITA 2000 Department of Agricultural Economics and Extension, University of Cape Coast,
ISBN 978-131-173-8 Cape Coast, Ghana
Printed in Nigeria by Wordsmithes Printers, Lagos
Contents
4 5
Starting a Cassava Farm
IPM Field Guide
How do I select a good site for Look for an area with fertile soil: Fertile Table 1: Site description and history
planting cassava? soils usually have a dark color, for example,
dark red or dark brown.The dark color shows
Site description Pests, diseases, and weeds
Cassava grows best in areas with deep and
well-drained loamy soils, adequate rainfall, and
that the soil has a lot of organic matter. If the Vegetation cover Cassava pests in the locality
soil looks gray and sometimes contains green Scanty Cassava green mite
warm and moist climatic conditions. The fac-
or blue spots, it means that there is poor Dense natural fallow Cassava mealybug
tors which guide you to determine if an area
drainage and waterlogging. Do not grow cas- Dense improved fallow Variegated grasshopper
will be suitable for growing cassava include veg-
sava on soils that get waterlogged. Spiraling whitefly
etation cover, soil texture and fertility, topogra-
Soil texture Cassava root scale
phy of land, and the field history of the area. Look for an area with flat or gently slop-
Sandy Termites
ing land: The best farmland for cassava is flat
Look for an area with thick vegetation Loamy White scale insects
or gently sloping. Steep slopes are easily
cover: Sites with dense vegetation cover are Clayey Vertebrates
eroded and are therefore not very good areas
likely to have fertile soils. The dense vegetation for growing cassava.Valleys and depression ar- Other (specify)
shades the soil from direct sunlight, reduces eas are also not very suitable because they Soil fertility
the amount of moisture that is lost from the usually get waterlogged and do not allow cas- Poor Cassava diseases in the locality
soil through evaporation, and minimizes run-off sava roots to develop well. You may, however, Good Cassava mosaic disease
water which may otherwise cause soil erosion. plant early maturing cassava varieties on Cassava bacterial blight
The dense vegetation also drops a lot of leaves mounds or ridges in inland valleys during the Cassava anthracnose disease
Topography
which rot and add nutrients to the soil. In addi- dry season. Cassava bud necrosis
tion, decaying leaves encourage an increase in Flat Root rots
the number of earthworms and other small in- Know the history of the site: Information Hilly/steep slopes Leaf spots
vertebrates in the soil, which in turn help to such as how the land was previously used, and Other (specify)
Depression area
increase the air in the soil and make it better the types of weeds, diseases, and pests in the
for growing cassava. area, can help you in selecting a site for your Common weeds in the locality
Previous crop
cassava farm. Such information can help you Spear grass
Cassava
Look for an area with good soil texture: to avoid a site with problems or make good
Yam Bermuda grass
The best soil for growing cassava is deep, plans for plant protection.Table 1 can be used
Sweetpotato Guinea grass
loamy soil. Such soils are rich in nutrients, low to summarize the agronomic and cassava
Rice Feathery pennisetum
in gravel, hold water well, and are easy to work plant protection history of a site.
Maize Sedges
or till. The way to tell if the soil is loamy is to
Sorghum Siam weed
moisten a small amount of it and try to shape
Cowpea/legumes Giant sensitive weed
it into a ball (Figure 4). If you press the ball and
Other (specify) Wild poinsettia
it falls apart, then your soil is loamy. If it feels
Tridax
gritty and you are not able to shape the
Goat weed
moistened soil into a ball, then the soil is
Parasitic weeds
sandy. If you shape the soil into a ball, and the
Other (specify)
soil does not fall apart when pressed, then the
soil contains a lot of clay and is a clayey soil. For site description, tick (+) appropriate boxes.
For pests, diseases and weeds, indicate importance of the problem as:
Sandy and clayey soils are not the most suit- Figure 4: Testing soil texture by the feel + = not serious
able soils for growing cassava. method ++ = serious
+++ = very serious
6 7
Starting a Cassava Farm
IPM Field Guide
How do I improve the soil for Mulch cassava seedbeds: Mulching involves
planting cassava? covering the soil surface with plant materials.
Mulching improves the fertility of the soil, in-
If you do not select a good site for growing creases the ability of the soil to hold sufficient
cassava you may have to spend a lot of time and water for plant growth, and reduces erosion
materials to improve the soil. Cassava plants on and weed problems. Mulching cassava seed-
good soils grow vigorously and are able to beds is especially valuable when growing cas-
withstand some damage by pests and diseases. sava in dry areas and on slopes.
The following are examples of cultural prac-
Mulching requires very large amounts of plant
tices you can use to improve soil properties.
foliage. Dead plant foliage can be used as
Manure your farm: At land preparation, you dead mulch. Sources of good dead mulch
can add organic manure to the soil to increase are foliage from alley crops, leguminous plants,
soil nutrients, improve soil structure, and im- rice husk, coffee hull and general crop and
prove the ability of the soil to hold water. Or- weed residues. Avoid using weed residues
ganic manure can be in the form of green ma- containing weed seeds, rhizomes, stolons, or
nure or other dead plant or animal manure. In tubers as mulch because these can increase
green manuring, plant foliage (fresh leaves and weed problems on your farm. Straws of maize Figure 5: Cassava variety with late, Figure 6: Cassava variety with early, low, and
young green stems) is ploughed into the soil. and guinea grass (Figure 7) are bad mulch ma- high, and less branching habit much branching habit
Green manure improves soil properties as the terials because they take too long to rot and
foliage rots. Egusi melon and leguminous crops, use up soil nitrogen as they do so.
for example, groundnuts and beans, make You can grow plants as live mulches. For ex-
good green manure. Inorganic fertilizers can ample, egusi melon (a food crop) planted at
also be applied to increase soil fertility. For very close spacing on cassava seedbeds is a
example, in southeast Nigeria, the recom- good live mulch. Nonfood crops can also be
mended rate for NPK application is 400 kg. used as live mulches, but these are normally
per hectare of land. grown as improved fallow plants. For example,
Prepare suitable seedbeds: Cassava fields during fallow periods you can grow Mucuna
on hilly sites with steep slopes are frequently pruriens var. utilis on land you have selected for
eroded. The erosion will be severe if the leaf growing cassava in the next season (Figure 8).
canopy of cassava plants is not thick enough to Mucuna pruriens var. utilis is, however, a fire haz-
cover the ground against rain splashes. This ard in the dry season when its foliage dries.
happens in young cassava farms and if the vari- Plant cassava in association with other
eties have a tall and less branching habit (Figure crops: Appropriate intercrops improve soil
5). If you cannot avoid growing cassava on properties in a manner similar to live mulches.
steep slopes you can grow cassava varieties Crops that are commonly intercropped with
with early, low, and much branching habit (Fig- cassava are maize, rice, legumes, and veg-
ure 6) to cover the ground quickly and prop- etables. Legumes, for example, cowpea and Figure 7: Shoots of guinea grass, Figure 8: Live mulch of Mucuna on fallow land
erly against rain erosion. You can also make groundnuts, are a particularly good intercrop Panicum maximum
ridges across the slopes and mulch the ridges because these plants make and release nutri-
to reduce erosion. ents into the soil.
8 9
Starting a Cassava Farm
IPM Field Guide
How do I select the best Look for varieties that bulk early: Bulking
Tolerance to
Moderate
Moderate
Moderate
Moderate
cassava varieties to plant?
Good
Good
Good
Good
Good
refers to the swelling of the storage roots as
Poor
CBB
they are filled with stored food. Varieties that
The best cassava varieties are those that are
bulk early are better able to offset losses in
liked by consumers, grow fast, give good yields,
storage root yield caused by weed competi-
store well in the soil and are tolerant to major
Tolerance to
Moderate
Moderate
Moderate
Moderate
tion, leaf-feeding pests, and disease than late
Good
Good
Good
Good
Good
Good
pests, and diseases.The particular variety cho-
CMD
maturing varieties.
sen by a farmer depends on her/his objectives
for planting the crop, and the factors looked Look for varieties with good ground
for in selecting cassava varieties usually in- storability: Ground storability is the ability
Tolerance to
clude the following.
Moderate
Moderate
Moderate
Moderate
Moderate
Moderate
of the mature cassava storage roots to stay in
Good
Good
Good
CGM
Poor
Table 2: Some features of common cassava varieties in West and Central Africa
the ground for a long time without getting
suppression
This reduces the duration of postharvest
Moderate
The dry matter is mainly starch and a little bit
Weed
Good
Good
Good
Good
Good
Good
Good
Poor
Poor
storage problems of fresh roots.
of fiber. The percentage of dry matter in the
roots determines the quantity and quality of Look for varieties that are tolerant to
the products obtained after the roots are weeds, pests, and diseases: Some cassava
storability
Moderate
Moderate
Moderate
Ground
processed. Cassava varieties whose storage varieties tolerate weeds, pests, and diseases
Good
Good
Good
Poor
Poor
Poor
Poor
roots have 30% or more dry matter are said better than others. In selecting a variety to
to have high dry matter content. Such variet- grow, it is advisable to consider how well the
ies produce good quality products and are variety can compete with weeds, and resist
Cyanogenic
Moderate
Moderate
Moderate
Moderate
potential
profitable for growers and market women. pests and diseases. For example, if weeds are a
High
Low
Low
Low
Low
Low
problem you can look for adapted varieties
Look for varieties with good mealiness:
which branch early, low, and often (Figure 6).
Mealiness refers to the cooking ability of cassava
Such varieties are able to develop a lot of
% dry matter
storage roots without processing. Mealy variet-
Moderate
branches and leaves quickly to shade the
High
High
High
High
High
High
High
High
High
ies are commonly called sweet cassava whilst
ground and prevent weeds from growing vig-
non-mealy varieties are called bitter cassava.
orously and becoming a problem.You can also
Bitter cassava requires processing before con-
High
High
High
High
High
High
High
High
High
Yield
content (referred to as cyanogenic potential,
CNP) in the storage roots. The higher the CNP Table 2 lists some features of cassava varieties
of a variety, the greater the need to process its commonly grown in West and Central Africa.
storage roots for safe consumption. If cassava Scientists and extension agents can prepare a
TMS 4(2)1425
Cameroon
leaves will be eaten, you can also consider the list similar to Table 2 for the cassava varieties
"Abasa fitaa"
TMS 30572
BEN 86052
RB 89509
Nigeria
cooking quality of the leaves. growing in the locality.
Variety
NR 8082
Ghana
"Afisiafi"
Benin
CMD
CGM
MS 6
8017
8034
IITA
CBB
10 11
Starting a Cassava Farm
IPM Field Guide
The most common sources of cassava stem The cassava mealybug, Phenacoccus mani-
planting material are farmers own farms. Oc- hoti, occurs on cassava leaves, shoot tips, peti-
casionally, cassava stem cuttings are sold at vil- oles, and stems. The mealybugs are covered
lage and town markets. Researchers and ex- with white waxy secretions. Cassava mealy-
tension agents sometimes provide their con- bug damage symptoms include shortened in-
tact farmers with cassava stem cuttings. Many ternode lengths, compression of terminal
cassava pests and diseases are stem-borne leaves together into bunchy tops (Figure 9),
and spread by distribution, sale, and planting of distortion of stem portions, defoliation, and
infested or diseased stem cuttings. By planting candlestick appearance of shoot tip. The in-
healthy stem cuttings, you can greatly reduce sects survive on cassava stems and leaves and
the spread and damage caused by these cas- are easily carried to new fields in this way.
sava pests and diseases. The following guide-
The cassava green mite, Mononychellus
lines will assist you to avoid unhealthy stem
tanajoa, occurs on the undersurfaces of young
cuttings and to select healthy planting material Figure 9: Cassava shoot tip with
leaves, green stems, and axilliary buds of cas- Figure 10: Cassava shoot tip with
for a healthy crop of cassava. bunchy top caused by cassava
sava. The mites appear as yellowish green small and narrow leaves caused by
Look for healthy cassava plants: Select specks to the naked eye. Mites survive on cas- mealybug cassava green mite
healthy cassava plants in the farm. Healthy cas- sava stems and leaves and are easily carried to
sava plants have robust stems and branches, new fields in this way. Cassava green mite
lush foliage, and minimal stem and leaf damage damage symptoms include yellow chlorotic
by pests and diseases. From each plant select leaf spots (like pin pricks) on the upper leaf
the middle brown-skinned portions of stems surfaces, narrowed and smaller leaves (Figure
as stem cuttings. These parts sprout and en- 10), candlestick appearance of the shoot tip,
sure plant vigor better than the top green and stunted cassava plants.
stem portions. Stem cuttings taken from the
The spiraling whitefly, Aleurodicus dispersus,
top green portions of stems or extreme top
damages cassava by sucking sap from the leaves.
and bottom of stored stems are unsuitable.
Colonies of the insect occur on the under-
They will dehydrate quickly, produce un-
surfaces of cassava leaves and are covered with
healthy sprouts, and are easily damaged by
white waxy secretions similar to those of the
pests and diseases.
cassava mealybug. Spiraling whitefly eggs occur
Avoid plants with pests and diseases: In in spiral patterns of wax tracks, mostly on the
selecting cassava plants as sources of stem undersurfaces of leaves. Symptoms of whitefly
cuttings, you should avoid those infected with damage are black sooty mold on the upper leaf
these pests and diseases. The common stem- surfaces, petioles, and stems (Figure 11), and
borne cassava pests and diseases are cassava premature leaf fall of older leaves. The insects Figure 11: Cassava stem and leaves Figure 12: Cassava white scale on
mealybug, cassava green mite, spiraling white- survive on cassava leaves and stems and are blackened under attack by spiraling cassava stem
fly, white scale insect, cassava mosaic disease, easily carried to new fields in this way. whitefly
12 13
Starting a Cassava Farm
IPM Field Guide
The white scale, Aonidomytilus albus, covers Cassava anthracnose disease is caused by
cassava stem surfaces with conspicuous white a fungus which occurs on the surface of cas-
waxy secretions (Figure 12). The insect sucks sava stems.The disease damage symptoms are
sap from the stem and dehydrates it. Stem cankers (sores) on the stem and bases of
cuttings derived from affected stem portions leaf petioles (Figure 15). The disease reduces
normally do not sprout. The insects survive the sprouting ability of stem cuttings.
on cassava stems and leaf petioles and are eas-
ily carried to new fields in this way. Cassava bud necrosis is caused by a fungus
which grows on the surface of cassava stems
Cassava mosaic disease is caused by a vi- covering the axilliary buds or the eyes of
rus which occurs inside cassava stems. Symp- stem cuttings (Figure 16). The affected buds
toms of cassava mosaic disease damage are die, and the sprouting ability of stem cuttings
patches of normal green leaf color mixed with is reduced.
light green and yellow chlorotic areas in a
mosaic pattern (Figure 13). Generally, plants
with these symptoms should be avoided as
sources of stem planting material. However, Figure 13: Cassava plant with cassava Figure 14: Leaf blighting and wilting
the disease is very common in Africa and it is mosaic disease caused by cassava bacterial blight
sometimes difficult to find cassava plants that
are completely free from the disease.You can,
however, reduce cassava mosaic disease prob-
lems by selecting stem cuttings from cassava
stem branches and not from the main stems.
Stem cuttings from the branches are more
likely to sprout into disease-free plants than
stem cuttings from the main stems.
14 15
Starting a Cassava Farm
IPM Field Guide
How do I best plant cassava? (Figure 17), mounds (Figure 18), or ridges (Fig-
ure 19).
The important factors to consider when
planting cassava are time of year, land tillage However, if the loamy soil is shallow and cas-
methods, seedbed type and preparation, and sava is planted on the flat, the storage roots
preparation, handling, and planting mode of will quickly reach hard ground or rocks giving
stem cuttings. poor yields. In sandy soils, minimum tillage and
planting cassava on the flat are appropriate
Select suitable planting dates: You should because the soil is sufficiently loose to allow
try to plant cassava early, at the beginning of for faster drainage and normal storage root
the rainy season. This ensures healthy sprout- development. At sites where the sandy soil
ing and good crop establishment which helps gets waterlogged, it is however better to make
the plant to better withstand damage by dry ridges or mounds than to plant on the flat. In Figure 17:
season pests like the cassava green mite, cas- clayey and poorly drained soils, tillage and Planting
sava mealybug, and termites. Late planting at planting of cassava on mounds or ridges are cassava on
the end of wet season exposes the crop to also essential to limit the effects of waterlog- the flat
severe damage by these pests as the dry sea- ging.
son progresses. However, planting date rec-
ommendations should fit within local farming Prepare and handle stem cuttings prop-
calendars and farmers choice of crops to en- erly: When cutting up cassava stems into
hance their adoption. stem cuttings for planting, make sure each
cutting is at least 2025 cm long and has ab-
Use suitable land and seedbed prepara- out 58 nodes. You should handle cuttings
tion methods: In cassava cultivation, land is carefully during transportation to prevent
usually tilled to loosen up the soil, improve bruises and damage to the nodes. This can be
soil drainage, make it easy for roots to de- done by packing them on cushions of dry
velop, and promote healthier storage root de- leaves. Figure 18:
velopment. Mounds and ridges are commonly
Sometimes, when planting material is slightly Cassava growing
made to gather top soil material for cassava
infested with cassava green mites, cassava on mounds
root development, limit prolonged contact
between the storage roots and stagnant wa- mealybugs, and other stem-borne pests, the
ter, and protect storage roots from rodent stem cuttings can be treated by immersing
and bird pests. them in heated water for 510 minutes just
before planting. This treatment will kill pests
The soil texture at the site you select for cas- on the surface of the cuttings.You can prepare
sava cultivation will be an important factor in the heated water by mixing equal volumes of
determining the level of tillage and type of boiling and cold water. Alternatively, you can
seedbeds required for your cassava farm. In dip the stem cuttings into a dilute pesticide
deep loamy soils, tillage may be essential but it solution (for example, 1% Rogor solution) to
does not matter which seedbed type is kill stem-borne pests.You can also reduce the Figure 19:
adopted and cassava can be planted on the flat incidence of cassava anthracnose and other Cassava growing
on ridges
16 17
Starting a Cassava Farm
IPM Field Guide
Adopt suitable planting mode: In order Improve the soil by manuring, mulching, and intercropping to encourage cassava
to get the best sprouting and growth from plants to grow vigorously and offset damage by cassava diseases.
cassava stem cuttings, it is important to plant
them properly. Cassava stem cuttings may be To select good cassava varieties for planting, look for varieties with high dry matter,
planted vertically, at an angle, or horizontally. good mealiness, good ground storability and which are well adapted to your area;
When planted vertically, the storage roots the variety should also bulk early and be easy to process.
develop deeper in the soil, more closely to- To select healthy cassava stem cuttings, choose healthy cassava plants as sources of
gether, and are more difficult to harvest by planting materials; use stem cuttings taken from the middle, brown portions of the
pulling. Vertical planting is best in sandy soils. stem and free of stem-borne pests and diseases.
In such soils, plant stem cuttings vertically
with 2/3 of the length of the cutting below To prepare cassava stem cuttings for planting, cut each stem cutting to a length of
the soil. When planted horizontally, the stor- at least 2025 cm; use stem cuttings with about 58 nodes; treat stem cuttings
age roots develop more closely to the sur- slightly infested with stem-borne pests by immersing them in heated water for 5
face and are more likely to be exposed and 10 minutes, dipping them into a dilute pesticide solution, or by planting them hori-
attacked by rodent and birds. Also, in hori- zontally.
zontal planting several weak stems develop
from the stem cutting. Horizontal planting, To plant cassava stem cuttings properly consider the type of soil; prepare ridges
however, has the advantage of killing insect and mounds in areas where soil gets waterlogged; use minimum tillage in sandy soil;
and mite pests which occur on the surface of plant cassava stem cuttings vertically in sandy soil; plant cassava stem cuttings at an
stem cuttings. In loamy soil it is probably best angle in loamy soil; plant cassava stem cuttings 1 meter apart from each other in
to plant at an angle. sole cropping; and in cassava intercrops make sure there is enough space for the
plants.
The spacing between plants will depend on
whether you are growing cassava alone (sole
crop) or with other crops (intercropping). If
cassava is being grown alone, plant 1 meter
apart from each other. If cassava is being
grown as an intercrop, consider the branching
habit of both the cassava and the other crops
and make sure there is enough space for the
plants. You should also make sure there is
enough space for you to work between the
plants during weeding and other activities.
18 19
Starting a Cassava Farm
Acknowledgements
Special thanks to the United Nations Development Programme and the Austrian government
which provided funds, and to the following institutions which provided materials, information and
services for the production of the set of cassava IPM field guides:
Rural Training Centre (RTC, Presbyterian Church) in Fonta and Kumba, Cameroon
20
A er rs
O de
dv 1 m
re
v
a
er 00, ont
tis000 hly
e
Nr. 37 June 2008
farmers forum
Farmers should act on fake feeds
Your article about faked feeds was
really interesting. It seems that we
Carcade plant have a culture of cheating in Kenya.
from page 4: Meru Herbs It is all the same, in politics as in busi-
ness. Why cant farmers groups come
biggest employer in Meru and has a
together and send 2 or 3 samples of
very positive impact on poverty alle-
animal feeds to KARI Laboratories
viation in a famine-prone region.
in Naivasha, and have them tested.
The expenses for wages and pro-
They can easily tell if they are buying
duction went up from Ksh 1.9 million
the right feeds? It would costs each
in the year 2000 to KSh 7.1 million
farmer about Ksh 200, but this is
in 2007. Last year Meru Herbs had Quality control needed
money well spent. We farmers are
an income of Ksh 22.5 million and According to your April-issue about
not smart enough, thats why it is
expenses amounting to Ksh 19.7 feeds I asked myself: Do we not have
so easy to get cheated; it is the same
million. The net profit was Ksh 2.7 the Kenya Bureau of Standards which
with seeds or the chemicals we buy
Million. All net profits are re-invested should control all the products sold
in agrovet shops. If we were more
back into the two production facilities in our shops? If I steal Ksh1, 000 Shil-
serious in farming, we would share
in Meru. ling from my neighbour, they will put
our experience, and if we would act
Success with organic farming like-self confident people, it would me in the cells. But if a company is
A forward-jump step for Meru Herbs not be easy to be conned by these fake stealing the money from thousands of
was the decision to go organic. Organ- manufacturers. Someone should take farmers by selling fake feeds, nothing
ically grown products are highly action. happens. It is just business as usual.
valued and fetch a better price in John Kibet, Eldama Ravine Paul Otieno, Kericho
Europe and Japan. The buyers appre-
ciate the healthy character of these More on beekeeping It has enlightened us
products and are willing to pay more I would like to get a copy of TOF I came across this magazine through
for them. In 2002 Meru Herbs got magazine featuring fodder crops and a friend. Our group has 30 members
certification from the UK-based Soil also to be included in your mailing and has already been registered under
Association; it was quite expensive. list. I also would like to be assisted Koisegut Dairy Farmers Group. I
Solely, the renewal of the certificate with information on bee keeping. I found it necessary for it gives guid-
last year cost Ksh 243,492. In 2002, started beekeeping last year; unfortu- ance on access to specialized breeders.
43 farmers were certified as organic nately those who helped me were dis- Practising organic farming improves
farmers, in 2005 196 and 268 this year. placed. I must thank you for this mag- the soil, human and animals health. It
The farmers are free to convert azine. It is updating farmers with skills also teaches the minimal use of arti-
to organic or produce convention- and knowledge on modern farming ficial fertilizers thus reducing input
ally. But all products which are sold methods. Thank you cost. Peter Langat, Ainamoi Primary.
to Meru Herbs have to be organically Doris A Nyanjong, P.O Box 549, School, P.O Box 249, Olenguruone
produced. On the other parts of their Oyugis More on rabbits
shambas, farmers can produce con-
ventionally on condition that they
It will reduce poverty I have been a very keen reader of your
good magazine titled The Organic
I happened to come across The Organic
do not mix the two farming systems Farmer magazine and I found a lot of Farmer from a friend. I would be
and that they have some kind of buffer information which when put into prac- interested in keeping rabbits in my
zone between the organic and the con- tice, can help alleviate poverty among small farm. Could you advise me on
ventional part of the land. small-scale farmers across the country. how to take care of them? I would be
The story of Meru Herbs is a real I am very interested in improving the interested to know what they feed
success story. According to Andrew quality of my dairy cows as I have the and their sicknesses so that I can
Botta, there are various reasons problem of poor quality breeds. Please organize myself. I will soon be able
for this success: The farmers were put me on your mailing list. I dont to communicate with you via e-mail.
involved from the beginning; they want to lose the opportunity to read it Hammerton Kahindi, P.O Box 715,
were therefore highly motivated; they as it will improve my life and that of Kilifi Tel. 0733 544770.
had a ready market for their products other farmers in our village. Joseph K
within the production area without Chepkwony, P.O Box 149, Longisa
having to seek for markets far way
or relying on middlemen who would Training farmers
exploit them. Meru Herbs concen- We would like to be supplied with
trated on a special product that ben- 17 copies of The Organic Farmer. We
efited from the help of the Catho- are carrying out training of farmers
lic Diocese in search of an export in Kabuyefwe location with empha-
market for the product. But without sis on sustainable agriculture. Please
our hard working personnel, says consider including us in your mailing
Andrew Botta, we would not have list. Thomas Khaemba, P.O Box 127,
gone this far. Naitiri
Nr. 37 June 2008
copies in August.
Farmer Groups Youth Groups Women groups Church Groups Agriculture Schools CBOs Colleges Individuals Companies NGOs
TOF mainly targets farmer groups, each copy is read by about 7 farmers 20 years. While 75 percent of the
Every month, we get TOF Copies Distribution 2008 (16,000 copies) worlds poor live in rural areas, a
around 25 applications from Kenyan Copies
mere 4 percent of official devel-
farmers groups. On average, we can
8000
7272
farmers forum
Name these feed companies
Your article on feeds (TOF April 2008)
was quite an eye opener for farmers
who buy poor quality animal feeds
from page 3: potato yield without knowing it. We incur huge
Harvesting: When the leaves turn losses as the so called feed manufac-
yellow, take about 10 - 20 plants at turers laugh all the way to the bank.
random and check whether the tubers However, your article does not solve
are 35 - 45 mm in length. The stems farmers problem because you do not
should then be cut at ground level. give us the names of the compa-
nies selling the sub-standard feeds. It on our part. If we were to name the com-
would really help farmers if you had panies, no farmer would buy their prod-
included the names of the companies. ucts. They would then go to court seeking
This way, we would be able to know damages for loss of business. What we
where to purchase quality feeds. would advise farmers to do is to ensure
John Mugambi P.O. Box 99 Meru they buy animal feeds from reputable and
Dear Mr. Mugambi, well known companies which sell quality
Thank you for your observation, the omis- feeds. Fortunately many farmers around
Ridging allows tubers to fill out and pro-
sion of the names of the companies from you already know these companies and
tects the tubers against the tuber moth
which we got the samples was deliberate should be able to help you.
This activity (also called dehaulm-
ing) enables the skin of the tubers to We require more copies I have learnt a lot
harden and it reduces the spread of Congratulations for an informative I am a field officer working for a Gov-
viruses. Avoid injuring the tubers. magazine. It encourages the use of ernment parastatal in Nakuru and
Harvested tubers should be stored natural inputs which is very healthy do interact with many farmers. Your
in well-ventilated crates and should for our current generation. Be kind magazine has taught me a lot and I
not be exposed to direct sunlight but enough to put us on your mailing list usually share these with farmers. The
kept in the shade. Before storage, for the benefit of our members. only obstacle is that I get your maga-
remove diseased, damaged or mis- Redeemed Gospel Church, P.O Box zine through someone who I have
shaped potatoes. 1493, Kitale to keep on reminding every month.
Five reasons Supporting I am kindly requesting you to mail
me directly so that I can distribute to
for increasing food prices rural development farmers on my field trips. Please con-
Energy: High prices for oil and gas I am a student at Egerton University sider my request.
make the production, processing and Njoro pursuing a course in agricul- Antonina L. Keya, P.O Box 13104,
transport of food more expensive. tural education and extension. I have Nakuru
Appetite: In China, India and other over the last few years been reading
fast-developing countries with a your copies of The Organic Farmer Organic
high economic growth, eating habits and I am greatly impressed by its farming is the future
change. The higher the demand for wonderful contribution to the agricul- I have come across your magazine
meat, the more grains are fed to tural development especially organic which I found very interesting. Con-
animals. For the production of 100 farming, which is a pillar and the key sidering the cost of farm inputs and
calories of beef, for example, 700 calo- to attaining sustainable agriculture most of their side effect both on us
ries of food are spend. in our agriculture-based economy. and our environment, I support you
Urbanisation: Since cities are growing I hereby request for a supply of a that the future is in organic farming.
worldwide, the available farm land copy of the same so as to continue In my area, no one practises organic
decreases, and the number of urban propagating the principals of organic farming and I think it is the high time
consumers is on the rise. According farming both in education and exten- we started it. Can you kindly put us in
to the United Nations, by the end of sion. Once again I commend you and your mailing list? Nelson M Maina,
2008, for the first time in history more the entire team for the good work you P.O Box 285, Karatina
than half of the worlds population are doing.
will live in cities. Julius Muteti, P.O Box 2748, Nakuru
Biofuels: Industrial nations promote
the production of biofuels to reduce Soil tests
their dependence on petroleum. too expensive for farmers
Therefore, on more and more farms Agricultural institutions should help
grows produce to be processed to fuel farmers by taking soil samples to test
than food. in order to know the type of crop
Weather: Hurricanes, floods and recommended. The soil laboratory
droughts are causes for crop failure tests are too expensive and even most
or the fact that farmers are not able to farmers do not know about it.
farm their land. (TOF) Tel. 0720 063 460
Nr. 36 May 2008
Fungus causes pumpkin rot
My pumpkins usually rot at maturity Read and follow instructions on the
stage, what is the cause? Jonathan label carefully. Monitor plants regu-
Omusikali, Tel. 0723 398 376 larly and spray only when necessary
Jonathan, it sounds as though your as copper can accumulate in the soil.
pumpkins have anthracnose. At such Spray in the early morning or late
a late stage it is almost impossible to afternoon. Wear protective clothing
save them. Anthracnose, caused by when handling, and wash your hands
the fungus Colletotrichum lagenarium, after handling.
is a devastating fungal disease. It
Field sanitation
causes defoliation and lesions on the
fruits. Anthracnose disease attacks
As a future remedy, do not grow
pumpkins or any of the same family Coffee disease problem
all parts of the plant at any stage My coffee bushes are dying mysteri-
group (melons, cucumbers, squash,
of growth. The symptoms are most ously, please advice. Tel. 0721 839
butternut) in the affected field for at
visible on leaves and ripe fruits. 816
least two growing seasons.
Copper oxychloride can be used Unfortunately I do not have much
Field sanitation is an important and
to control it, if it is detected early. experience with coffee. I would like
highly effective farm practice to keep
most pests under control. to suggest the following. Before any
Properly select healthy plants for action is taken, you must identify
transplanting. what is causing the problem. Is it
Keep weeds under control at all a pest, or a disease? To do this you
times. really need to inspect the plants,
Observe personal hygiene. Always those that are dying as well as those
bear in mind that you might be the that are dead. Check every part of the
carrier of the pests while you move coffee bush, the berries, the leaves,
from one plant to another the stem etc and note down any
Pull plants that are heavily infected abnormalities. Uproot the dead tree
with insect pests and those that are and look beneath the roots. Take
showing heavy symptoms of disease samples of the dead plant, includ-
infection. ing all the parts you found suspect
Prune the plant parts where insect during your examination, to your
pests are found congregating and nearest agricultural extension office.
those that show heavy symptoms of Please contact us and let us know
disease infection. what you did and what you discov-
Properly dispose of all the infested ered so that we may share this with
plants. Do not put them on the other readers.
compost pile. Su Kahumbu
Pick rotten fruits and collect those
that have dropped. Diseased and pest Deformed water melons
infested fruits must be properly dis- How can I prevent deformation of
posed off. Do not dump them in the melon fruits? Tel. 0727 731 647
compost pile. Deformation in melons can either be
If possible, remove all the crop attributed to insect damage or viral
residues after harvest. Add these to damage. It is good to know the cause.
your compost pile, except if they are Viral damage would be evident in
diseased or pest infected. the leaves, they would show mixed
Clean your farm tools. colours, stunted and deformed. In this
case the solution is to burn the entire
Anthracnose on a cucumber leaf Su Kahumbu/TOF
plant. Do not grow the same family
Strawberry seeds? Questions? Go to Infonet! of crops in the same area for at least
I would like to grow strawberry. two growing seasons. Virus is spread
Infonet is an via insects, so it is good to spray for
Where can I get seeds? Wellington
information plat- insects too if your other plants in the
Njeru Tel. 0720 996 322
form for organic same area are not affected.
You can get strawberry runners from farmers. What- If the leaves are healthy and the
Mr Wilfred Ngure (Tel.0723 260 233) ever you would fruits deformed, it is probably insect
and his group of strawberry growers like to know damage. Spray the plants with a bio-
in Tigoni. He has two types, Shadra about the ecolog- pesticide (spray in the early morning
and Pajero both originally from the ical methods for the control of pests or late afternoon). I recommend
U.S. Each runner costs Ksh 25.00 and parasite infestations of plants, Flower DS which is pyrethrum-based,
A runner grows directly from the humans and animals Infonet will every second day for at least a week,
mother plant as opposed to a seed- have an answer. You just go to the then spray once a week with neem.
ling that grows from seed. Strawberry Internet, either at home or at a cyber- Make sure to harvest all edible parts
propagation from seed is quite dif- cafe and type in: of the plant before spraying.
ficult. (SK) www.infonet-biovision.org Su Kahumbu
Nr. 35 April 2008
P.O. Box 38378 Following the postponement of the Brookside 2008 Livestock Breeders Show
00623 Nairobi & Sale, The Boran Cattle Breeders Society organised a Kenya Boran Sale at Ol
Pejeta Conservancy. This conrms that animals can fetch better prices as well.
ORGANIC
Toothpaste
CERTIFICATION
To be 2 Table spoon
Certied Organic Baking Soda
Contact: 1 tea spoon salt
EnCert Limited,
P. O. Box 74510-00200, Mix with water to form a
Nairobi. paste.
Tel: 0724 910240
E-mail: info@encert.co.ke Soap
Website: www.encert.co.ke 3 litres melted fat, 1 can lye
1.5 litres water
Instructions/Caution
Lye is very irritating to the skin and can do
severe damage to eyes and throats.
Use extreme caution when using lye,
aways keep it away from children. You
should use rubber gloves and saftey
glasses when using lye. Follow the di-
Training in Organic Farming rections on the back of the lye box on how
to handle lye.
Do you want training in organic farming You can also make your own lye by pour-
as a group or individual? ing water over wood ashes and saving the
a) Farmers course 1 week organized
byproduct--lye water. The lye water is then
at your own location.
b) School leavers 1 year or 2
added to fat to make soap.
years residential. Although lard is the main ingredient in
c) Distance learning programme soap, one can successfully substitute with
available. other oils to use in its place. Possible sub-
stitutions for lard can be sunower, canola,
Apply for Diploma in Organic Agricul- or just vegetable oil.(I have found that soap
ture or Certificate course to Kenya made from oil is greasier than that made of
Institute of Organic Farming (KIOF). lard.) Lard can be purchased at a grocery
The course is fully residential at KIOF, store or a butcher shop.
Juja town. Fees are reasonable. Mean The utensils you use in soapmaking
grade D+ or C-. Intake for the should be saved for soapmaking use
September/October 2008 is now in only and should not be use thereafter
progress. for food purposes.
You must not use metal pans and
utensils, like aluminum, iron, tin, or
teon for soap making. You can use
cast iron (as in a kettle, if you are mak-
Write immediately to Director,
ing it outside over a re) or enamelware,
P. O Box 34972 00100 Nairobi.
kiof@iconnect.co.ke or Tel: 0733 799072
stoneware,wood, glass or plastic and
(nyungu) earthenware pot.
Always add lye to cold water. Not vise-
versa. Remember to stir slowly to avoid
splashes. The water will start heating up
once the lye is added, due to a chemical
reaction. Afterwards, pour the lye solution
into the fat, once again stirring slowly.
Chunks in your bar soap is caused by
the separation of the lye and the lard. The
chunks are the fat. If this happens, melt the
mixture and add a cup of water at a time,
until the mixture is thick and syrupy again.
You can make your own soap molds out
of a rag-lined box or glass cake pans or
casseroles. Simply slice the bars with a
Dairy Goats knife after the soap has cured for a week.
Steps to follow:
Call: 0734 913 049 1. Add lye to water and dis-
solve.
2. When container which holds
the lye water is warm, add the
fat and stir until cool. 3.
3. Pour into a cloth lined box or
mould, or a box that has been
dipped in cold water, and then
cover.
Young Stock 4. Leave for 7 days until ready
on SALE! cut soap into squares.
Source: farmgal.tripod.com
The Farmers Classied 3
HOW TO ADVERTISE
If you wish to share in the success of Africas Ag-
riculture revolution, The Farmers Classified, of-
fers you the ideal media to do so. Distributed free
of charge in East Africa, and other parts of the
world via the internet every month, the magazine
is the first publication to educate farmers on sus-
tainable agriculture. Advertisers have a unique
opportunity to unlock the untapped potential.
To Advertise contact:
James Wathuge
thefarmersclassified@mailnew.com
+254 0720 419 584, 0733 893 300
+254 020 356 4106
4 The Farmers Classied
Nr. 39 August 2008
A good farmer knows the needs of a goat
Dairy goats are easy to keep and of concentrate feed (i.e., dairy meal),
can supply you with milk there is total lack of herbage. The
if you care for them well. goat is, therefore, being fed more like
a rabbit. This can only be remedied if
Val Corr *
the goats are left to graze free range
There is an old saying: The eye of or, alternatively, if herbage can be cut
the farmer fattens the beast. In our and put into the stalls.
experience, with varied species of In some instances it is necessary
livestock, this saying is very true. It to tether goats. This should never
simply means that a good farmer, by be done by attaching a rope to the
watching his stock, will know what it leg. Not only is this cruel, it can also
needs to thrive. result in serious injury. Goats should
always be tethered by the neck and,
Zero grazing and fodder preferably, with a rope tied to a collar.
Zero grazing, as we know, applies It must be ensured that whatever the
to a huge percentage of Kenyas live- rope is tied to allow the goat to move
stock, particularly in the case of small- freely round the stake as, otherwise,
scale farmers. Dairy goats are an ideal you will find that the goat finds itself
animal for the small-holder farmer as on a rope so short that it cannot
they are relatively cheap to keep, take move and, more dangerously, it may
up very little space, are easy to feed strangle itself.
and produce more milk than a cow, games will become part of their daily
which takes up more room, eats more Exercise and playing pattern. This exercise ensures the
food and costs more to keep. Young kids will show a natural ability growth of strong bones and muscles.
It has been our experience that goats to jump up and down from as early It is possible, even in the zero grazing
kept on zero grazing are fed mainly as 2 days. They will instinctively look situation, to rig up things for the goats
on Napier grass. Other green matter for places to play by jumping on and to play on, for instance old car tyres,
is only fed when available. Although off anything that is higher than the stones etc.
the food is sufficient, especially if it ground. It would seem that this is a Careful eaters
is subsidized with a small amount crucial part of their growth and, in If you are able to free range your
*Val Corr, Lake Breeze Farm & Toggen- our opinion, it is essential that goats dairy goats, you will observe that
burg Dairy Goats, Naivasha. If you wish should be allowed to jump on an off they are very discerning eaters. In
to contact her for further advice, please things, and be able to play freely. other words, they tend not to destroy
call her on Tel. 0734 913 049. If left to their own devices it the environment in the same way as
In the next TOF-issue: Birth weight, is apparent that they are happy to the Masai goats do. They will eat at
weaning, feed and bucks. interact with each other; energetic Continued on page 6
COMPOST
Dilute 200mls:20L wa- FOR MORE DETALS CONTACT
ter and apply in lay- PETER CHANDI
ers. Take care not to 0722599478
exceed moisture 0733546491
content of 40%. Email organicafrik@yahoo.com
Aer treatment
the compost
TOFSUBSCRIPTION FORM
SUBSCRIPTION FORM HOW TO ADVERTISE
Return this completed form to TOF. PO Box 14352 00800 Nairobi or info@organickenya.com
Registration type: If you wish to share in the success of Africas Ag-
riculture revolution, The Farmers Classified, offers
Name: Individual farmer you the ideal media to do so. Distributed free of
Postal Address: Code: Farmer Group charge in East Africa, and other parts of the world
Town: District Women Group via the internet every month, the magazine is the
Youth Group
Province: first publication to educate farmers on sustainable
College
Registration No.: agriculture. Advertisers have a unique opportunity
School
to unlock the untapped potential.
Number of active Members: Church Group
Chairpersons Name Extension Officer
NGO
To Advertise contact:
Chairpersons Tel.: James Wathuge
CBO
Areas of interest: Other thefarmersclassified@mailnew.com
+254 0720 419 584, 0733 893 300
+254 020 356 4106
4 The Farmers Classied
from page 2: Eucalyptus that involves removing any weeds the tree when the tree stump starts
growing around the young eucalyptus sprouting; they can leave two stems
ment. William Mucheke, a senior tree tree. to allow the tree to grow again. This
breeder at KEFRI says farmers should Harvesting: Harvesting of the euca- means (in theory) that if the farmer
seek advice from the forestry depart- lyptus tree can be done after 3 - 5 harvested 1,000 trees during the first
ment before buying any eucalyptus years, but they can be left to grow to harvest, they can get up to 2000 trees
seedlings. the desired size depending on their in the next harvest.
Planting guidelines intended use. Farmers who want to Diseases and pests: Although resis-
Site selection: Select a portion of your use the trees for poles can cut them tant to most diseases, a new pest, the
land that is not very productive e.g. when they attain 6 to 7 years. Trees for bluegum chalcid has recently invaded
a swampy ground or far away from use in power lines should be allowed eucalyptus plantations in most parts
where you grow maize, beans or veg- between 8 and 10 years. After cutting, of the country. Scientists are working
etables. the tree takes a short time to grow on various methods to control the pest
Land preparation: Prepare enough again. Farmers are advised to prune biologically.
compost three months before plant-
ing the trees, prepare seed bed using
sand instead of the soil. The seedbed
Agroforestry improves biodiversity
should be 1m wide and the desired No doubt, the euca- has many benefits to
length. Broadcast the seeds and con- lyptus is a very fast the farmer. One of
stanlty remove any weeds from the growing tree. When them is that various
young eucalyptus seedlings. Transfer wood production is trees attract different
the seedlings into 4 cm by 6 cm poly- the major objective other living organ-
thene bags in a second seedbed. of the landowner, he isms such as benefi-
Planting: Transfer the seedlings into will thus choose euca- cial insects and bees
the selected portion of land after 3 or lyptus. that provide honey
4 months. On the other hand, and help in pollina-
Weeding: Young eucalyptus trees are planting only euca- tion. It also provides
very vulnerable to weeds especially lyptus trees means a habitat for preda-
grasses, which cause diseases such as impoverishment of tor birds. And by the
Amillaria and root rot. These diseases our nature. We should way, we should not
can wipe out a whole plantation if not forget that plant- forget the beauty of
weeds are not controlled. It is recom- ing different varieties big indigenous trees
mended that farmers do spot weeding of trees in our farms on the landscape!
Nr. 41 October 2008
Mustard as a cover crop, can control ering of soil mineral components. sclerotinia in potato production.
pests and diseases while Mustard speeds up these processes b) Reduction in nematode population
improving soil texture and fertility. by activation of soil microorganisms. which cause root lesion, hapla and chit
These microorganisms support the wood in potato production.
release of essential nutrients for plants c) Suppress root rot (pythion, fusar-
Many times, this magazine has advised while suppressing the disease-causing ium, and rhizoctonia) and sclerotonia
farmers on the value of planting green agents in the soil. The result is that the in bean production.
manures or cover crops in order to soils biology is changed in a way that d) Suppresses pink rot and sclerotonia
improve the quality of our soils and to makes it difficult for the fungi, bacteria in onion production.
increase their productivity. At the same and nematodes to survive. e) It reduces disease pressure from
time, green manures provide fodder for Additional benefits. aphamyces, pythium, rhizoctonia,
animals. Some of the well known green Crop rotation, as we know, can reduce fusarium and sclerotinia in pea pro-
manure crops are lablab, mucuna, pest problems by altering the environ- duction.
desmodium and purple vetch. In this mental conditions under which par- f) It controls cavity spot, root rot, fusar-
issue, we introduce to you another very ticular pests thrive. When these condi- ium and sclerotinia in carrot produc-
important cover crop, the mustard. For tions change, the pest cannot survive tion.
centuries, mustard has been used by and therefore ceases to be a problem to g) It is highly effective on most diseases
farmers across the world to improve your crops. The application of mustard that affect wheat.
their soils and to replenish their fertil- reduces the influence of some of the How to plant mustard
ity and productivity. pests that pose a problem to the crops. Mustard should be planted at the rate
The application of mustard as green Why? Like other crops in the brassica of 10-15 kg per hectare at a depth of
manure can increase the physical, family, such as cabbage, broccoli or 10-15 mm in soil that has adequate
chemical and biological properties of rapeseed, mustard produces, in its roots moisture. The soil needs compacting
the soil. Mustard controls pests such and shoots, a compound called glu- so that the seed comes into contact
as nematodes, a fungal disease such cosinolates. It also produces an enzyme with the soil for good germination.
as blight, a stubborn weed, and at the called myrosinase. When the mustard Soil moisture should be maintained
same time it improves the texture of is chopped and incorporated into the to ensure adequate plant growth and
the soil. soil, the glucosinolates and myrosinase good weed competition. Well prepared
Mustard protects the soil combine, in the process producing a compost can provide the crops nitrogen
Mustard supports farmers who want mixture of other substances. Some of requirements. Sulphur can be added if
to improve the physical structure of them are toxic to soil fungi, nematodes the soil is deficient because mustard
their soil such as infiltration and water and even weed seeds. requires 5:1 nitrogen to sulphur ratio.
holding capacity. It can also help to These substances help to fumigate Farmers without machinery can plant
ensure that more air goes into the soil the soil in a process called bio-fumi- mustard by simply broadcasting it
to increase the population of impor- gation. Farmers are advised to chop over the prepared land. For good ger-
tant soil micro-organisms such as myc- the mustard when it is still green and mination there must be good seed to
orrhizae bacteria that promote plant working it immediately into the soil. soil contact.
health. Like any other cover crop, This enhances the effects of biofumiga- For good results, farmers are advised
mustard can control wind and water tion especially when the mustard is cut to wait for 14 days after chopping and
erosion and therefore protect the soil. while still young, preferably when it is incorporating mustard seed into the
and fixes nitrogen flowering or just before it sets seed. soil before planting the desired crop
Apart from the physical properties of It controls diseases such as beans, potatoes or even wheat.
the soil, mustard can also improve the Some of the diseases that mustard Interested in buying mustard seed:
soil by correcting its chemical proper- green manure can help control are HYGROTECH (E.A) Ltd
ties. It fixes nitrogen and reduces leach- outlined here: P.O. Box 41446,00100, Nairobi,
ing of essential nutrients and weath- a) Verticilium wilt, silver scurf and Tel 066 73 567 /8/9, 0733 896 092.
Nr. 41 October 2008
Amaranthus Spider weed Conge Stinging nettle Black night shade Comfrey
To advertiser contact: James Wathuge 020 356 4106, 0720 419 584, 0733 893 300, email: thefarmersclassied@organickenya.com
EM
For organic practices
About EM
EM (Eective Microorganisms)
nisms) is a mixture of microorganisms which are
found in nature and used d in foods.
EM technology is a provenen and eective technology used for develop-
ing healthy agricultural and environmental systems.
EM increases the humus content of the soil promoting biodiversity
biodiversity,
changing disease causing soils to disease suppressive soils capable for
sustaining high quality food production.
Developed in the 1970s at the University of Ryukus, Okinawa, Japan by
Dr. Teruo Higa, the technology is rapidly expanding throughout the
world.
For more information and where to nd EM, please contact:
EM Technologies Ltd
Tel 0721 640 174, TeleFax 068 41074
email: embu@emteckenya.com, emtechkenya@gmail.com
PO Box 1365-60100 EMBU
Nr. 42 November 2008
William Ayako
Mycotoxins are the most significant
threat in grains (maize, wheat, barley
etc.) that form the bulk of human and
livestock feed in feed manufacturing.
There are two types of mycotoxins,
those that develop in the field prior to
harvesting (arising from field moulds)
and those that develop after harvest-
ing during storage (caused by storage Moisture in maize causes the growth of mould (afflatoxins) Photo TOF
moulds).
Over three hundred strains of myco- Practical control measures
toxins, among them aflatoxin in maize, An important first step in control- Moving or turning: Regular turning
have been identified and new strains ling mycotoxins is preventing mould of grain in storage facilities is a good
are still being discovered. As moulds growth. There are several strategies for control of temperature, moisture level
grow, they use the nutrients in the doing this: and insect infestation. In a way, this
grain and therefore reduce their nutri- Moisture control: This is the cheapest is a form of aeration. It also enables
tive value. If they continue to grow and the easiest way of ensuring safe detection of any developing insect
further, they produce the toxins (Myc- storage. To minimize the potential for infestations.
otoxins). Unless the growth of moulds 15 cm mould growth and mycotoxin Minimizing mechanical damage:
is effectively controlled they cause production, grain moisture content Although most mould pathogens
serious damage to the grain. should be reduced to below 15 % can directly penetrate plant tissues,
The occurrence of mycotoxins in within 48 hours after harvesting. mechanical damage provides addi-
both grains and feed can adversely Aeration and temperature control: tional entry point and therefore should
affect productivity and profitability of The interaction between moisture level be minimized.
poultry and pig flocks. Even though and temperature is the most impor- Selection of resistant cultivars: Selec-
there are recommended agricultural tant factor affecting grain preservation tion of cereal cultivars resistant to
practices to reduce the formation of during storage hence; both should be Fusarium and other mycotoxin-pro-
mycotoxin during crop growth, har- kept as low as possible. Temperature ducing fungi is currently viewed as
vesting and storage, significant feed can be achieved by regular aeration. a possible option for reducing myc-
contamination still exists whereby Aeration is effective for the control of otoxin contamination in grains and
poultry and pig farmers continue to fungal and insect infestations. feeds. W. A.
incur losses. There is also a serious
growing concern over contamination their toxins may be the cause of differ- Reducing risks
of human foods by mycotoxin. ent crops being affected. Prevention It has been proved that the risk associ-
Prevention is important of formation of mycotoxins in feed ated with mycotoxin contamination of
The occurrence of mycotoxins happens is the most appropriate strategy and feed can be reduced through imple-
when favourable conditions for their economic approach in their control in mentation of different approaches:
development are created. Specific feedstuff. Dilution: Animal feeds severely con-
mycotoxins appear to be limited to It has been widely known that mois- taminated with mycotoxins can be
certain environmental conditions and ture, temperature and aeration are diluted with non-contaminated feed
specific crops. Regional and geograph- primarily the environmental factors to achieve final concentration of myco-
ical distribution of different fungi and controlling fungal growth. However, toxin that does not affect the perfor-
moisture is the single most important mance of the animal.
factor. So if commodities are dried Diversion: Some species of animals
to less than 14 % moisture, minimal are more tolerant to a particular myco-
fungal development can occur. toxin than others. This fact can be used
Farmers can easily achieve the rec- to divert the mycotoxin contaminated
ommended moisture content by sun- grains to less susceptible species. The
drying grain to a level that is easy to best example is diversion of contami-
grind or mill into flour as in this case nated grains from pigs to dairy cows.
the moisture content should be below Physical methods: Many physical
14 %. In addition moisture metre (mois- methods such as cleaning and seg-
ture detector) can be used to determine regation of mould-damaged grains
moisture level in the grain. from the intact grain, milling, thermal
continued on page 6
Nr. 42 November 2008
Rabbits can support your whole family
Rabbits are easy to keep, provide
you with healthy meat and can give
you a good income.
Val Corr*
Many Kenyans, especially the men,
would not contemplate eating rabbit
meat. However, I have always been
of the opinion that if every Kenyan
family kept a few rabbits, their chil-
dren, at least, would eat meat every
day. Rabbit meat is totally fat and cho-
lesterol free and has the highest protein
of all domestic livestock.
Rabbits are easy to keep, cheap to Housing and bedding
feed, breed quickly and are ready for To grow healthy, rabbits must be fed
slaughter within four months. They properly, housed properly and kept
carry much more meat than a chicken clean. It is best to house them off the
of the same weight and are very easy ground as follows:
to cook. The house should be 90 cm off
Enough feed and water the ground, be 90 cm high and 90 cm
Rabbits need to feed on rabbit pellets square. Because mabati comes in 2.5
or rabbit ration sufficient to last them meter lengths, it makes sense to build
through the day. Green fodder is essen- blocks of houses 1.80 meter wide so
tial but can be fed in relatively small that one sheet can be used to cover the
quantities. There is very little that two houses.
rabbits will not eat including potato The floors should be of chicken
peelings, carrot peelings and other veg- wire so that droppings and urine fall
etable scrap. They thrive on weeds through to the ground. This can then
(especially chick weed and thistles). be swept up daily and used as compost
Lucerne and Napier grass (thara), if it (see end of the article).
Rabbits need clean house with adequate
is available. The house should have a layer of space, light and comfortable bedding
It is essential that they receive plenty hay as bedding. This is a very impor-
of clean water. It is a fallacy that rabbits tant part of the rabbits diet; they will Their houses should be cleaned
obtain sufficient water from their food. eat a lot of this bedding during the daily. Wet bedding should be removed
It is surprising just how much water night. and put on the compost, dry hay can
they drink in 24 hours. Rabbits must not be in windy con- be returned and some more added. If
Earthen ware bowls with a small lip ditions, so it is advisable to cover the rabbits are left on soiled bedding, it
seem to be the best for water and food, ends of the building with shade nets is not only uncomfortable but it will
as they are too heavy for the rabbits to and to have roll down shade netting encourage flies which will, in turn,
turn over. curtains at night. cause disease.
It is always a good idea to put
minerals in the feed (Coopers Maclick How to slaughter a rabbit
powder is a good one). It is important that the rabbit is killed removed. The feet are clipped off. A
We place a square of sacking under very quickly. The quickest and kindest small slit should be made on the inside
the feed bowls to prevent food being way to do this is: of the back leg that is not attached to
dug out of the bowl and spilt onto the Hold the rabbit in your left hand the slaughter post. The skin is peeled
floor which is waste. by its back legs. With your right hand off this leg. The skin is then gently
Enough meat hold the rabbit between your index loosened round the body and front
If you decide to keep rabbits I am sure and middle fingers, under the chin legs. You will then be able to take the
you will find it very rewarding and and against the base of the skull. Lift skin off the remaining back leg, and by
it is an excellent opportunity to teach your right hand to shoulder height, pulling down, so that the skin is now
children about responsibility and the stretching the rabbit, and pull the head inside out, you will be able to peel the
care of animals and you may be lucky quickly and sharply. If you try to do skin off like a sock.
enough to be able to produce enough this any other way it will not work. The heads, spleens and heart make
meat to sell to your neighbours! The rabbit should then be hung by excellent dog food. The liver is a deli-
*Val Corr, Lake Breeze Farm, Eburru, one back leg. The head is removed. cious delicacy and highly nutritious
Naivasha. If you wish to contact her for The rabbit is gutted and entrails your rabbit is now ready to eat.
further advice, please call 0734 913 049.
Nr. 42 November 2008
To advertise contact: James Wathuge 020 356 4106, 0720 419 584, 0733 893 300, email: thefarmersclassied@mailnew.com.com
Farmers Diary
Brookside dairy farmers training days:
Month Date Venue District
October 31 Mundoro Gatundu South
November 7 Sabatia D.F.Coop Koibatek
November 21 Kathangariri Embu
November 28 Tetu Nyeri South
December 5 Sotik D.F.C.Soc Buret
CONTACT PERSON: S.N. KARIUKI 0733 - 270986
Nr. 43 December 2008
Serve your cows on time The hike in fuel prices in the recent
Lack of knowledge on animal past has demonstrated how greedy local
breeding is to blame for the poor companies can be in their bid to make
quality of dairy cattle in the country. profits at the expense of the common man.
Although fuel prices have gone down by
The Organic Farmer more than half of what it cost two months
Many farmers lack knowledge when it ago, oil companies are unwilling to reduce
comes to managing the fertility of their pump prices by the same margin, which
dairy cattle. This ignorance is to blame has in turn raised the cost of goods and
for irregular calving, low milk produc- services. This is a big burden to consum-
tion and the poor quality of dairy cattle ers and especially the low income earners.
in most farming areas in the country. Farmers are also hard hit by the increase
In this issue of TOF, we have revisited in the cost of inputs. When they produce
the issue of animal breeding following food at unimaginable high costs, it is
enquiries from several farmers. sad to see companies, which operate like
cartels, buying such produce at throw-
Too early or too late. away prices.
The quality of dairy cattle in the country heat. There is another and even worse Yet this is what is happening when
started deteriorating two decades ago problem: Without records, private arti- it comes to the marketing of agricul-
when the government privatised vet- ficial insemination providers may end tural products. If it is not the middlemen
erinary services following pressure up serving the daughter of a cow with exploiting farmers, it is the millers and
from donors. Since then, the quality of the same semen that was taken from its food processing companies. Take wheat
service has considerably gone down. father, resulting in inbreeding. In this for example. Although world prices have
The private service providers do not issue we advise farmers how to detect remained relatively high since last year,
impart any knowledge to the farmers heat in an animal and show the best local millers still buy the commodity
on important aspects of breeding such time to serve it in order to increase the form farmers at very low prices. One
as heat detection in a dairy cow. chances of conception. Page 3 wonders why these companies can afford
What usually happens is that hat the to buy wheat at a price of upto Ksh 4000
farmer may call the servicee in the international market but pay local
provider either too
Cow calendar
This chart
c is a Cow Calen- farmers as low as Ksh 2400 for a 90 kg
early or too late bag of wheat. The companies are quick
dar, it can help farmers to
when chances
hances to increase the price of wheat flour and
manage
m the fertility of
of the animal
imal bread to maintain and maximize their
their
t dairy cows. With
conceiving profits, but they are not ready to pass on
the calendar, a farmer
are minimal.al.
can tell when the cow the benefits to the farmers. One of the
Lack of responsibilities of the National Cereals
will next come on
records and Produce Board (NCPB) is to help
heat, when to dry it
makes it veryy regulate the price of cereals and store stra-
and
a also the date of
difficult forr tegic food reserves for the country. Two
delivery.
d Those inter-
the farmer too decades ago, the board used to buy wheat
ested
es in buying this
know when n from farmers and sell it to millers as is
useful
us calendar can
the cow was as the case with maize. But individuals with
contact
con
last served.
d. vested interest stopped this, leaving the
Fuga Enterprises
Therefore he farmers at the mercy of the millers.
Limited,
Limited P.O.Box 653,
cannot be ablee to Price controls may appear outdated
Uthiru-00605,
Uthiru-00 Nairobi
predict when n the
Tel. 0733 86686 191. Price Ksh200 in a liberalised market such as Kenyas,
animal shall nextext be on but sometimes it is the only way the
government can rein in unscrupulous
Sukumawiki Fodder companies out to fleece farmers. The other
No other vegetable There are several ways to alternative is for farmers to form strong
reduces better the provide your cattle with associations that can lobby for their inter-
occurence of different adequate fodder during ests. Such associations can exert pressure
kinds of cancers. Page 2 the dry season. Page 5 on the companies and on the govern-
ment to change its policies on marketing
of agricultural produce.
Due to the current food crisis everyone
Fish farming now is talking about revitalising agri-
If managed well, fish culture. We hope this is not just empty
farming can easily talk. Finally, we wish all farmers a merry
improve the income of Christmas and a prosperous new year
ce
pm
ur ili
FR
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
30
s
TO
Ki
C
KB
15
Nr. 43 December 2008
Sukumawiki keeps the doctor away
Sukumawiki is not only a cheap
vegetable. It is also one of the healthi-
est with lots of vitamins.
John Cheburet
Kale, popularly called sukumawiki,
is a staple vegetable for most Kenyan
households. In recent years, many
organisations pushed for the planting
of traditional vegetables arguing that
these are more nutritious than sukuma
wiki. But only few people know the
numerous benefits of kales. Some
people consider this vegetable to be
bitter while others treasure it because
it is easy to grow and has numerous
health benefits.
Rich in nutrients
Sukumawiki does well in a well
manured soil and is relatively drought vonoids) called kaempferol. Research When leaves are left for too long, they
resistant, meaning that it can be easily in 66,940 women enrolled in the become coarse and bitter. And, when
grown in most homes across the Nurses Health Study between 1984 buying sukumawiki ensure that you
country. It is a member of the bras- and 2002 revealed that women whose select deep coloured leaves that have
sica family of vegetables that includes diets provided the most kaempferol moist hardy stems. Small leaves are
cabbage, Brussels sprouts and collards had a 40 percent reduction in risk of usually tender and have a more mild
(a cabbage which does not develop a ovarian cancer, compared to women flavour than larger, more mature leaves.
heart). This family of vegetables is high eating the least kaempferol-rich foods. Store sukumawiki in a cool place since
in nutrients that help in fighting and In addition to kale, foods richest in kae- warm temperatures will cause it to wilt
reducing the occurence of different mpferol include non-herbal tea (like and reduce its flavour. In addition, you
kinds of cancers. These nutrients help green tea), onions, broccoli, leeks and can pair kale with other greens, such as
the liver to neutralize substances in the spinach. collard greens, which have a sweeter
body that may be cancerous. Sukumawiki is also good for men. flavor to reduce the strong flavor of
Kale is rich in plant pigments (fla- Recent studies show that those eating kale.
the most cruciferous vegetables (veg- Good for the environment
The Organic Farmer is an independent etables of the brassica family) have a Sukumawiki is good for the environ-
magazine for the Kenyan farming com- much lower risk of prostate, lung and ment. It needs between 5-8 minutes to
munity. It promotes organic other types of cancer. In a study of cook well without losing the nutrients
farming and supports dis- over 1,200 men conducted at the Fred it is known for. This means it requires
cussions on all aspects of Hutchinson Cancer Research Center less energy to cook compared to tra-
sustainable development. The in Seattle (Canada), those eating 28 ditional vegetables which have to be
Organic Farmer is published servings of vegetables a week had a 35 boiled before frying. It is ideal for both
monthly by icipe and distrib- per cent lower risk of prostate cancer, rural areas where there is high demand
uted free of charge to farmers. The reports but those consuming just 3 or more for firewood and in urban areas where
in the The Organic Farmer do not necessar- servings of cruciferous vegetables each there is high demand for charcoal.
ily reflect the views of icipe. week had a 44 per cent lower prostate
The Organic Farmer is sponsored by BioVi- cancer risk. Food safety
sion, a Swiss-based foun- In addition, sukumawiki is useful While sukumawiki has numerous
dation for the promotion of in keeping away other ailments. For health benefits, it is also important
sustainable development. instance, the vegetable has a nutri- to know that a dirty environment is
www.biovision.ch ent called beta-carotene that helps in a major factor that affects the safety
Publisher African Insect Science for Food good vision. This nutrient reduces the of the sukumawiki we plant or buy.
and Health (icipe), P.O. Box 30772, 00100 growth of cataracts that lead to gradual In major towns, across the country, it
Nairobi, KENYA, Tel: +254 20 863 2000, loss of sight. Sukumawiki is a good is common to find green leafy veg-
icipe@icipe.org, www.icipe.org source of the highly valued vitamin C etables planted near sewers.
Editors Peter Kamau, Peter Baumgartner which reduces the likelihood of devel- Dirty water increases the levels of
Secretariat Lucy W. Macharia oping colon cancer. Just one cup of this harmful bugs and bacteria that can
Layout In-A-Vision Systems, 0720419 584 cooked vegetable supplies 88.8% of be found in the vegetable. There is a
Advisory Board Nguya Maniania, icipe, the daily value for vitamin C. Sukuma strong link between diseases such as
Charles Kimani, farmer, Wangige, Joseph wiki is rich in minerals; calcium, potas- diarrhoea and food poisoning caused
Mureithi, KARI, Henry Kiara, ILRI, Christian sium, manganese, iron, and potassium. and the consumption of vegetables
Borgemeister, icipe, Sunday Ekesi, icipe It also contains an insoluble fiber that grown in dirty water laden with germs
Address The Organic Farmer is associated with protection against such salmonella, E coli and listeria.
P.O. Box 14352, 00800 Nairobi, KENYA heart disease in both men and women. Farmers planting vegetables in dirty
Tel: +254 20 445 03 98, 0721 541 590 Select and cook well places risk losing customers as people
e-mail: info@organickenya.com, Cut the lower leaves of plants for sale will not buy vegetables with high
www.organicfarmermagazine.org or your own domestic consumption. levels of dangerous bacteria.
Nr. 43 December 2008
pm
ur ili
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
FR
30
s
TO
Ki
C
KB
15
Nr. 45 February 2009
For me, going organic was the best decision
To change from conventional to people in the villages do not care about
organic farming is a challenge. Amos the nutritional value of their food; they
Guandaru Nganga has managed it. just want something to eat, he adds.
In order to be able to sell his produce
Anina Bondeni as organic and get a better price for it,
since they are of higher value, Nganga
It is a great challenge to try new pro- would have to follow the documented
duction methods, especially in agri- Standards of Organic Production and
culture, where farmers are always to have his land certified as organic by
concerned about losing their precious a recognized certification body. For a
crops if they changed. Nevertheless, long time all certification of produce
it is also worthwhile to try, since the was carried out by international certi-
benefits can be immense, sometimes fiers only. But in July 2005, a certifica-
improving soil fertility as well as your tion company for the local market was
harvest - and maybe even income. established to provide certification to
Amos Guandaru Nganga is a great local farmers at an affordable cost. This
example of a man who took this chal- certifying body is called EnCert.
lenge and benefitted a lot from it. International statistics show that con-
Farming with TOF in the pocket sumption of organic produce is increas-
Amos is a full-time small-scale farmer ing due to better consumer aware-
from Subukia valley. For the past sixty ness. Organic certification could be a
years he was used to farming the con- good investment. Both local and export
ventional way with chemical fertil- markets of Kenyan organic products
izers and pesticides. Then, four years are yet to be tapped.
ago and at the age of 66, a friend gave For many organic small-scale farmers
him an issue of The Organic Farmer Amos Guandaru Nganga changed to however, certification is still too expen-
magazine. After reading it carefully, organic after reading The Organic Farmer sive. But costs can be greatly reduced
he immediately decided to change to In one week, he had already put if farmers came together and paid for
organic farming as he realized that it together enough material to make certification as a group. Working in
would be much healthier for him and his first heap of compost, following a group has other advantages: Since
his family. Moreover, he understood every step as outlined in a TOF article most of the buyers of organic food live
that he would save a lot of money if How to make compost. Amos says: in urban areas, the members of a group
he used compost instead of chemical I kept the article in my pocket while could save on transport costs (see our
fertilizers. working on the compost heap! When article about successful avocado-grow-
we visited Nganga and the members ers in Subukia valley in the March-2009
The Organic Farmer is an independent of his farmers group some weeks ago, issue of TOF).
magazine for the Kenyan farming com- he showed us, with pride, his well-
munity. It promotes organic maintained compost. He had covered
farming and supports dis- it carefully with a plastic sheeting to
cussions on all aspects of prevent sun-drying and keep it moist.
sustainable development. The He has also adopted several methods
Organic Farmer is published and tips he acquired from reading
monthly by icipe and distrib- articles in TOF magazine. He is prac-
uted free of charge to farmers. The reports tising the push-pull method which is
in the The Organic Farmer do not necessar- aimed at controlling stem-borer in his
ily reflect the views of icipe. maize crop and providing fodder for
The Organic Farmer is sponsored by BioVi- his cows apart from fixing nitrogen in
sion, a Swiss-based foun- the soil. He is also rearing rabbits (see
dation for the promotion of
sustainable development.
TOF No. 42 of November 2008 and No.
26 of July 2007) to provide his family TOF celebrates
www.biovision.ch with good and healthy meat. fourth birthday
Publisher African Insect Science for Food However, the change from con- In April 2004, we launched your mag-
and Health (icipe), P.O. Box 30772, 00100 ventional to organic farming comes azine, The Organic Farmer. In view
Nairobi, KENYA, Tel: +254 20 863 2000, with an increase in labour input, of the commemoration of this event
icipe@icipe.org, www.icipe.org Amos says. But it was the right deci- in April, we shall publish a short
Editors Peter Kamau, Peter Baumgartner sion. I noticed an immense increase in series on farmers groups in Subukia
Secretariat Lucy W. Macharia harvest, in addition, I save money by valley as an example of all the farmers
Layout In-A-Vision Systems, 0720419 584 using compost instead of the expensive groups we are dealing with. How has
Advisory Board Nguya Maniania, icipe, chemical fertilizers, he says. TOF influenced their farming methods
Charles Kimani, farmer, Wangige, Joseph Marketing problems and their social life? And what is the
Mureithi, KARI, Henry Kiara, ILRI, Christian The only disadvantage is that Amos experience of Charles Munyari, a TOF
Borgemeister, icipe, Sunday Ekesi, icipe Nganga has to sell his products to distributor since the inception of the
Address The Organic Farmer the local buyers for the same price magazine?
P.O. Box 14352, 00800 Nairobi, KENYA as conventionally-grown fruits and In the first article on this page
Tel: +254 20 445 03 98, 0721 541 590 vegetables. Mine are more nutritious, we shall talk about Amos Guandaru
e-mail: info@organickenya.com, tasty and healthy, he says. I should Nganga, who has changed from con-
www.organicfarmermagazine.org be selling them at a higher price. But ventional to organic farming.
Nr. 45 February 2009
1. Prepare a horizontal trench on the cm or diametre) is then inserted into the digester and an
ground in a good part of the farm preferably near the air-tight joint made using rubber straps. (You can cut this small
zero-grazing unit. The trench will enable the polythene piece from the PVC pipes which will eventually be used to
tube to hold the digester in place. The trench should be deliver the gas from the digester tube to the jiko (kitchen).
trough-shaped with a top width 4. The digester is then laid horizontally into the trench with the
of 65 cm, a bottom width of 50 cm, inlet, outlet and gas tube facing upwards.
a depth of 65 cm. The length of 5. The cow dung accumulated over time is mixed with water at
the digester is variable depending a ratio of 1:2 and the mixture poured into the digester through
on the number of animals but a the inlet pipe until the digester is about three quarters full; this
digester measuring 8 to 10 m long usually occurs when the mixture starts flowing from the outlet
is recommended for a 2-cow or pipe.
8-pig unit. The trench should have firm sides to avoid 6. The external end of the 30 cm-long
soil from collapsing, and a gentle slope on the floor pipe is then fitted to other PVC water
(about 5 percent) to ensure outflow of exhausted slurry. pipes using elbow joints. These pipes
2. The two sides of the digester are fitted with the 4 will eventually deliver gas from the
PVC pipes measuring about 1 m to serve as inlet and digester to the kitchen.
outlet for the slurry. The PVC 7. It takes two or three days for the
should be tied to the digester dung in the digester to start pro-
using rubber straps made from ducing gas. Once the digester starts
old vehicle tubes. Biogas cannot swelling, this is an indication that it
escape through these pipes since is producing biogas. To ensure con-
the pipes remain immersed in the tinuous gas production, the system
dung inside the digester. should be fed with about 1 to 2
3. A small hole (about one centi- buckets (the normal 20-lt capacity)
metre in diametre) is punctured through the wall of the with the same mixture of cow dung
digester about 1 metre from the inlet end. A small piece and water (ratio of 1: 2) daily.
(about 30-cm long) of the normal PVC water pipe (1.2 8. The digester should be covered
with light materials such as grass
straw and maize stalks to protect
Budget for a biogas unit it from direct sun rays (ultra-vio-
10 m polythene tube (1000-mm gauge), black let radiation). A fence of fine wire-
or white, 90 120 cm diameter, @ Ksh 250 per 2,500 mesh or closely spaced wooden slats
meter should be used to protect the digester from damage by chil-
* Two 4diametre PVC pipes, 1 m long(like the dren, pets and livestock. The plastic digester should be handled
ones used for pit latrine ventilation but prefer- 750 with care.
ably of a stronger gauge) Photos courtesy of JuaNguvu of their demonstration plot in Mombasa.
JuaNguvu PO Box 1779 - 80100 GPO Mombasa Tel: 0722 87 37 38
3 PVC water pipes ( diameter) for the delivery email: info@juanguvu.com
of gas (from digester to kitchen) @ Ksh 250 per 750
piece Important tips for biogas users
5 PVC elbows @ Ksh 25 125
Careful handling: The plastc digester should be handled with
Rubber straps for tying the 4 PVC pipes and the care. It should be covered and protected. The inlet and outlet
100
inch gas pipe into the digester @ Ksh 20 should be airtight as well as the gas outlet.
A burner or jiko (made by jua kali artisan) incl.
1,000 Regular feeding: A 5 m3 digester requires 19 kg of cow dung
valve
**Total costs (without labour) 5,225
and 47-57 litres of water to produce enough gas for a day.
Under-feeding reduces the amount of gas produced. If a green-
* You can hardly get 1m-pieces of a 4 PVC inlet looking slurry comes out of the digester, this is an indication
and outlet pipe; a full pipe costs between Ksh 600 - that it is overloaded.
1,200, depending on the quality. If three farmers come Cow dung: Cow dung is the ideal substrate for bio-digesters
together, they can buy 1 pipe normally 6 m long (20 because it is not acidic. If livestock wastes and garbage have to
feet) and share the piece including transport costs. be used, cow dung should be used as a starter substrate.
** If the digester is protected with wire mesh then an Effluent recycling: Recycling some of the digested slurry
additional Ksh 1,500 is required improves the performance of the bio-digester. This is important
Material (in Ksh; prices from Embu) when the digester is still new because the used slurry contains
Continued on page 6
Nr. 45 February 2009
from page 5: Biogas
020 445 03 98 0721 541 590 0738 390 715
from page 3: Planting planting. will help to provide the needed nutri-
Vegetative stage: From the eighth to ents. When maize is about to tassel,
the tenth day, the plant develops two farmers can apply Vitazyme at the rate
leaves and also the first roots also called of litre per acre (Lachlan) Synegizer
the fibrous roots. At this stage the plant (Juanco).
will have finished all the food reserves Do a trial
within itself but the two leaves help Farmers can also select a small portion
it to make its own food using the sun of their land and try the two methods
rays in a process called photosynthesis. of fertilizer application. After getting
growth stages. The plant roots also start taking nutri- the results, they can go into large scale
Germination stage: Once planted in ents from the soil to feed the plant. production using the best method.
moist soil, the seed breaks its dor- Unless these nutrients are provided Read the labels on the fertilizers and
mancy and starts germinating. During (for instance in a well composted soil), foliar feeds carefully to ensure you
this period (normally seven days), the growth will be stunted and the plant is apply them in the correct way.
plant gets all its nutrients from food prone to diseases and even pests. For To get more detailed information,
stored within itself. Therefore it does this stage, farmers can use Vitazyme at farmers can contact the companies
not require any fertilizer for growth. the rate of litre per acre or TwinN at selling the organic fertilizers and foliar
After the 7 days, the plant will require the rate of vial for every one acre of feeds we have mentioned here. Their
extra feeding and also some protec- maize (Lachlan) alternatively they can addresses are given below:
tion from diseases. To provide essen- use or Synergizer or Phosgard (Juanco). Lachlan Kenya Limited, P. O. Box
tial nutrients farmers can top-dress the Application of these foliar feeds should 49470, Nairobi, 00100, Old Airport Rd.
seeds with 1.5g of Eco-T (Lachlan) per be done in moist conditions for proper Tel. 020 207 3912 , Cell 0722 209474.
kilogram of seed. They can also add a absorption by the plant. Hygrotech (EA) Ltd P.O Box 41446,
diluted solution of Vitazyme (Lachlan) Fruiting stage: At this stage that the 00100 Te. 020 205391 cell.0722 390207
at the rate of 1 litre for every 50 kg of plant is in need of extra feeding to (EA) P.O Box 381, 00502 Karen, Nairobi
seed. Fulvic acid is also essential for produce the required size of grain, Tel. 0722 827 987.
the germinating seed (Lachlan, Hygro- weight and other desired qualities. It Juanco Centre, Ngong Rd, Ngong
tech). The seeds should be thoroughly should therefore be fed with all their Hills, P.O.Box 381 Karen, 00502, Tel.
mixed and dried in sunlight before fertilizer requirements nutrients that 254 -45-41209, 40206.
Nr. 48 May 2009
Mbaazi repels red spider mites If you have been reading newspapers,
watching television or listening to the
radio in the last few months, you may
have realised one thing: Well known
agricultural organisations worldwide,
experts in agriculture and governments
have recognised the special role small-
scale farmers will continue to play to
ensure food security in future. Poor
countries with a large population who
can no longer feed themselves rely on
small-scale farmers to meet their food
requirements. But when we compare the
nice promises with the reality, things
look quite different, at least in Kenya.
Let us give some examples:
- Due to corruption, small-scale farmers
Did you know that a row of pigeon peas (mbaazi) can protect your crops from harmful who have tried to get the subsidized
pests such as spider mite? Read more about natural pest control methods on page 3 fertilizer from The National Cereals and
Produce Board have been unable to buy
Pages 4 & 7
8. ay r vi
8. Th wah o
to sd se
i
ad
pm
ur ili
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
FR
30
s
TO
Ki
C
KB
15
Nr. 48 May 2009
Lupins are good fodder for your livestock
Farmers have many
methods to improve the livestock feed,
for instance with lupin seeds.
John Cheburet
As farmers in Kenya continue to grapple
with the high cost of animal feeds, a
crop not yet known to most farmers
is slowly taking root as a preferred
protein supplement for dairy farmers.
This is lupin, a leguminous plant. Like White lupin beans (above); a flowering
most members of this family, lupins lupin plant (right) (Photos TOF)
can fix nitrogen from the atmosphere vest are late maturing. They take 6-7
into ammonia, fertilizing the soil for months to mature.
other plants. White lupins (Lupinus albus) The
There are two types of lupin; bitter major variey is Ultra. It takes 4-5 months
lupins and sweet lupins. Bitter lupins to mature. Ultra is a good seeder giving
are used for soil regeneration and up to 6 tons of dry seeds per ha per
cannot be used for feeding livestock year while Uniwhite and Uniharvest
because of poisonous alkaloids found are high in herbage yields giving about
in the leaves, pods and seeds. Sweet 4 tons of dry matter yields per ha.
lupins pose no dangers of poisoning According to Frederick Wambiru
livestock because of low percentage of of KARI Ol Kalau, the Ultra variey
alkaloids. Sweet lupins can be grown has been under trial and has shown
anywhere in the highlands where rain- satisfactory results. The centre is now
fall is over 900mm in a year. in the process of bulking the seeds for
There are two cultivars of the sweet farmers.
lupins Nutritional Composition
Blue lupins (Lupinus angustofolius). The composition of the grain and espe-
Major varieties are Uniwhite, Unihar- cially the high protein content makes
vest and Unicrop. Unicrop is early white lupin highly suitable for animal
maturing variety. It takes 3-4 months diets as a protein-rich product. Lupin 1-2 years to avoid soil borne fungal
to mature. Unishite and and Unihar- seeds are a product of nutritional diseases.
importance due to their high protein Start to harvest when the pods begin
The Organic Farmer is an independent content (37%), soluble fibre (35.5%), to change colour from green to yellow,
magazine for the Kenyan farming com- crude fibre (13%), fats (10%) and ashes and the lowest leaves begin falling off.
munity. It promotes organic (4%) as well as acceptable levels of 1/2 acre produces 4 to 6 bags of lupin
farming and supports dis- thiamin, riboflavin and vitamin E. seed, which will be enough to feed 1
cussions on all aspects of As an animal feed, Wilson Wekhulo dairy cow for 1 year.
sustainable development. The of KARI Kitale says that lupin is used If lupin is intercropped with maize,
Organic Farmer is published together with maize as a home made 1/2 acre can produce about 2 to 3 bags
monthly by icipe and distrib- alternative to dairy meal for farmers of lupin seed, which with 6 to 9 bags of
uted free of charge to farmers. The reports keen on getting more milk while reduc- maize can feed a dairy cow for 3 to 4
in the The Organic Farmer do not necessar- ing the cost of animal feeds. months.
ily reflect the views of icipe. Preparation and planting After harvesting lupin pods should
The Organic Farmer is sponsored by BioVi- Prepare land like for maize and be dried and threshed like beans.
sion, a Swiss-based foun- beans, so as to have a uniform, firm soil Utilization
dation for the promotion of that will maximize germination. The To prepare the animal feed, the seeds
sustainable development. land should also be level and free of are ground with maize seed in the ratio
www.biovision.ch depressions to permit uniform depth of 1:3 (1 gorogoro of lupin seed and 3
Publisher African Insect Science for Food of seed placement. gorogoros of maize grain). 1kg of this
and Health (icipe), P.O. Box 30772, 00100 Plant early to avoid heat and water supplement can substitute 1kg of dairy
Nairobi, KENYA, Tel: +254 20 863 2000, stress during flowering and pod fill. meal.
icipe@icipe.org, www.icipe.org Plant Lupin seed at a spacing of 45 Feed 2 kgs of the the mixture per
Editors Peter Kamau, Peter Baumgartner cm between rows and 30 cm between medium cow per milking. Fresh
Secretariat Lucy W. Macharia plants. herbage can also be used as a livestock
Layout In-A-Vision Systems, 0720419 584 Use 1 to 2 handfuls of compost or feed.
Advisory Board Nguya Maniania, icipe, farm yard manure per hole. Lupin can Introduce the mixture gradually for
Charles Kimani, farmer, Wangige, Joseph also be planted between maize rows at cows being fed with lupin for the first
Mureithi, KARI, Henry Kiara, ILRI, Christian a spacing of 30 cm from hole to hole time. Add a little mineral salt, molasses
Borgemeister, icipe, Sunday Ekesi, icipe Plant 2 seeds per hole or other feed to the mixture to encour-
Address The Organic Farmer Management and Harvest age the cow to start eating it.
P.O. Box 14352, 00800 Nairobi, KENYA Keep the field free of weeds by Interested farmers can get small quantities of
Tel: +254 20 445 03 98, 0721 541 590 regular weeding. seeds for bulking purposes from The Officer in
e-mail: info@organickenya.com, White lupin is relatively tolerant to Charge, KARI Ol joro orok,
www.organicfarmermagazine.org diseases. However, rotate lupin every Telkom wireless number 020 2026510
Nr. 48 May 2009
on parasites immune system, an indication of stress progress, especially with mange mites.
Pyrethrum: Pyrethrum is very effective
External and internal para- or poor nutrition. Animals that repeat-
edly have problems with external para- against mites and lice. It contains pyre-
site infestation are a serious sites often have some other underlying thrin that kills insects on contact and
problem among livestock problems, perhaps internal parasites. can be used in liquid or powder form.
keepers. However there are various The weakest animals (and thus the Soap: Soaping animals removes the
methods farmers can use to protect most stressed) are the most likely ones waxy cuticle that protects insects and
their animals against them. Starting to develop parasite problems. mites from drying out. It kills lice and
this month, we will bring you a short Clean the environment off harmful mites, but repeat treatments will be
series of articles on parasites and how pathogens and livestock parasites with necessary, especially with heavy infes-
to control them. In this issue we give a proper waste management and recy- tations. Repeat the treatment in one
you tips on external parasites such as cling of biodegradable materials. week to do away with the lice from
fleas and lice. In our June issue we will Use clean equipment for watering newly hatched eggs. Use pure soaps
feature the control of ticks in livestock and feeding. and avoid detergents.
and in July we will give you tips on Free-range chicken and ducks in the Plant oils: A thin coat of vegetable
internal parasites. compound are an ecological control oil in the affected area will suffocate
continued on page 6
Nr. 48 May 2009
from page 5: Parasites
insects and can probably kill 020 445 03 98 0721 541 590 0738 390 715
insect eggs. Apply a light coat
of oil to the areas of infestation.
Also run oil along the neck and
Do you want your own TOF copy?
spine to cover some of most Since we started publishing The Organic Farmer magazine, we have always insisted that it
commonly infested areas. As should be shared among members of farmers groups across the country. Apart from reach-
with soap, repeat treatments ing so many farmers, the idea behind this distribution system was that this would encour-
may be necessary. One can also age you to come together, read the magazine and share the ideas, tips and new farming
use various essential oils such methods featured in each new issue.
as anise, camphor, eucalyptus, The system would require well-organised farmers groups that hold regular meetings.
rosemary etc.: 1 part of each Such groups should build up a file with all issues of TOF to ensure that the few copies they
with 2-3 parts of any other oil. receive are well-stored. This method would enable any member wishing to get information
Good results are attributed to on a particular topic covered in one of the magazines to borrow the file and make refer-
raw linseed oil, applied with a
stiff brush. ence. While some groups have adopted this system, many others have not been able to
Neem Oil: The neem tree is keep all the copies in a way that is accessible to other members. Some groups chairmen
the source of this natural pes- rarely share the magazines with other members and distribute them within their extended
ticide. A combination with oil family. Others prefer to give copies only to a section of the members denying others a
is effective against all external chance to read.
parasites. This is one reason why farmers from many parts of the country keep calling us to send
Aloe: Crush the leaves of aloe them a particular issue of the magazine which we produced months ago; most of which
and sisal plant leaves and extract have run out of stock. Other farmers would like to keep the magazines to themselves for
juice to make equal portions of reference when they need it. We understand the problem, but this goes against the spirit
juice. Mix with 10 litre of water and purpose of the magazine: That each copy should be read by at least seven to nine
and leave for 2 days. Apply the
people, as is the case at the moment.
mixture on the animals once a
day for 2 days to control lice and In the past few weeks we have received more than 300 fresh applications from individual
mange. farmers who want to get their own TOF copies. We have stretched our resources to the
limit: Even after raising the circulation to 18000 copies, we have realised that we are unable
Fighting leeches
Leeches affect livestock that to meet the demand from farmers. Very few copies remain for our own use in the office,
drink in shallow water. They which means that we can no longer send more copies to new subscribers. Our budget has
suck a lot of blood from the now risen to more than Ksh14 million a year.
animal by attaching themselves To overcome this problem, we are starting a new subscription service for farmers. Those
to the lining of the mouth or who wish to receive their own copies can pay a yearly subscription fee of Ksh 840. With this
throat. To remove leeches, use amount TOF will cost you only Ksh 70 per month. This is a negligible amount of money com-
alcohol, salt, soap, or lemon pared to the value of information and the knowledge you will acquire from the magazine.
juice or just pull them off. The We will not make any profit from this subscription fee because this is exactly what we pay
best way is to slide your finger- for the production of one copy in one year. Of course, we know that this new service will
nail under the front and tag on increase our administrative burden. We will accept only yearly payments, from January to
the tail to gently cause the leech
to break the suction from the December. If a farmer would like the individual TOF for this year, he has to pay Ksh 490 by
animal. This method substan- end of May to get TOF from June to December 2009. Immediately we receive the payment,
tially reduces the risk of bad we will start sending you the copies. Renewal of subscription for the year 2010 has to be
infection. done by end of December 2009. You can send the money through M-pesa to our special
Tobacco: Mix 50g of tobacco subscription telephone number 0717 444 405. Send in a separate sms your name and full
powder (snuff) with litre of address.
water and flush the animals Farmers groups will continue to get their TOF copies free of charge. But they will have
mouth with the mixture.The to prove that their groups really do exist. Groups applying for copies should include a
leeches will detach and fall off. photocopy of the registration certificate together with some details such as the number of
members (men and women), describe how their group operates, including their manage-
ment (their full address and, if possible, their mobile phone numbers).
The big demand for The Organic Farmer is a good sign for us, the TOF team as well as
you the farmers, this is a sign that you are interested and willing to improve your farming.
We will do our best to fulfill these expectations. The Editors
Take farming
as business
The Kenyan farmers face many prob-
lems. Of course, many difficulties they
are confronted with are beyond their
scope. But with commitment, encourage-
ment and with cooperation, they could
solve so many of these problems on their
By The Organic Farmer
own. Before, many Kenyan farmers
relied on the National Cereals and
Produce Board and the cooperative
movement to market their produce. But
with the liberalisation of the agricultur-
Harvest season: Happy boys carry home their bean produce. (Picture : Kamau) al sector they were caught flat-footed.
They now find it increasingly difficult
The war against pest damage to cope with the changing market
demands. Most farmers will harvest
Not all Kenyan farmers can take home human health and the environment their produce and keep it in their stores
a big harvest like the boys in the picture some of which is difficult to reverse. waiting for buyers. In most cases these
above. Many of them incur huge losses Indeed, consumers are becoming buyers are middlemen out to make a
due to pests. more and more sensitive to chemicals quick profit and who often offer prices
applied during food production. far below the prevailing market prices.
By The Organic Farmer There are many methods a farmer Of course transport costs to markets
can use to control pests without may be high due to the bad state of the
resorting to the use of synthetic pes- roads. But why are farmers not taking
Every year, farmers in Kenya lose bil- ticides. Intercropping for example is their own initiative? Why they are not
lions of shillings following the one (see page 5). Another one is coming together to share transport costs
destruction of their crops by pests. Pyrethrum. In this issue (on page 8) to exploit the available market opportu-
Although many of them use chemical we have featured various cost effec- nities?
pesticides for control, they are now tive methods of making Pyrethrum In the last issue we heard the com-
losing the war because most of the extracts.
pests have developed resistance to the plaints of farmers in Nyeri who had big
chemicals. Besides inorganic pesti- Preventive measures problems selling their cabbages. The rea-
cides are causing great harm to It is a fact that many farmers already son why is very easy to explain: So
have some indigenous knowledge on many farmers are planting the same
how to control pests without the use crops, and there are not enough cus-
of harmful pesticides. However they tomers to buy them. Who is to blame?
need to supplement these with addi- The customers? The farmers? Our
tional information in order to pro- Farmers are rarely market driven. This
mote effective pest management has to change. A manufacturer of
In this issue strategies in their farms. Know your pumps for instance has to look for what
pests and their natural enemies! The the customers need, and he has to mar-
Benefits of a useful herb accurate identification of the species, ket his own products otherwise he will
Comfrey is good for human life cycle, habitat requirements, time soon go bankrupt. There is no big dif-
and plant health. Page 2 and location of occurrence form an ference with farmers. In order to remain
important part of the knowledge of competitive, what the farmers need to do
Fighting hunger and poverty pests and natural enemies is indispen- is to take farming like any other busi-
A slum women group reclaims sable for long-term pest manage- ness. Farmers should be able to balance
a refuse site to grow food. Page 4 ment.
Crop rotation, timing of planting between their subsistence and market
and harvesting periods, planting of needs. But most important of all, they
Make your plant extract should change their attitude and way of
How to prepare a pesticide for nat- trap crops and choice of crop vari-
ural pest control at home. Page 8 eties do play an important part in pest doing things in order to realise the full
control. benefits of farming.
2 The Organic Farmer Nr. 5 August 2005
transfer the diseases to their farms. increase in fungal diseases. With crop
Another reason for the declining rotation and field sanitation, farmers
production is poor management by can effectively prevent and control these
farmers which has led to the spread of diseases.
diseases. Farmers rarely observe field Our farmers are really struggling
sanitation; all diseased leaves, vines to better their income, and they are
and fruits should be removed and hard working. But working hard is not
burned or buried in a pit to stop the enough; they need to have the right
disease from spreading to the healthy skills to do things the correct way. Since
plants. Old unproductive shoots and farming is a business, farmers have
infection from one plant to the other. to adopt the best methods to increase
deadwood must be removed. All the To avoid a build-up of soil-borne dis-
equipment used for pruning should production and avoid incurring losses.
eases, passion fruit growers should This not only needs an intensive search
be disinfected to avoid spreading viral ensure that they practise crop-rotation. for more knowledge on how to grow
in this issue Passion fruits should not be grown on crops such as passion fruits. But it
the same piece of land for 2- 3 years to also requires effort to look around for
Medicinal plants 2 keep it free of diseases. A wide range
Farmers in Kakamega earn more certified seedlings. To buy them from
of vegetables can be intercropped with roadside nurseries might be the easiest
from Medicinal plants. passion vines such as beans, cabbages, way; they are near and one can avoid
Tick Control 4 tomatoes, potatoes, beetroot, Swiss the transport costs to well known and
Ticks cause huge losses to farmers. chard, carrots, strawberries, leeks recognised nurseries. But this short cut
Learn alternative control methods. and head lettuce. However, plants in will cost them dearly, because even the
Breeding 7 the pumpkin family (cucurbits) such best farmer cannot expect to get a good
Do you need a high yielding dairy as pumpkins and squash should be crop when the seedlings are already
cow? See our list of breeders avoided as they bring in diseases such infected with disease.
ce
pm
ur ili
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
FR
30
s
TO
Ki
C
KB
15
Nr. 49 June 2009
Medicinal plants bring fortune to farmers
Mondia and ocimum hangovers: A group of farmers who the medicinal products began about
kilimandscharicum plants are a source have domesticated the highly threat- eight years ago, reliance on the forest
of income for Kakamega farmers. ened medicinal plant, known locally has decreased, allowing better forest
as Mkombela (Mondia whytei), used conservation.
Anja Bengelstorff to collect and sell the roots locally. The Community enterprise
plant is widely distributed in tropical James Ligale, assistant administrator of
Before they started conservation work Africa. In Kenya, it is more preva- the Mondia community enterprise, said
in Kakamega forest in western prov- lent in the remnant tropical rain forest a group of
ince of Kenya, it was just one of the fast of Kakamega. Mondia whytei is also 30 farmers,
disappearing tropical rain forests in known as mondia, or Whitess ginger. known as
Africa, exploited for firewood, timber, It is a vigorous climber (3-6 m high) the Muliro
charcoal and building posts. But now with attractive heart-shape leaves and Farmers,
the African Insect Science for Food a vanilla aroma. w e r e
and Health (ICIPE) must be proud of involved in
Remedy for flu
their conservation efforts. They have the initial
Another group of farmers is involved
not only managed to save the forest, domestica-
in the domestication of the medici-
they have also shown the surround- tion of the
nal plant Ocimum kilimandscharicum,
ing farming community the benefits of mondia
commonly also known as kilimanjaro
conserving its rich biodiversity while p l a n t ,
basil, camphor basil, hoary basil or
exploiting its resources to improve which takes Mondia whytei
feverplant. A leaf extract from the plant
their liveslihoods. six months
is used in the manufacture of a balm
The forest is host to many medicinal to mature. These farmers have since
and an ointment used to treat flu, cold,
herbs; among these are the mondia encouraged outgrowers to cultivate the
chest congestion, aches, pain and insect
and Ocimum kilimandscharism. For cen- plant, which is processed at the factory
bites.
turies the local communities had used MFCG Enterprise Shinyalu, built with
Ocimum kilimandscharicum is one of
these plants to treat various ailments. financial assistance from international
the species of the genus of the Ocimum
But it was not until the ICIPE came donors.
plant that is native to East Africa. It is
to the area that the community rea- Products of these medicinal plants
an evergreen aromatic perennial under
lised that they had been sitting on that are currently available at super-
shrub. It thrives as a natural rounded,
gold; the medicinal plants could be markets like Nakumatt are Naturub
woody shrub that can grow to a height
processed and sold in the markets, Balm and Naturub Ointment (30
of up to 2 m. It has an efficient rooting
locally and abroad. A powder devel- grams, Ksh 179, against muscular
system and perennial habits which
oped from Mondia whytei is used as aches and pains), made of Camphor
prevent soil erosion where it is grown.
a revitaliser, appetizer and clearer of from Ocimum kilimandscharicum as
The plant requires little management
in the field and no pesticide control. the main ingredient. The root barks of
The Organic Farmer is an independent We believe the project has a major mondia are processed wholly to make
magazine for the Kenyan farming com- role to play as a model for conservation Mondia Tonic.
munity. It promotes organic or biodiversity and in the improve- Additional income
farming and supports dis- ment of the livelihoods of communi- The farmers harvest the plants three
cussions on all aspects of ties living near the forest, says Wilber times a year and earn three times more
sustainable development. The Lwande, ICIPE leader of the Applied from mondia or Ocimum kilimand-
Organic Farmer is published Bioprospecting Programme. It is also scharicum than they did cultivating
monthly by icipe and distrib- one of the ways of enabling indigenous crops like maize and tea. On average,
uted free of charge to farmers. The reports traditional knowledge to be useful to a farmer makes Kshs 35,000-40,000 a
in the The Organic Farmer do not necessar- humankind before [that knowledge] is year from one acre. The cultivation
ily reflect the views of icipe. entirely lost. According to ICIPE, this of O. kilimandscharicum does not
The Organic Farmer is sponsored by BioVi- is a new venture that is developing a involve external inputs like fertilizers,
sion, a Swiss-based foun- sustainable financing plan and with pesticides or insecticides. However,
dation for the promotion of measures to increase farm productiv- Evelyn Ndenga from ICIPEs Applied
sustainable development. ity to enable farmers to exploit the Bioprospecting Programme points out
www.biovision.ch potential markets. The total asset base that farmers around Kakamega forest
Publisher African Insect Science for Food for both community groups amounts still grow maize, beans and other food
and Health (icipe), P.O. Box 30772, 00100 to Ksh 7.5 million, including buildings crops. Cultivating those medicinal
Nairobi, KENYA, Tel: +254 20 863 2000, and equip- plants was meant to provide supple-
icipe@icipe.org, www.icipe.org ment. mentary income and reduce depen-
Editors Peter Kamau, Peter Baumgartner Communities dency on the forest, she says. Cur-
Secretariat Lucy W. Macharia living near the rently, nearly 1,500 farmers within four
Layout In-A-Vision Systems, 0720419 584 forest relied on districts around Kakamega forest grow
Advisory Board Nguya Maniania, icipe, it for firewood, the two plants.
Charles Kimani, farmer, Wangige, Joseph building mate- Ligale said those who previously
Mureithi, KARI, Henry Kiara, ILRI, Christian rials and lived in grass-thatched houses now
Borgemeister, icipe, Sunday Ekesi, icipe various herbs. have better homes; awareness about
Address The Organic Farmer However, environmental conservation has
P.O. Box 14352, 00800 Nairobi, KENYA since com- improved. Many local people now seek
Tel: +254 20 445 03 98, 0721 541 590 mercial cul- computer and business management
e-mail: info@organickenya.com, tivation and skills to improve their production and
www.organicfarmermagazine.org processing of Ocimum kilimandscharicum marketing.
Nr. 49 June 2009
Dear farmers,
This is the last issue of the The Organic
Farmer this year. In the last 12 months,
many of you have faced a number of
challenges in your efforts to increase
agricultural production, both for food self-
sufficiency and for sale. Despite it being
the festive season, many farmers are
already engaged in harvesting maize and
related food crops. That's why we have
given additional tips on maize storage. It
will be most unfortunate if farmers lose
their precious crop after working so hard
during the last 12 months.
Farmers lose a lot due to poor storage. (Photo courtesy of ICIPE) Now the year is coming to an end.
$GPGHKVUQH RTQRGTOCK\GUVQTCIG
What does it mean to you? First of all it
is helpful and always important that
farmers take stock of failures and
Early harvesting and good
(#1 HCTOGTUKP#HTKECNQUGDGVYGGP achievements. This gives you an
storage can reduce losses and VQ RGTEGPV QH VJGKT JCTXGUV VQ opportunity to evaluate yourself so as to
increase earnings for farmers. RGUVU 6JKUECPDGCXQKFGFKH QPN[VJG[ perform even better in the coming year to
EQWNF VCMG C HGY UKORNG OGCUWTGU VQ avoid the same mistakes. The decisions
The Organic Farmer UVQR VJG NQUU ECNNGF RQUVJCTXGUV you make today will have consequences
NQUU FWTKPIUVQTCIG tomorrow.
+PQTFGTVQRTQVGEVVJGKTJCTXGUV OCP[ /CP[DW[GTU OKNNKPIEQORCPKGUCPF
HCTOGTU KP -GP[C DWKNF YGNNUGCNGF After selling farm produce, farmers
VJG 0CVKQPCN %GTGCNU CPF 2TQFWEG need to focus sharply on the tasks ahead.
UVQTGU VJCV ECPPQV DG DTQMGP KPVQ D[ $QCTFQHVGPTGLGEVRQQTSWCNKV[OCK\G
VJKGXGU $WV VJG[ HQTIGV QVJGT HQTEKPI HCTOGTU VQ UGNN KV CV NQYGT A lot of financial requirements will be
VJKGXGUCNTGCF[YCKVKPIKPVJGUVQTGU RTKEGU VQ OKFFNGOGP 6JKU KU OCKPN[ waiting for you, such as land preparation,
6JGUGKPENWFGYGGXKNU VJGNCTIGTITCKP FWGVQRQQTJCTXGUVKPICPFUVQTCIG farm inputs and even paying school fees in
DQTGT QT l1UCOC CPF GXGP OQWNFU the month of January. You may also have
VJCV EQPVCKP FGCFN[ RQKUQPU UWEJ CU Early harvesting is the answer various debts that need to be settled. All
CHNCVQZKP /CP[RGQRNGFKGFKPRCTVUQH .QUUGUCNYC[UDGIKPKPVJGHKGNF +VKUC these obligations mean that you have to
-KVWK FKUVTKEV NCUV [GCT CHVGT GCVKPI RTCEVKEGCOQPIOCP[EQOOWPKVKGUKP plan properly in order to meet all these
RQQTN[ UVQTGF OCK\G VJCV EQPVCKPGF -GP[CVQYCKVHQTVJGUEJQQNJQNKFC[U responsibilities.
CHNCVQZKPU VQ UVCTV JCTXGUVKPI 1H EQWTUG YG Everyyear farmerswho do not prepare
%CP[QWKOCIKPGDW[KPIHGTVKNK\GTU WPFGTUVCPFVJCVUOCNNUECNGHCTOGTUCTG
UGGFUCPFVGPFKPI[QWTOCK\GETQRCNN their activities carefully are caught up in a
PQV CDNG VQ RC[ HQT QWVUKFG NCDQWT vicious cycle of problems. Planning is an
[GCTTQWPF QPN[VQJCXGKVFGUVTQ[GF 6JKUKUVJGTGCUQPYJ[VJG[FGRGPFQP
D[RGUVUCHVGTJCTXGUV!;GVVJKUKUYJCV important step to avoid troubles later in
VJGKTEJKNFTGPHQTJCTXGUVKPI the year. Careful choice of what to plant
JCRRGPU VQ OCP[HCTOGTU GXGT[[GCT $WVVJKUYKNNCNTGCF[DGVQQNCVG #V
#EEQTFKPI VQ VJG 7PKVGF 0CVKQPU and where to plant is essential; not all
VJG OQOGPV OCP[HCTOGTU JCXG PQV plants like each other, as you can see on
(QQF CPF #ITKEWNVWTG 1TICPK\CVKQP [GVJCTXGUVGFVJGKTOCK\G CNVJQWIJKV page 8. If a particular crop has not done
JCUDGGPTCKPKPIKPOQUVRCTVUQH VJG well this year, the farmer has to find out
EQWPVT[ KP VJG RCUV VYQ OQPVJU the reason for the failure and make the
(CTOGTU CTG IQKPI VQ NQUG C
EQPUKFGTCDNGSWCPVKV[QH OCK\GFWGVQ necessary changes - of course not forgetting
In this issue what the market demands.
TQVVKPI CPF RGUVU GXGP DGHQTG VJG[
Working for African Farmers JCTXGUV /QUV QH VJG OCK\G XCTKGVKGU We arelookingforward to a fruitfuland
6JGXKUKQPQH VJGPGY+%+2' RNCPVGF KP /CTEJ CPF GCTN[ #RTKN rewarding relationship with you in the
FKTGEVQTIGPGTCN Page 2 UJQWNF DG TGCF[ HQT JCTXGUVKPI D[ coming year. We should not forget that
1EVQDGT +H VJGCNTGCF[OCVWTGOCK\G agriculture is the backbone of this
Importance of Nitrogen UVC[U VQQ NQPI KP VJG HKGNF VJG JWUMU country'seconomy. Let us work togetherto
%TQRTQVCVKQPCPFKPVGTETQRRKPIYKVJ VGPFVQQRGP 6JG[CTGVJGPPQVQPN[ increase production in a sustainable way
NGIWOGUKPETGCUG[KGNFU Page 3 GZRQUGF VQ RGUVU DWV CNUQ VQ YCVGT that uplifts the living standards of our
HTQOVJGTCKPU 6JGYCVGTKPVJGEQDU people. We wish all our readers and their
Associated plants KU TGURQPUKDNG HQT VJG [GNNQY EQNQWT families a happy holiday season and a
*QYFKHHGTGPVRNCPVUFGRGPFQPGCEJ CPF TQVVKPI *[DTKF XCTKGVKGU CTG prosperous New Year.
QVJGTVQHKIJVFKUGCUGU Page 8 GURGEKCNN[ XWNPGTCDNG VQ RGUVU CPF
FGEC[ See page 3 6JG'FKVQTU
Organic farmer.qxp 11/16/2005 6:20 PM Page 2
MY OPINION
By John Miriti
+%+2'CUUKUVKPI#HTKECPHCTOGTU
Whenever I introduce myself as a ICIPE will strengthen the
farmer to other people, the reaction cooperation with African
I get is that of somebody who is way universities to promote
down the career ladder. This is agriculture in Africa.
despite the fact that we farmers play
a very important role in Kenya's The Organic farmer
economy. We should be proud of (CTOGTU KP -GP[C CPF
our occupation and let other people VJGTGUVQH #HTKECHCEGC
know this fact. It is from the work of DKIRTQDNGOYKVJKPUGEV
our hands that millions of our people RGUVUUWEJCUVJGNCTIGT
get something to eat. Otherwise ITCKPDQTGT CHNCVQZKP
C
they would not survive. Farmers are VQZKP RTQFWEGF D[ C
hardworking and self-employed. It is HWPIWUKPOCK\G VJTKRU
so satisfying to work on the land. It QT GXGP VJG FKCOQPF
is what makes me to be proud as a DCEMOQVJ +H [QW
farmer. OGPVKQP VJGUG CPF
John Miriti is farmer in Meru. OCP[ QVJGT RGUVU VJG
PCOG QH QPG RGTUQP
CNYC[UUVCPFUQWVCPF
The Organic Farmer VJCV KU &T %JTKUVKCP
Nr. 8, December 2005 $QTIGOGKUVGT VJG PGY
FKTGEVQTIGPGTCN QH VJG +PVGTPCVKQPCN Dr. Christian Borgemeister
The Organic Farmer is an %GPVTG QH +PUGEV 2J[UKQNQI[ CPF IQQFCPFVJGDGPGHKVQH VJGRGQRNGKP
independent newspaper for the 'EQNQI[
+%+2' *GKUETGFKVGFYKVJ #HTKEC CPF GURGEKCNN[ HQT VJG #HTKECP
Kenyan farming community. It JCXKPIRKQPGGTGFTGUGCTEJQPYC[UQH HCTOGTU
promotes organic farming and EQPVTQNNKPIVJGUGFGXCUVCVKPIRGUVU 6JCV KU YJ[ &T $QTIGOGKUVGT
supports discussions on all aspects CVVTKDWVGU C ITGCV XCNWG VQ VJG
of sustainable development. The $QTP KP KP )GTOCP[ &T
$QTIGOGKUVGTKUPQUVTCPIGTVQ #HTKEC PGYURCRGT The Organic Farmer
Organic Farmer is published monthly RWDNKUJGF D[ +%+2' 5EKGPVKUVU ECP
by ICIPE and distributed CPF KVU RTQDNGOU *G YQTMGF CU C
TGUGCTEJGT CV VJG VJG +PVGTPCVKQPCN UJCTG VJGKT MPQYNGFIG YKVJ VJG
free to farmers. The HCTOGTU CPF VJG HCTOGTU ECP UGG VJG
reports of The Organic +PUVKVWVG HQT 6TQRKECN #ITKEWNVWTG
++6#KP$GPKP 9GUV#HTKEC DGVYGGP EQOOKVOGPV QH VJG UEKGPVKUVU YJGP
Farmer do not necessarily VJG[ CTG VT[KPI VQ UQNXG VJG HCTOGTlU
reflect the views of ICIPE. CPF #HVGTVJCVJGOQXGFVQ
VJG 7PKXGTUKV[ QH *CPPQXGT KP RTQDNGOU
The Organic Farmer is sponsored by )GTOCP[YJGTGJGTQUGVQDGEQOGC
BioVision, a Swiss based foundation RTQHGUUQT CV VJG RTGUVKIKQWU +PUVKVWVG Fight against malaria
for the promotion of sustainable QH 2NCPV 2TQVGEVKQP CV VJKU WPKXGTUKV[ &T $QTIGOGKUVGTRNGCFUHQTEQPVKPWKV[
development. NCUV[GCT $WV#HTKECYQWNFPQVNQUGKVU QH VJGYQTMQH +%+2' 6JGDCUGNKPG
www.biovision.ch ITKR QP JKO +V KU TGCNN[ C PGY TGUGCTEJ JCU VQ DG CEVKXCVGFOQTG CU
EJCNNGPIGHQTOGVQNGCF+%+2' UC[U YGNNCUVJGCFXKEGVQHCTOGTU 9GJCXG
Publisher $QTIGOGKUVGT YJQ FGUETKDGU JKOUGNH VQ UWRRN[ VJGO YKVJ PCVWTCN YC[U VQ
International Centre of Insect CU RTCEVKECN KP JKU CRRTQCEJ VQ HKIJVRGUVUKPVJGKTETQRU
Physiology and Ecology (ICIPE) RTQDNGOU +%+2' KU URGEKCNKUGF KP $WV VJG VCUM QH +%+2' UVTGVEJGU
P.O.Box 30772, 00100 Nairobi TGUGCTEJ KPVQ KPUGEVU DWV QWT HKGNF QH HWTVJGT +V KU CNUQ QPG QH VJG NGCFKPI
KENYA MPQYNGFIGUVTGVEJGUHWTVJGT 9JKNGYG QTICPKUCVKQPUKPVJGYQTNFKPVJGHKIJV
Tel. +254 20 863 2000 VT[ VQ UQNXG RTQDNGOU QH #HTKECP CICKPUV OCNCTKC 9G CTG PQV CNNQYGF
e-mail: icipe@icipe.org CITKEWNVWTG YG ECP JGNR KORTQXG VJG GXGT VQ NQUG UKIJV QH VJG RTQDNGOU
homepage: http://www.icipe.org NKXKPIUVCPFCTFUKPVJGEQPVKPGPV OCNCTKC DTKPIU CNQPI CPF YG CNYC[U
6JCV KU QPG QH VJG TGCUQPU YJ[ JCXGVQRWVJWOCPNKHGCVVJGEGPVTGQH
Editors +%+2' YCPVU VQ UVTGPIVJGP VJG QWTHQEWU6JGOCPKHGUVQH +%+2'KU
Peter Kamau, Peter Baumgartner EQQRGTCVKQPYKVJ #HTKECPWPKXGTUKVKGU QH ITGCV KORQTVCPEG VQ &T
Secretariat 9G YCPV VQ GUVCDNKUJ IQQF $QTIGOGKUVGT +V UVCVGU +%+2'lU
Lucy W. Macharia TGNCVKQPUJKRU GZRNCKPU $QTIGOGKUVGT OKUUKQP KU VQ JGNR CNNGXKCVG RQXGTV[
Advisory Board VJGTGGZKUVUCITGCVRQVGPVKCNDGECWUG GPUWTGHQQFUGEWTKV[CPFKORTQXGVJG
Dr. Bernhard Lhr, ICIPE #HTKECP 7PKXGTUKVKGU JCXG FGXGNQRGF QXGTCNNJGCNVJUVCVWUQH RGQRNGUQH VJG
Dr. Nguya Maniania, ICIPE XGT[YGNNUKPEG+NGHV 6JKUKUGURGEKCNN[ VTQRKEU D[ FGXGNQRKPI CPF GZVGPFKPI
Dr. Fritz Schulthess, ICIPE UQKP-GP[CKPRCTVKEWNCTCPFKP'CUV OCPCIGOGPV VQQNU CPF UVTCVGIKGU HQT
Address #HTKECKPIGPGTCN JGUC[U JCTOHWNCPFWUGHWNCTVJTQRQFU YJKNG
The Organic Farmer
%CRCEKV[DWKNFKPIKUCOCIKEYQTFHQT RTGUGTXKPI VJG PCVWTCN TGUQWTEG DCUG
P.O.Box 14352, 00800 Nairobi
VJG PGY +%+2'FKTGEVQT *G UGGU VJTQWIJ TGUGCTEJ CPF ECRCEKV[
KENYA
QRRQTVWPKVKGUKPVJCVCTGCHQT+%+2' DWKNFKPI
Tel. 020 445 03 98
e-mail : info@organickenya.com +VKUCP#HTKECP+PUVKVWVG 9GYQTMKP 6JQUGCTGEJCNNGPIKPIIQCNU UC[U
Layout: #HTKECP EQWPVTKGU 6JGMPQYNGFIG &T $QTIGOGKUVGT GURGEKCNN[YJGPYG
In-A-Vision Systems(k) YGICVJGTKPCNNVJQUGEQWPVTKGUJCUVQ NQQMCVCNNQH VJGOVQIGVJGT $WVVJG
DGWUGFKPCOQTGKPVGPUGYC[HQTVJG GHHQTVKUYQTVJYJKNG
Organic farmer.qxp 11/16/2005 6:20 PM Page 3
(CTOGTUDGPGHKVHTQOITQYVJCEVKXCVQT
The activator is helping farmers
get better results and strengthen plants
to withstand diseases and even pests.
By Peter Kamau, Kangema
+H CP[QPGYGTGVQENCKOVJCVQTICPKE
KPRWVU UWEJ CU EQORQUV CTG UNQY KP
RTQOQVKPIRNCPVITQYVJEQORCTGFVQ
EJGOKECN HGTVKNK\GTU [GCT QNF
4QUGOCT[ 0[CODWTC YQWNF NCWIJ KV
QHH 6JG OQVJGT QH UKZ EJKNFTGP KU
COQPIJWPFTGFUQH HCTOGTUKPEGPVTCN
RTQXKPEGCPFVJGTGUV QH VJGEQWPVT[
YJQ JCXG FKUEQXGTGF VJG WUG QH
'HHGEVKXG/KETQQTICPKUOU
'/ C
UQNWVKQP QH DGPGHKEKCN DCEVGTKC VJCV
JGNRVQURGGFWRVJGFGEQORQUKVKQPQH Rosemary Nyambura shows her healthy passion fruits. (Photo TOF)
QTICPKE OCVVGT YJKNG TGNGCUKPI
GUUGPVKCN PWVTKGPVU HQT WUG D[ RNCPVU UJG KU QPG QH VJG OQUV UWEEGUUHWN HWVWTGRWTEJCUGU
6JG '/ VGEJPQNQI[ KU EJCPIKPI HCTOGTU KP -CPIGOC FKXKUKQP QH 6JG IQQF VJKPI YKVJ QTICPKE
HQTVWPGU HQT OCP[ HCTOGTU YJQ CTG /WTCPICFKUVTKEV 6JGETQRUKPJGT HCTOKPIKUVJCV+WUGOCVGTKCNYJKEJKU
PQYWUKPIKVHQTOCP[RWTRQUGUQPVJG CETGHCTOUJQYYJCVVJGCEVKXCVQTECP TGCFKN[ CXCKNCDNG QP VJG HCTO 6JG
HCTOVQKPETGCUGRTQFWEVKQP FQVQETQRUKH KVKURTQRGTN[WUGF *GT RTQDNGOYKVJOCP[HCTOGTUYJQWUG
CETG OCTMGV ICTFGP KU KPVGTETQRRGF EJGOKECN HGTVKNK\GTU CPF RGUVKEKFGU KU
Compost decays faster YKVJ JGCNVJ[ RCUUKQP HTWKVU QPKQPU VJCVVJG[FQPQVUKVFQYPVQHKPFQWV
$GHQTGO[EQORQUVWUGFVQVCMGVQ VWTPKRU EQWTIGVVGU ECDDCIGU VJG EQUV QH VJGUG KPRWVU +H VJG[ FKF
OQPVJUVQFGEQORQUG YJGP+CRRN[ UWMWOCYKMK ECRUKEWOUCPFKORTQXGF VJG[YQWNFFKUEQXGTVJCVEQPXGPVKQPCN
'/KVVCMGUQPN[OQPVJ /[ETQRU RWORMKPU #JCNHCETGKUTGUGTXGFHQT CITKEWNVWTG KU OWEJOQTG GZRGPUKXG
CTG JGCNVJKGT CPF VJG [KGNF JCU OCK\G YJKNG VJG WRRGT UGEVKQP KU C UJGUC[U
KPETGCUGF EQPUKFGTCDN[ UC[U ECVVNG UJGF YKVJ FCKT[ EQYU VJCV Marketing organics a big problem
0[CODWTC RTQXKFG HCTO[CTF OCPWTG YJKNG VJG 0QYVJGOCKPJCPFKECRHQTVJGITQWR
6QIGVJGTYKVJQVJGTOGODGTUQH TGOCKPKPICETGUCTGWPFGTVGC
VJG 0IQGKPK-CP[GP[CKPK
0IQMC KUHKPFKPIOCTMGVHQTVJGKTXGIGVCDNGU
5JG JCU UGGP C ITGCVKORTQXGOGPV #NVJQWIJVJG[JCXG RTQFWEGF SWCNKV[
5GNH*GNR)TQWR 0[CODWTCJCFDGGP QP VJG RTQFWEVKXKV[ QH VJG XCTKQWU XGIGVCDNGU CPF HTWKVU HQT VJG NCUV HKXG
KPVTQFWEGF VQ WUKPI QTICPKE OQFG QH ETQRUQPVJGHCTO +WUGFVQJCTXGUV [GCTU PQVCUKPINGDW[GTJCUGZRTGUUGF
RTQFWEVKQP DCEM KP 6JGP VJG QPN[DCIUQH OCK\G NCUV[GCT+IQV CPKPVGTGUVKPVJGO #UCTGUWNVVJG[CTG
ITQWRYCUITQYKPI#TCDKEWOHNQYGTU DCIU QP VJG UCOG RKGEG QH NCPF /[ HQTEGFVQEQORGVGYKVJEQPXGPVKQPCNN[
QTICPKECNN[YKVJHCTO[CTFOCPWTG 5JG ECDDCIGUPQYYGKIJCPCXGTCIG QH ITQYPUWDUVKVWVGU
NCVGT CDCPFQPGF HNQYGT ITQYKPI FWG MICRKGEG 6JGOQUVKPVGTGUVKPIVJKPI Need for certification
VQ VJG RQQT RTKEGU QHHGTGF D[ YKVJQTICPKEHCTOKPIKUVJCVVJG[KGNF
OKFFNGOGP +V YCU VJGP VJCV C MGGRU QP KPETGCUKPI GXGT[ [GCT $[ UC[U )GQHHTG[-KTCIW CPQVJGTOGODGT
DWUKPGUUOCP HTQO -KTKCKPK OCTMGV VJCV YKVJ VJG PGY OGVJQF QH
GCVKPI QTICPKE HQQFU O[ JGCNVJ JCU QTICPKERTQFWEVKQP
VCWIJV VJGO JQY VQ WUG '/ 5JG KORTQXGFVQQUJGUC[U VJGITQWRKUCDNG
CVVGPFGFUGXGTCNVTCKPKPIUGUUKQPUWPVKN VQ UWRRN[CP[SWCPVKV[QH QTICPKECNN[
UJGDGECOGEQPXGTUCPVYKVJEQORQUV 9KVJVJGGZVTCEVUJGJCUOCPCIGFVQ ITQYP KVGOU *G UCKF VJG[ JCF
OCMKPICPFRTGRCTCVKQPQH (GTOGPVGF EQPVTQN OCP[ RGUVU CPF FKUGCUGU VJCV TGURQPFGFVQCPCFXGTVKUGOGPVKPThe
2NCPV 'ZVTCEVU
(2' WUKPI VJG YGTG FKHHKEWNV VQ EQPVTQN GXGP YKVJ Organic Farmer D[ 5W -CJWODW VJG
CEVKXCVQT EJGOKECNU #PQVJGTDKICFXCPVCIGUJG HCTOGT HTQO.KOWTWYJQ ITQYU CPF
JCUFKUEQXGTGFYKVJVJGWUGQH '/KU UWRRNKGU QTICPKE XGIGVCDNGU VQ NQECN
Yield has increased VJCV ETQR TGUKFWGU URTC[GF YKVJ VJG UWRGTOCTMGVU
5JG CNUQ CPUYGTU
(TQO VJGP HCTOKPI JCU PGXGT DGGP UQNWVKQPFGEQORQUGHCUV 6JGTGUKFWG HCTOGTU SWGUVKQPU QP RCIG
VJGUCOGCICKPHQT0[CODWTC 6QFC[ KU TGCFKN[ EQPXGTVGF KPVQ SWCNKV[ -CJWODW JCF CFXKUGF VJGO VJCV HQT
EQORQUVVJCVECPPQVVTCPUHGTFKUGCUGU VJGKT RTQFWEVU VQ DG CEEGRVGF CU
Dear farmers, HTQO QPG ETQR VQ VJG PGZV 5JG JCU QTICPKE VJGKT HCTOU JCXG VQ DG
5Q OCP[ HCTOGTU CTG ECNNKPI YKVJ CNUQ TGFWEGF VJG PWODGT QH ETQR KPURGEVGFD[SWCNKHKGFQTICPKEHCTOKPI
GPSWKTKGU QP YJGTG VJG[ ECP DW[ TQVCVKQPE[ENGUKPGCEJRQTVKQPQH NCPF GZRGTVUYJQYQWNF VJGP IKXG VJGO C
QTICPKE HGTVKNK\GTU CPF ITQYVJ 6JKU KU DGECWUG VJG UQKN HGTVKNKV[ KU EGTVKHKECVGVQUJQYVJCVVJGKTOGVJQFU
CEVKXCVQTU UWEJ CU RJ[OKZ DKQCNIGPG OCKPVCKPGF CPF GPJCPEGF YJKNG QH RTQFWEVKQP OGGV VJG TGSWKTGF
PGGOCPF'/CUYGNN FKUGCUGUCPFRGUVUCTGEQPVTQNNGF KPVGTPCVKQPCN UVCPFCTFU HQT QTICPKE
$GIKPPKPI ,CPWCT[ The Organic Local material HQQFU $WV -KTCIW UC[U VJG[ FQ PQV
Farmer YKNN ECTT[ C UGTKGU QH CTVKENGU 6JG OGODGTU EQNNGEV OQPG[ CPF WPFGTUVCPFVJGRTQEGFWTGUKPXQNXGFQT
IKXKPIFGVCKNUKPENWFKPIKPUVTWEVKQPUQP DW[VJG'/LQKPVN[
CNKVTG EQUVU -UJ VJG RGQRNG YJQ RTQXKFG EGTVKHKECVKQP
VJGKT RTQRGT WUCIG +H [QW JCXG CP[ VJG[VJGPRTGRCTGVJG(2'CUC UGTXKEGU
SWGUVKQPU RNGCUG HQTYCTF VJGO VQ WU ITQWR CPF WUG KV KP VJGKT KPFKXKFWCN 1WTRTQDNGOKULWUVVJGOCTMGV 9G
CPFYGYKNNVT[VQTGURQPF HCTOU 6JG TGOCKPKPI ECUJ KU JQRGVJCVQPGFC[YGYKNNDGCDNGVQ
FGRQUKVGF KP VJG ITQWRlU CEEQWPV HQT UGNNNQECNN[CPFGXGPGZRQTV JGCFFU
Organic farmer.qxp 11/16/2005 6:23 PM Page 5
5GGFNKPIUTGSWKTGVGPFGTECTGYJKNGKPVJGPWTUGT[
5WDWMKC HCTOGTU CTG MPQYP CNN QXGT -GP[C HQT VJGKT CEWOGP KP 9JCV UYTQPI
JQTVKEWNVWTCNHCTOKPIGURGEKCNN[VJCVQH VQOCVQGUCPFECDDCIGU 6JGTGKU YKVJO[ECTTQVU!
JQYGXGT C JCPFKECR KP TGCNK\KPI VJG QRVKOWO [KGNFU DGECWUG QH VJG
HQNNQYKPITGCUQPU
.CEMQH RTQRGTMPQYNGFIGQPVJGRTGRCTCVKQPQH PWTUGTKGUTGUWNVKPIKP
HCKNWTGKPIGTOKPCVKQPQH CNCTIGRQRWNCVKQPQH UGGFU
#VVCEMD[RGUVUGURGEKCNN[CRJKFUCPFEWVYQTOU
2NGCUGUGPUKVK\GWUKPVJGUGVYQKUUWGUUQCUVQGHHGEVKXGN[KORTQXGQPVJG
[KGNFCPFKORTQXGQWTGEQPQOKEYGNNDGKPI
+PO[NKUVQH SWGUVKQPUHTQOHCTOGTU UGGFNKPIU NKMG [QWPI EJKNFTGP TGSWKTG
VJKUOQPVJ +YCURNGCUCPVN[UWTRTKUGF VGPFGT ECTG YJKNG KP VJG PWTUGT[
VQ UGG C SWGUVKQP HQTO The Organic 0WVTKVKQPOWUVDGGCUKN[CEEGUUKDNGCPF
Farmer TGCFGTU 5WDWMKC 6JKU KU DGUV RTQXKFGF VJTQWIJ OCVWTG
KPFKECVGUETQUUUJCTKPIQH KPHQTOCVKQP EQORQUV EQODKPGF KP VJG UGGFDGF
DGVYGGP UQOG HCTOGTU QWV VJGTG YKVJVJGUQKN
YJKEJ KU LWUV HCPVCUVKE VQ MPQY
%QPITCVWNCVKQPU VQ [QW 5JCTKPI QH Watch the soil...
#UVJGTGCTGOCP[V[RGUQH UQKNUCPF
5W UCPUYGTU FKHHGTGPEGUKPHGTVKNKV[YKVJKPVJGUCOG
QPG OWUV LWFIG VJG COQWPV QH
EQORQUVD[VJGHGGN UOGNNCPFEQNQWT
)GQTIG )KVJWMW CUMU + CO CP
QTICPKE HCTOGT DCUGF KP 6GVW
5WDWMKC +RNCPVGFUQOGECTTQVUQP
QH VJGUQKN 1PGCKOUVQETGCVGCFCTM CYGNNOCPWTGFRNQV 6QO[UWTRTKUG
MPQYNGFIG GURGEKCNN[ KP VJG QTICPKE JGCNVJ[ UGGFDGF UQKN YKVJ JKIJ VJG ECTTQVU FKF UQ RQQTN[ FGURKVG
YQTNFKUPGEGUUCT[ +VKUVJGTGNKIKQPQH QTICPKEEQPVGPV ETWODN[VGZVWTGCPF JCXKPI YGGFGF VJGO CPF YCVGTKPI
QWT RNCPGV CPF KH YG CTG VQ KORTQXG IQQFYCVGTJQNFKPIECRCEKV[ 6JGHKPCN VJGO TGIWNCTN[ 9JCV EQWNF DG
QWTJGCNVJCPFVJCVQH QWTRNCPGV YG OKZVWTG QH UQKN CPF EQORQUV OWUV RTQDNGO EQPUKFGTKPI VJCV VJG QVJGT
OWUVDGUGNHNGUUKPUJCTKPICPFECTKPI UOGNN XGT[ GCTVJ[ 1HHGPUKXG QFQWTU ETQRU+RNCPVGFCNQPIUKFGVJGECTTQVU
9JKNUVCMPQYNGFIKPIVJGKTHCOGCPF UWIIGUV EQORQUV VJCV JCU PQV HWNN[
RQVCVQGUFKFXGT[YGNN
GZRGTKGPEG KP VQOCVQ CPF ECDDCIG TQVVGFCPFYKNNETGCVGRTQDNGOUKPVJG 1DUGTXCVKQP KU QWT HKTUV UVGR KP
ITQYKPI VJGUG HCTOGTU HGGN UGGFDGF WPFGTUVCPFKPI PCVWTG )GQTIG
JCPFKECRRGF KP TGCNK\KPI OCZKOWO 5GGFDGFU OWUV PGXGT FT[ QWV )KVJWMW TKIJVHWNN[ QDUGTXGF VJCV
[KGNFU DGECWUG NCEM QH RTQRGT EQORNGVGN[ CPF OC[ DGPGHKV HTQO ECTTQVUFKFPQVRGTHQTOYGNNFGURKVG
MPQYNGFIG QP RTGRCTCVKQP QH UNKIJVOWNEJKPIWPVKNVJGGOGTIGPEGQH TGIWNCT YCVGTKPI CPF YGGFKPI YJGP
PWTUGTKGU TGUWNVKPI KP HCKNWTG QH UGGF VJG[QWPIRNCPVU (GGFKPIQH UGGFNKPIU RNCPVGF QP C YGNNOCPWTGF RNQV
IGTOKPCVKQP KUPQVPGEGUUCT[KH UGGFNKPIUCTGVQDG 2QVCVQGU JQYGXGT RNCPVGF KP VJG
VTCPURNCPVGF DGVYGGP VQ FC[U UCOGCTGCFKFYGNN *GKUYQPFGTKPI
Fragile condition of seed *QYGXGT YGGMN[ HGGFKPI XKC C OKNF
)TGCVCVVGPVKQPOWUV DG IKXGP VQ VJG NKSWKF EQORQUV VGC KU PGEGUUCT[ HQT YJCV VJG RTQDNGO OC[ DG
RTGRCTCVKQP CPF OCKPVGPCPEG QH QWT UGGFNKPIUCPFEWVVKPIUQH HTWKVVTGGU #UVQPKUJKPICUKVOC[UGGO ECTTQVU
PWTUGTKGU QT UGGFDGFU KH YG FGUKTG VTGGUGVE VJCVTGSWKTGCNQPIGTUVC[KP FQPQVNKMGPGYN[OCPWTGFUQKNUCPF
JGCNVJ[UGGFNKPIU %QOOQPUGPUGCPF VJGPWTUGT[ DGCTKPI VJKU KP OKPF VJG[ CTG C
NQIKE IQ CNQPI YC[ YJGP YG VJKPM RGTHGEV ETQR VQ HQNNQY KP TQVCVKQP
CDQWV VJG HTCIKNG EQPFKVKQP QH UGGF ...and watch the seedlings carefully DGJKPFCJGCX[HGGFGTETQRYJGTGC
CPFUGGFNKPIU .QECVKQP QH PWTUGTKGU KU XGT[ NQV QH OCPWTG CPF EQORQUV YCU
5QKNOWUV DG NKIJV CPF ETWODN[VQ KORQTVCPV +FGCNN[ VJG[ UJQWNF DG WUGF
CNNQY VJG [QWPI UGGFNKPIU CP GCU[ NQECVGF KP C EQQN CTGC CU ENQUG CU 9GFQPGGFJQYGXGTVQNKIJVN[CGTCVG
LQWTPG[ HTQO VJGKT UGGF ECUKPIU CPF RQUUKDNGVQCYCVGTUQWTEG +H RQUUKDNG VJG UQKN D[ UJCNNQY FKIIKPI DGHQTG
OQKUVWTG OWUV CNYC[U DG RTGUGPV VQ VJG[UJQWNFCNUQDGRTQVGEVGFHTQOVJG RNCPVKPI ECTTQVU 6JKU YKNN CNNQY
CXQKF FT[KPI QWV VJWU UVTGUU VQ VJG GNGOGPVUD[CNQYHGPEKPICPFRQUUKDN[ GCUKGTRGPGVTCVKQPD[VJGECTTQVTQQV
[QWPI RNCPV 7RQP GOGTIGPEG C VJCVEJ QT PGV EQXGTKPI
(QT UQOG CPF YKNN CNUQ CNNQY DGVVGT YCVGT
QFFTGCUQP O[FQIUIKXGPVJGEJCPEG JQNFKPIECRCEKV[ 5Q)GQTIG VJGTGKU
WUGUGGFDGFUVQFKICPFRNC[KP PQ RTQDNGO [QW JCXG LWUV
FKUEQXGTGF JQY VQ UCXG OQPG[ D[
1PGCTGCOQUVQXGTNQQMGFKPHCTOKPI TGCNK\KPI [QW ECP RNCPV ECTTQVU
KUVJGVKOGQH VTCPURNCPVKPI 5GGFNKPIU
5W-CJWODW NGHVKPVJGUGGFDGFHQTVQQNQPIOC[
YKVJQWVCP[OCPWTG
CPUYGTU[QWT NQQMJGCNVJ[CPFUVTQPIJQYGXGTVJG[ QH QXGT ETQYFKPI 6Q JGNR UQY XGT[
SWGUVKQPU YKNN DCVVNG OQUV YJGP VTCPURNCPVGF UOCNNUGGF OKZKPCVCDNGURQQPQH UQKN
/CMG UWTG VQ FCVG[QWT UGGFDGFU UQ YKVJ VJG UGGF 6JKU YKNN GPUWTG IQQF
VJCV[QWTGOGODGTYJGPVQVTCPURNCPV URCEKPI %TQYFGF UGGFNKPIU UVTWIING
9TKVGVQ VJG UGGFNKPIU # YGGM QH FGNC[ KU HQT PWVTKVKQP DGEQOG UVTGUUGF CPF
The Organic Farmer CEEGRVCDNG CP[ NQPIGT CPF [QW UWEEWOD VQ FKUGCUGU UWEJ CU HWPIWU
21$QZ 0CKTQDK CNTGCF[JCXGCEQORTQOKUGFRNCPVVJCV YJKEJ VJTKXG KP FCOR QXGT ETQYFGF
-'0;# YKNNUVTWIINGVQTGCEJKVlUHWNNRQVGPVKCN UGGFDGFU +H ETQYFKPI KU C RTQDNGO
6GN #PQVJGTOWEJQXGTNQQMGFRTQDNGO VJKP VJG UGGFNKPIU QWV +V KU DGVVGT VQ
GOCKN KPHQ"QTICPKEMGP[CEQO YJKEJQTKIKPCVGUKPVJGUGGFDGFKUVJCV NQQUGCHGYVQUCXGVJGTGUV $GUWTGVQ
Organic farmer.qxp 11/16/2005 6:24 PM Page 7
Dear editors,
A short while ago I read a report from the German Heinrich Bll Foundation
Study on the Impact of High Food and Factor Prices on Kenyan Farmers from
conserved and harvested is called April 2009. I think it would be of interest to my fellow farmers if you would
water management. Managing the publish the conclusions of this report. Thank you. Anthony Otieno, farmer
water cycle in a farm has to be done in Dear Anthony, we have gone through the report, and agree with you. We hereby
the right way as it can affect the water
publish its conclusion. Some parts have been adapted to enhance clarity. The Editors
supply both positively or negatively.
Balance between
water intake and off-take
Do farmers benefit from high food prices?
Countries that rely on imports to meet their food requirements may, in future,
The way a farmer balances between have to reorganize their trade and national marketing systems to ensure they are
rainfall, evaporation or transpiration self-sufficient in food production, if at all they want to avoid escalating and unsta-
determines the amount of water avail- ble global food prices. Countries such as Kenya which, in normal years, are almost
able for better crop production. When
rainfall exceeds evaporation and tran- self-sufficient in food production are highly influenced by their domestic food pro-
spiration, the crops will have adequate duction, national market structures or failure of the government.
water for proper growth since the root Yet, besides the global trends with their enormous influence, country-specific
zone will have adequate water. When factors seem to limit the possibilities for farmers to benefit from higher food prices
evaporation and transpiration exceed much more. As long as staple food marketing is to a certain degree controlled by
rainfall, the water available for plant cartels or monopolies with high market power, weak institutional governance and
growth is decreased. In analysing water corruption, economic activities of farmers might depend much more on domestic
needs for agriculture, evaporation and agricultural policy reforms than on global food price developments.
transpiration rates are very important. Meanwhile, farming households are already diversifying their incomes in Kenya
Run-off and percolation also affect the as elsewhere. A clear trend to more off-farm and more non-farm income for
amount of water remaining in the root rural households can be observed. Furthermore, household investments are not
zone. The main objective of water man-
directed towards farm improvement or farming as a business.This shows that
agement in sustainable agriculture is to
make maximum use of run-off, perco- rural households with opportunities divert from agricultural activities, because they
lation evaporation and transpiration. are not seen as promising avenues for the future. The stagnating productivity of
One way of increasing the amount African small-scale farms might be a cause and a reason for this phenomenon.
of water available for agriculture is to Investing, but not in agriculture
reduce the loss of water through tran- Yet, the need for food production increases. We can only expect a reaction
spiration. For example one hectare of towards investment in agricultural production or productivity, where price increase
maize can lose as much as 37,500 litres took place; if it mainly takes place at the level of traders and millers, little produc-
of water in a day or 1,900,000 litres per
tion impetus can be expected. Moreover, further evidence is needed on future
growing season through transpiration.
However, establishing a mixture of food price projections. So far, it is not clear whether the trends on commodity
crops and trees creates a micro-climate world markets were just unusually volatile during the past 18 months due to
where the moisture produced (transpi- unusual domestic and international circumstances or whether they were indicat-
ration) is used by nearby crops. Raising ing a longer term increase in real food prices. On the other hand, decreasing food
seedlings in shady places protected prices make it better for poor consumers. But this might put producers in a situa-
from wind also prevents loss of mois- tion of agricultural treadmill.
ture. In the next issue we will show But even if prices stabilise, agricultural production remains an economic activity
other methods of water conservation with a number of other risks. One of them is the weather which might gain more
for crop production. importance in the forthcoming years due to climate change. The argument of price
incentives for producers doesnt seem to materialise soon for small-scale farmers
The cost of El Nino in Kenya or elsewhere in Sub-Saharan Africa. The assumption is that As product
A World Bank report released almost prices climb higher, so too is the producer encouraged to invest in higher agri-
a decade ago after the 1997/98 El Nino inputs This, as formulated by many observers, has in the short term not proved
rains followed by La Nina drought to be right.
in the year 2000- 2001, shows the
country lost at least 14 percent in Needed: better infrastructure
each of these years. At the moment Higher prices can theoretically mean incentives to producers; however it is not
the loses are much higher consider- prices but profits that count. The challenges will be to translate higher food prices
ing that water resource degradation into motivators for lasting investment in rural areas and sustainable agricultural pro-
has intensified. Lack of investment duction in order to achieve food security for all producers are also consumers.
in water resources cost the economy This study couldnt find evidence that high food prices alone will provide incen-
even more. It shows that droughts tives for smallholders to intensify their production in the medium term. From the
and flooding would not be so severe Kenyan experience it is much more likely that farmers would respond to more reli-
if there was better access to water
able, affordable and available services for inputs and to improved rural infrastruc-
supply through more surface water
storages such as earth dams and ture. Secure access rights to productive resources such as land and water and a
more groundwater development in reduced volatility in input and output markets seems to be much more important
arid and semi arid areas (ASALs). for rural incomes than temporarily high prices.
i-TOFs
at work Our article on livestock breeding in the
October issue of The Organic Farmer
Dozens of farmers
groups have already generated a good response from farmers
benefitted from the who have requested for advice and guide-
i-TOF training pro- lines on how to keep records. Indeed,
gramme offered by animal breeding goes hand-in-hand with
the information and record-keeping. These documents help
input centres of The to reduce the risk of inbreeding and
Organic Farmer maga- also increase animal productivity. There
zine. The picture shows can be no sustainable livestock breeding
members of the Mukui without maintaining proper records.
Farmers Group during Even though we have written about
a training session in this in the previous TOF-issues, we
Sagana, preparing plant cannot ignore these requests from fellow
extracts. See page 6 farmers. In The Organic Farmer will
from December we feature the basic
principles of record keeping including
Fertilizer not effective in poor soils guidelines on how farmers can keep
records for animals as well as for crops.
Soil organic matter increases soil fer- with better soils. Three things can be Record keeping requires discipline and
tility, improves soil structure, retains seen from these studies. time to put down the figures regularly.
and stores nutrients and water and Firstly, the governments well- Proper records are a useful instrument
makes them available to plants over intended efforts to make fertilizers of planning and a good management
a long period. Two new studies con- available and affordable dont help tool, not only on livestock breeding,
ducted in Western Kenya add a new the poorest farmers much, but may but also for small-scale farmers. Careful
dimension to this common knowl- actually reinforce income inequalities. planning does not require money, it
edge. They show that mineral fertiliz- Secondly, farmers should be aware needs creativity, initiative, the courage
ers are less effective and may even be that fertilizer application is not eco- to tackle problems instead of lamenting,
unprofitable on soils which are very nomical on very poor soils. Thirdly, and a will to succeed.
low in organic matter. In such soils, the results emphasize the central role The recent drought with its devasta-
fertilizer nutrients are not retained of soil organic matter. ting consequences should be a lesson to
in the soil, but are washed out before Organic matter is central farmers on the need to plan ahead. Let
they can be taken up by the crops. Organic methods are the best way to us give you two examples. Most farmers
These soils had been planted for improve poor soils. Compost, animal did not have adequate forage compared
decades without a break. In addition, manures, green manures, mulches to the number of their cows. There are
the most degraded soils were often and cover crops all contribute to the various methods farmers can use to
cultivated by the poorest farmers, and building up of soil organic matter - prepare fodder for the dry season; we
they were using less than half the fer- which is what poor soils need most have featured them in our magazine. If
tilizer amounts compared to farmers to improve. you need some of this information, send
us an SMS with your address and key
Rift Valley Fever: Outbreak likely word like hay or silage, and we
will send you the material. A longterm
Livestock keepers should be aware that toms. The solution for producing fodder during the
with the current rains, an outbreak Rift Valley dry seasons is to plant fodder trees such
of the Rift Valley Fever is looming. Fever virus is as Leucaenea or Calliandra.
Farmers across the country are advised spread primar- Another example for the need to plan
to take preventive measures to contain ily by the bite ahead is the availability of water. When
the disease when they notice symp- of infected mos- the rains come, farmers forget all about
quitoes, mainly drought; but within a short time, they
the Aedes will be facing the same problem. There
A new farmers association? 3 species, which are many cheap methods of harves-
Su Kahumbu encourages can acquire the ting water (see pages 5 and 6). All you
organic farmers to come together. virus from feeding on infected animals. need is labour and the determination to
The female mosquito is also capable of
Progressive neighbours 4 transmitting the virus directly to her
harvest as much water as you can to use
The Tanzanian government for food and fodder production.
offspring via eggs. Small-scale farmers need to take their
promotes organic farming.
These eggs can survive for several fate in their own hands. Do not wait for
Water series 5 years in dry conditions. Periods of other people to assist you, take the first
Showing farmers rainfall enable the eggs to hatch and step to address your problems. Experi-
how to harvest the mosquito population to rapidly ence shows that proper planning is the
and store water increase, spreading the virus to the first step to success.
animals on which they feed. See page 3
io
ad
FR
TO
Nr. 54 November 2009
+
"
Farmers need water for two main be collected in smaller tanks or drums.
uses: Clean water for the household In a household with 6 persons consum-
and animals, and less clean water for ing 100 liters of water per day, 36 cubic
crops. The best source of clean water is meters of water are required through-
rainwater. Iron sheet roofs can supply out the year. In a semi-arid climate (600
free and clean water throughout the mm of rain per year), this amount of
year it only needs to be caught by water is provided from a roof area of
gutters and drained into a storage 60 square meters. This corresponds to
tank. a house of 6 meters x 10 meters.
Use all roofs on your farms to harvest All gutters need to be checked and
rainwater! Also water flowing from maintained permanently to make sure Do not waste rain water! (Source of all
smaller roofs of sheds and stables can that no water is wasted and the inflow photos: www.infonet-biovision.org)
to the tank is not blocked. rainwater should always be directed
Storage tanks away from the storage, since it con-
Tanks, reservoirs and cisterns tains the dirt from the roof.
for clean water storage can A storage tank should be placed near
be constructed above ground the place of usage, e.g. the kitchen, or
or below ground. No matter the cattle unit. An overflow should
whether they are made of redirect excess water to a smaller
plastic, bricks, masonry, steel water container or tank.
sheets, or concrete, they must Protect your family from malaria
be tightly covered to prevent All open water areas are breeding
evaporation and pollution, and places for mosquitoes, also in the dry
mosquitoes breeding inside. season, when malaria transmission is
They also need regular inspec- normally decreased. Cover tanks and
A roof, well maintained gutters and a clean and tion and cleaning. Before the all other inlets where mosquitoes may
covered tank are vital in dry regions. (Source: Sus- rains start, the tank must be invade (taps, ventilation pipes) with
tainable Agriculture Manual, IIRR 1998) cleaned. The first direct flush of screens and mosquito-proof mesh!
You can get enough water for your livestock and crops
Water for farm animals and for irriga- to reduce leakage. Trees and scrubs are Collecting runoff surface water
tion of crops can be collected from grown on the windy site of the dam to Surface water runoff, e.g. from roads,
surface runoff which is directed into function as windbreaks and to reduce should always be directed into ponds
ponds or reservoirs. Such structures evaporation. This requires some effort, or reservoirs. Trenches channeling
can hold large amounts of water. but there are many examples of initia- water directly into the fields should be
Usually, soil is excavated and the mate- tives where farmers alone or together avoided, because uncontrolled water
rial is used to form a dam. The ground by forming water user associations suc- flow during heavy rainfalls leads to
of the pond or pit has to be compacted cessfully constructed dams and ponds. soil erosion and development of deep
gullies in agricultural land. Water from
ponds can be used for livestock as well
as for irrigation of fields and crops.
From the pond, small channels can
then direct the water to the fields.
Pits, dams and ponds
Natural depressions or pits which were
left by road constructors can be used for
water storage, especially if you observe
Run-off water from roads can be harvested from cut-off trenches or road ditches that water tends to drain slowly from
Continued on page 6
Nr. 54 November 2009
from page 5
Water
020 445 03 98 0721 541 590 0738 390 715
them. A trench can be dug to divert water from
the road into the pit. To construct a dam and a
pond, use a natural depression where rainwater
flows or accumulates naturally. Also gullies can
More farmers benefit from i-TOFs
Peter Kamau, Gatuto in the right way and various methods
easily be diverted into a pond. The soil should It is a hot Tuesday morning, and they can use to improve soil fertil-
be clayey. Avoid building dams near livestock members of Mukui Farmers Common ity and crop yields. Previously we
enclosures to avoid pollution! Interest Group near Sagana town are have had to depend on a few experts
Dams should always be circular or oval in order seated in a semi- circle under a tree in who came to train us at an exorbitant
to have an evenly distributed water pressure a group members farm. Before them cost, says group chairman George
preventing cave-in of the walls. They can be are a variety of plants in a heap for Maina. We are not paying anything
lined with clayey soil to make the bed more preparation of plant extracts, there for this valuable training and infor-
impermeable. On slopes, a dam of half-circular are also ingredients for preparation of mation material. We hope the project
shape may be sufficient to hold the water in the natural milking salve. The members will continue so that more farmers can
pond. A spillway lined with stones is built at are involved in a lively discussion on acquire knowledge on sustainable agri-
each upper end of the dam wall to discharge the steps they have to follow in the culture, Maina says. The farmers want
surplus water safely. preparation of the two products. more training in agroforestry, water
Excavation dams are circular or oval excava- Peter Murage, an extension worker harvesting and dairy farming.
tions where the excavated soil is used for build- who is in charge of i-TOF training
ing the dam walls. Their sides should slope at Using Infonet
programme in the area is supervising Like the other extension workers in the
least 45 degrees to be stable. the farmers to make sure they prepare programme, Murages diary is always
Enlarge your pond gradually the ingredients according to the way he full. When he is in the office, farmers
A farmer can start with digging a small pond has trained them. Finally the farmers thirsty for information come to consult
during dry season and enlarge it every year, get down to work. him. Others bring diseased plants and
until he is satisfied with the capacity of his dam. The Gatuto training centre is one of even pests for him to identify and rec-
Channels to the shamba the four information and organic input ommend a solution. Murage opens his
Diversion channels direct the water from the centres (i-TOF), which
pond into the shamba, where it can be collected have been set up by The
in small pits. These are dug along the contours. Organic Farmer magazine
Pits allow the water to sip into the soil, thereby in Gatuto (Central), Kan-
increasing its moisture content. Use of pits is gundo (Eastern), Majengo/
also a soil conservation measure as it prevents Buyangu (Western) and
the run-off water from carrying the soil away. Baraka Agricultural
college in Rift Valley prov-
ince.
Exchanging informa-
tion
The 24-member group is
a beneficiary of the i-TOF
training programme,
which was launched two
months ago. Already
many farmers groups Mukui farmers group members in a group discussion
near the i-TOF centres are with i--TOF extensionist Peter Murage, (left in cap)
reaping the benefits of
Round dams are organic farming and sustainable agri- small laptop computer. It contains the
built on flat land culture through direct training by our infonet-biovision information package
(above), semi- extension workers. which provides answers to most of the
circular dams After the practical session is over, diseases and pests that affect farmers
hold water on the farmers review areas they had not in East Africa. After going through
understood in their previous training. the pictures showing various diseases
hillsides (left), and
They seek clarifications from Murage on the computer, the farmers are able
excavation dams to identify the particular disease and
can also be built who answers all the questions with
in succession ease. The farmers then share their own how to control it. They leave the office
(below).
experiences on the different aspects of satisfied.
farming. Organic inputs
Anne Wairimu says termites used to In addition to the training, one area
be a big problem to her, but since she that farmers have a problem with is
attended a training session last month, access to organic inputs. The i-TOF
a termite control plant extract solution programme has made arrangements
they were introduced to had managed in the four i-TOF areas where farmers
to wipe out termite colonies in her can buy some basic organic inputs such
farm. Other members who have used as diatomite powder that can protect
the extract agree with her. cereals such as maize, beans, rice or any
Apart from the use of plant extracts other cereal crops from pest damage
and the milking salve, the farmers have for long periods of time, for instance
also learnt how to prepare compost against the Larger Grain Borer.
Nr. 54 November 2009
Why some eggs fail to hatch ...answers in brief
Why do some eggs Cowpeas
remain unhatched What is cow peas in Kikuyu lan-
after the hatching guage?
period is over?
Chickens are Cowpea is known as thoroko in
Kikuyu language.
naturally rather
poor brooders. What type of cassava
Very often, only Thanks for your radio programme
a part of the eggs
^_`{|`{|H +"
will hatch. Even cassava MM96/5280 take to mature?
Bankiva-chickens, L.A Omuka. 0724 417 182.
the wild ancestors MM96/5280 is an early maturing
of our domesticated variety developed by KARI scientists.
chicken, are often It is tolerant
not very successful to Cassava
and have to start a M o s a i c
second and third Disease, has
clutch. There can sweet taste
be many reasons and is high
for unhatched eggs. yielding. The
If the egg was not variety takes
fertilized by a cock, 6 months to
no chicken will mature. For
develop. Eggs may also have remained cold for too long. In case the egg had a more infor-
crack or the shell was of poor quality, the egg might have dried out. Also the age mation get in
of the hen can matter: the proportion of unhatched and infertile eggs is larger touch with KARI Kakamega. P.O. Box
from the third laying period of a hen onwards. 169, 50100 Kakamega, Tel 056-30031.
Control ticks
Phosphorus is essential for plants Why are ticks common on some par-
Is organic phosphate better than DAP? ticular breed of cows than others?
Ruth Ruto, Bomet It is true that ticks may attack a par-
Phosphates are a naturally occurring ticular cow in the herd more than
form of phosphorus. Phosphorus is others but the reason for this has not
absolutely essential for both plants and been researched on. It may be similar
animals as an energy carrier and for as with mosquitoes some people get
growth and reproduction. bitten all the time while others remain
Rock phosphate in its natural form untouched. Some veterinarians say
is used in organic farming to provide animals with tender skin may be more
phosphorus to the soil for plant uptake. prone to attack but no scientific evi-
Rock phosphates release phosphorus dence exists to back this explanation.
and other minerals gradually and We would advise to ensure all your
Enriching compost with rock phosphate
slowly, and the effect may not be seen cows are dipped often to reduce tick
immediately. When using rock phosphate, you infestation which can cause several
DAP on the other hand is synthesized have to know: livestock diseases if they are not con-
in a factory by combining ammonia - Legumes and millets respond best and trolled.
with phosphoric acid. It contains both directly to rock phosphate, whereas on Super-gro
Nitrogen and Phosphorus which are maize the effect is only long term. I would like to know more about
transferred to the plant directly, as - In acidic soils, rock phosphate is more a product called super-gro.Which I
DAP is a water soluble fertilizer. soluble and more available to plants have been told is an organic fertilizer.
+"
"
>@$
- Rock phosphate shows best effects Do you really approve it. Walter from
plant food frequently, it increases soil when it is composted together with Rachuonyo district? Tel 0724 112 142.
acidity. In soils where DAP has been organic materials like manure or vege- Super-gro is a wetting agent that
used for long time it is difficult to tative matter. This natural acidification enables plants to utilize water more
reduce acidity. This reduces crop yields process makes it available to plants in efficiently. It is non-toxic, non-caus-
and income for the farmer. most soils. tic and environmentally friendly.
It is often mixed with pesticides to
make them work better when applied
Ratio of cocks to hens H +"
@
+"
#
] cock per 20 laying hens. If the cocks company who introduced it into the
Chicken naturally live in groups of start to fight seriously, weaker cocks country, registered it as a cosmetic
one cock and two to five hens. But if have to be removed. product running into problems with
the poultry they are kept in confine- If you want eggs for brooding, you the Kenya Plant Inspectorate Service
ment, there should not be too many will of course want that the entire }~$+ "
H
cocks, as they will start fighting and clutch is fertilized. In this case, one not available in most agrovet shops
may even kill each other. In such a rooster should probably serve not
H+"
-
system, provide not more than one more than six hens. lutely safe to use in organic farming.
Nr. 54 November 2009
Starting a proper organic kitchen garden
The Organic Farmer magazine your crops without damaging them.
often gets questions like this: I have Paths should be wide enough to take
recently moved to a new home and small wheel barrows, thus compost
would like to grow a kitchen garden can be distributed efficiently and har-
and flowers organically. Please advise, vesting can be done without damaging
thanks. I think it is important to the soil. Number the planting beds as
show how to set up a kitchen garden. this will help you with referencing and
record keeping.
Su Kahumbu Now that you have a map you need
to figure out what you are going to
Im happy to hear you intend to also grow and in what quantities. Once you
grow your flowers organically! have made a decision, start a planting
When locating a place for a kitchen calendar as shown below. This will
garden, a few considerations must be ensure you keep track of your planting
taken into account. Firstly choose a regimes as well as ensure you have a
spot with good, fertile soil. Secondly, continuous harvest.
there should be adequate water nearby Your planting calendar will follow the
as this will save you the trouble of planting patterns of the rains if you rely
trekking back and forth. If you have
H+"
any buildings close by, water could are using irrigation to water your crops
be harvested from the roofs. Thirdly, do proper planning so that harvest-
you should not have too many big ing time does not coincide with rainy a lot of compost fertilizer. Ensure you
trees in the area as crops have diffi- season to avoid losing your harvest keep all your biodegradable wastes
culty growing under big trees. Finally, especially for cereal crops. from your house and garden as well
ensure the area is safe from animals Some tips as from your flower garden, grass cut-
and even unwelcome humans who 1. Use your planting calendar to plan tings etc for this purpose.
may be tempted to taste your crops! your farm activities and follow good
Once you have the ideal location, crop rotation in each planting bed. This Compost Making
draw it out and take some measure- will reduce the incidence of pest and Again, choose the compost making
ments so that you have a kitchen disease on the crops. area close to a water source. Make
garden map. compost heaps ideally 2m long by 1m
2. Planting in beds with this plan will wide by 1 meter high, using layers of
allow you to adapt the system into materials you find on your farm such
Planting Bed 1 using drip irrigation very easily. One as crop wastes, kitchen wastes, green
Shed of the future TOF-editions will dem- materials e.g. tithonia and comfrey
Planting Bed 2 onstrate how this is done on the same leaves, weeds, dry leaves, manure,
Planting Bed 3 plan. wood ashes, and if available minjingu
Water Point Seed Beds rock phosphate. For a compost pile
Planting Bed 4 Before you begin to plant, start prepar- this size approximately 5 kg ashes and
Seed Beds
Planting Bed 5 ing your seed beds. This area must be 10 kg minjingu can be used. Make sure
Compost
area
near a water source and may require that as you make the layers, you keep
Planting Bed 6 a little shading if it is too hot. Prepare wetting them down just to a damp
your soil for your seed beds and dig stage, with water, or water with E.M.
up beds approximately 2m x 1 m. The When the compost is piled up,
From this map, draw out your plant-
number of seed beds will depend on cover it with plastic sheeting or banana
ing beds. I recommend beds that are a
the size of your kitchen garden. An leaves and wait for 3 weeks making
meter wide and can run for up to 50
eighth of one acre plot may require sure to check it does not dry out. After
meters. Between each bed leave 1.5 feet
2 seed beds this size. Incorporate a 3 weeks turn it and again make sure it
of space as a path. Once you have pre-
large amount of very well decomposed is damp; then cover it again. It will be
pared the beds it is imperative that you
compost into the seed bed soil. It is ready when it resembles dark brown
do not trample on the soil again. Many
important that this soil drains well but rich soil and has a great earthy smell.
farmers do not leave paths and thus
does not dry too quickly. This may take a few months. If it has
damage the soil structure as they weed
Follow the direction on your seed a bad smell do not use it, but turn and
and tend to their crops. If you have a
packets with your planting calendar stop it from getting too wet which is
path running down the side of the bed
so that you do not under or over plant. probably why it was smelling.
you can easily do all maintenance on
An organic kitchen garden requires Make a new compost pile as often
Planting calendar as possible so that compost is always
available for application in your
Bed Crop Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec kitchen garden. Transplant seedlings
1 kale tp w h h h c/p when they are approximately 1 month,
1 carrot d/s w w t h h c/p and water them well, especially after
planting. For your flowers, use the
2 corn c/p d/s w t/d h same compost. Put mulching material
2 beans c/p d/s w w h c/p around the bases of the plants to keep
2 potato d/s w t/d h h soil moist and avoid having to water
frequently. You can do the same with
tp = plant w = weed t/d = top dress c/p = clear and other crops.
d/s = direct seeding h = harvest t = thin prepare bed Voila, keep the cycle going! Good Luck!
Nr. 55 December 2009
Table 2: A guide to a good crop rotation sequence for some common cropss
Good in the preceding season Planted crop Good to plant afterwards
All crops are good maize, sorghum, millet all crops except carrots
All crops except wheat, barley, oats wheat, barley, oats all crops except wheat, barley, oats
Legumes, maize and other grains, cotton, sweet
rice cowpeas
potatoes
Maize, grains, rice, irish and sweet potatoes, sun- Irish potatoes, tomatoes, cabbages,
legumes
flowers, spinach squashes, maize, grains, cotton
Irish potatoes, tomatoes, cabbage, onions,
Maize, grains, spinach, carrots, onions beans
maize, grains
Spinach, maize, grains, fodder grass groundnuts grasses, cotton
cabbages, spinach, onions, pumpkins and
Maize, grains, grasses, legumes, spinach, onions,
Irish potatoes squashes, sunflowers, soybeans, maize,
sunflowers
grains, lettuce
Legumes (and all families except nightshades and
tomatoes cabbages, maize, grains, grasses
the cucumber family)
Maize, grains, grasses, legumes, tomatoes, irish
cabbage family only maize, grains, grasses, leeks
potatoes, onions
Irish potatoes, onion family, spinach, legumes, root crops (but not Irish potatoes):
pumpkin, squashes
maize, grains, grasses carrots, sweet potatoes, yam, cassava
Cucumber family, onion family, beet family, grains,
carrots maize, grains, grasses, beans
grasses
Grains, french beans, irish potatoes, spinach onions all crops except onion family
Cucurbits, spinach, lettuce, sunflowers sweet potatoes legumes, maize, rice, grains, grasses
Onion family, irish potatoes, carrots, peas, grains, groundnuts, soybeans, all crops except the
spinach
grasses beet family and lettuce
Maize, grains, spinach sunflowers Irish potatoes, maize, grains, legumes
Nr. 57 February 2010
pm
ur ili
FR
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
30
s
TO
Ki
C
KB
15
Nr. 44 January 2009
Moringa can feed both people and animals
Each part of a Moringa tree,
from top to the roots,
is useful to the farmers.
The Organic Farmer
Even though it is an exceptionally
resourceful plant, the Moringa tree has,
to date, received little attention in our
country. You might know it as mrongo
or mzunze or under the English names
Horseradish tree or Drumstick tree.
Other times it is even called mothers
best friend. Names aside, it may well
have the potential to become your best
friend in future!
Rich in all types of vitamins The moringa tree is identifiable by its long pods. Photos: www.treesforlife.org
Almost every part of the Moringa tree The flowers, rich in calcium and potas- planting. The seeds should germi-
is edible. The leaves are the most essen- sium, are not only a good source of nate within 15 days. The best time for
tial product of the tree. You can eat nectar for bees but can also be boiled sowing is at the beginning of the wet
them fresh or cooked like spinach, and eaten as a vegetable. Further, season.
or you can store the leaves as dried dried flowers provide you with a nice Cuttings of healthy branches with
powder for many months to supple- tea. Finally, the pods can be cooked hard wood ( 1 m to 1,5 m long) should
ment soups and sauces. And, of course, like green beans; the seeds from more be taken in the rainy season. Let the
the leaves provide great forage for mature pods can be eaten like peas or cuttings ends dry in a shady place for
your livestock. roasted like nuts. 3 days, then place one third of each
Scientific research confirms that the An organic fertilizer cutting length in the soil. If you keep
leaves are of high nutritional value. Moringa trees are very useful especially the soil moist but not over watered, the
They contain seven times the vitamin for organic farmers. Apart from provid- branches will take root readily in just
C in oranges; four times the calcium ing a live fence around homesteads or a few months. Within three years of
and two times the protein in milk, four serving as a windbreak, they produce planting, a single tree may produce 300-
times the vitamin A in carrots and three a lot of biomass, since they grow very 1000 pods annually. Frequent pruning
times the potassium in bananas (see fast and can be planted close to each following harvesting is recommended
the graphic below). other. The high protein content in the as it promotes branching and increases
foliage serves as an organic fertilizer leaf growth. And your animals will
The Organic Farmer is an independent for the surrounding food crops. The benefit from this healthy fodder!
magazine for the Kenyan farming com- deep roots without extended shallow, Increasing demand
munity. It promotes organic lateral branching do not compete with Earthoil Kenya is at the moment the
farming and supports dis- nearby crops, and its loose canopy pre- biggest buyer of moringa seeds in the
cussions on all aspects of vents excessive crop shading. country (Earthoil Kenya PTY EPZ Ltd,
sustainable development. The The Moringa tree is well known in the Langata South Road, Nairobi, Tel: 020
Organic Farmer is published traditional medical practice, especially 891 13 46, 0728 023 240). The farm gate
monthly by icipe and distrib- in India. The leaves, flowers and pods price for Moringa seeds shot up to
uted free of charge to farmers. The reports have been claimed to function as a Kshs 40/kg in early 2008. By now, the
in the The Organic Farmer do not necessar- natural medicine with anti-bacterial and farming of Moringa for commercial
ily reflect the views of icipe. anti-inflammatory effect. Finally, you purposes has taken root in Nyanza
The Organic Farmer is sponsored by BioVi- can purify water by adding pounded province, where 71 farmers groups
sion, a Swiss-based foun- Moringa seeds to dirty or even muddy deliver Moringa seeds and leaves twice
dation for the promotion of water. The solid matter will then sink a year and generate additional income
sustainable development. to the bottom and the surface water can from the recently rediscovered multi-
www.biovision.ch be used after boiling. purpose tree.
Publisher African Insect Science for Food How to grow Moringa You can buy Moringa seeds from: Kenya
and Health (icipe), P.O. Box 30772, 00100 Although the Moringa is originally con- Forestry Research Institute. Call John
Nairobi, KENYA, Tel: +254 20 863 2000, sidered a tree of hot semi-arid regions, Obango, 0722 763 016
icipe@icipe.org, www.icipe.org it has also proven to be well adapted to
Editor Peter Kamau wet conditions. Water logging should Plus: 4 times
the calcium in Plus: 4 times
Secretariat Lucy W. Macharia be avoided as it can cause root rot, the milk the vitamin A
Layout In-A-Vision Systems, 0720419 584 only common disease that threatens in carrots
7 times the
Advisory Board Nguya Maniania, icipe, Moringa. The tree does best in well vitamin C in
Charles Kimani, farmer, Wangige, Joseph drained and sandy or loamy soils. Nev- oranges
Mureithi, KARI, Henry Kiara, ILRI, Christian ertheless, the tree also tolerates heavy
Borgemeister, icipe, Sunday Ekesi, icipe clay soils.
Address The Organic Farmer Moringa trees can be grown from
P.O. Box 14352, 00800 Nairobi, KENYA seeds, stem cuttings and even from
Tel: +254 20 445 03 98, 0721 541 590 Plus: 3 times Plus: 2 times
roots. Soak the mature seeds in water the potassium in the protein in
e-mail: info@organickenya.com, for one day and then plant them one bananas milk
www.organicfarmermagazine.org inch deep. Keep the soil moist after
Nr. 44 January 2009
To advertise contact: James Wathuge 020 356 4106, 0720 419 584, 0733 893 300, email: thefarmersclassied@mailnew.com
BURNS:
Milk it. Milk is an excellent compress for minor burns, says Stephen M.
Purcell, D.O., chairman of the Department of Dermatology at Philadel-
phia College of Osteopathic Medicine and assistant clinical professor at
Hahnemann University School of Medicine in Philadelphia. Simply
soak the burned area in milk for 15 minutes or so, or apply a milk-
soaked washcloth to the area. Whole milk is effective: Its fat content
soothes burns and promotes healing. But make sure to rinse your skin and the
washcloth in cool water afterward, because the milk will smell.
Source: www.mothernature.com
Nr. 45 March 2009
pm
ur ili
FR
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.com
30
s
TO
Ki
C
KB
15
Nr. 45 March 2009
Inspired by TOF, Subukia farmers form groups
TOF has always advised farmers to
form groups. Farmers in Subukia
complied and benefitted.
Katharina Kijani.
Paul Njenga leans against one of his
forty large avocado trees and proudly
explains, I started growing avocados
in 1984. At that time, I was the only
farmer with avocado trees in Subukia
valley. Since then, I have continued
selling seedlings from my tree nursery
to surrounding farmers, and I am still
teaching others how to graft avocado
trees. Paul Njengas passion for avo-
cados has led to the foundation of a TOF Radio producer John Cheburet interviews Subukia farmers. (Photo TOF)
farmers group -Miroreni Horticulture to start meetings in order to share and
Every farmer with at least four
Growers with 40 members. It was reg- discuss ideas from the articles and sec-
Avocado trees can join the group after
istered by the Department of Social ondly to dispel doubts about the ben-
paying a registration fee of Kshs. 300.
Services in 2006. All the farmers who efits of organic farming. In each of their
The farmers group is well organised.
now grow organic avocados come from monthly meetings, they read articles of
Each member pays a monthly contri-
Munanda location in Subukia valley in interest from the magazine and discuss
bution of at least Kshs. 200. They hold
Nakuru North district. possible ways of implementing new
a general meeting on the first Wednes-
An active group day of every month. methods of farming.
The groups chairperson Paul Njenga The disciplinary board of the group Young poultry farmers
recounts that, from the beginning, his can penalise members if they do not Adjacent to the avocado group, a
avocados have been organically grown attend meetings, fail to hand in money second farmers group specialising in
as chemical fertilizers would, in his in time or sell against the groups regu- poultry keeping has been established.
own words, completely spoil the taste lations to individual buyers. After the The Good Shepherd Youth Group is
of my avocados. He has not had any second warning or a fine, an errant mainly composed of young farmers
serious problems with pests or diseases member has to leave the group. The between 18 and 25 years old. John
that would have forced him to spray chairperson, secretary and treasurer Njuguna Muchina, the chairperson,
pesticides. are elected once a year by all members sees his main objective as proving to
through a secret ballot voting system. the youth, that poultry keeping can
The Organic Farmer is an independent There is also a regular assessment to be a profitable business and farming
magazine for the Kenyan farming com- ensure all members observe organic a highly reputable profession. At
munity. It promotes organic standards. Njenga says that there is the moment, the group has 15 active
farming and supports dis- a high level of integrity and commit-
ment amongst his farmers who have Continued on page 6
cussions on all aspects of
sustainable development. The to maintain high standards of organic
Organic Farmer is published farming.
monthly by icipe and distrib- Organic pays
uted free of charge to farmers. The reports The farmers group received a real boost
in the The Organic Farmer do not necessar- in early 2008, when they established
ily reflect the views of icipe. contact with the US-based company,
The Organic Farmer is sponsored by BioVi- Olivado, which after a rigorous assess-
sion, a Swiss-based foun- ment started buying avocados from
dation for the promotion of them. Olivado buys organic avocados
sustainable development. from farmers groups to process them TOF celebrates
www.biovision.ch into certified organic and fair trade fourth birthday
Publisher African Insect Science for Food avocado oil at their production facility In April 2004, we launched your mag-
and Health (icipe), P.O. Box 30772, 00100 in Nairobi. The deal assures all partici- azine, The Organic Farmer. In view
Nairobi, KENYA, Tel: +254 20 863 2000, pating farmers of a regular buyer, per- of the commemoration of this event
icipe@icipe.org, www.icipe.org manent access to a market and above in April, we shall publish a short
Editor Peter Kamau, Peter Baumgartner all, a much higher price. Instead of series on farmers groups in Subukia
Secretariat Lucy W. Macharia selling avocadoes to the local market at valley as an example of all the farmers
Layout In-A-Vision Systems, 0720419 584 between Kshs 400 -500 a bag, they now groups we are dealing with. How has
Advisory Board Nguya Maniania, icipe, sell at Kshs 1,500 a bag. The farmers TOF influenced their farming methods
Charles Kimani, farmer, Wangige, Joseph save on transport costs and time; they and their social life? And what is the
Mureithi, KARI, Henry Kiara, ILRI, Christian gather the harvest at their chairmans experience of Charles Munyari, a TOF
Borgemeister, icipe, Sunday Ekesi, icipe place from where the buyer comes to distributor since the inception of the
Address The Organic Farmer collects them. magazine?
P.O. Box 14352, 00800 Nairobi, KENYA Paul Njenga points out that The Organic In this second article on this page, we
Tel: +254 20 445 03 98, 0721 541 590 Farmer magazine played a central role in feature farmers in Subukia who have
e-mail: info@organickenya.com, starting off the farmers group. Primar- formed groups after gaining experi-
www.organicfarmermagazine.org ily, the magazine prompted the farmers ence from the magazine.
Nr. 45 March 2009
-TOF
in this issue issues and the Infonet-biovision infor-
mation platform, but can also purchase
Animal health 3 organic inputs.
Small problems such as bloat and These centres will be stocked with
foot rot need attention.
Parasites 4 Our new centres some of the essential organic inputs
that farmers need but have been unable
An animals health deteriorates The Organic Farmer, with support from
its sponsor, BioVision, will open 4 to obtain from their local agrovet shops.
unless they are regulary dewormed. This initiative, which is supported by
information centres in the country
Beekeeping 8 in August this year. The centres will BioVision Foundation, will be under-
Learn how to attract bees to your provide farmers with information and taken on a pilot basis (See our article on
new hive. also organic inputs. The pilot project this page and also on page 6). Should
to be called i-TOF has selected the 4 the project succeed, more centres will
centres in Kangundo in Eastern prov- be opened in other parts of the country.
ince, Gatuto in Central province, Molo It is up to the farmers to make use of
in Rift valley and Buyangu in Western these centres to keep them going. We
Province. An extension officer will hope that you will utilise the facilities
be deployed in each centre to train to improve production and gain the full
ce
pm
ur ili
FR
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0717 551 129, 0738 390 715, Email: info@organickenya.org
30
s
TO
Ki
C
KB
15
Nr. 50 July 2009
Bloat can cause death if not treated on time
Bloat can be a problem For more severe cases where the
when animals are introduced animal cannot swallow, you can tie a
to lush green pastures. rope across the mouth of the animal
to make it chew the rope to stimulate
William Ayako belching.
For very severe cases of frothy and
Barely a month ago, most livestock gassy bloat when the animal is dis-
keepers were so worried about the tressed and cannot breathe, it is advis-
effects of prolonged drought on their able to puncture the skin carefully and
animals. As a result of this, most the rumen of the animal on the left
livestock keepers incurred very high flunk to let the gas out. Use a knife or
losses. Some pastoralists lost up to 50 any sharp thing, but the best instru-
% of their animals. ment to use is the trochar and cannula.
However, with the onset of the long The hole should be made at a hands
rains, livestock keepers especially goat, width behind the last rib and a hand
sheep and cattle keepers are faced away from the edge of the backbone.
with yet another problem: Bloat. Bloat Push hard because the skin is very
occurs when there is an abrupt nutri- tough. Gas and froth will come out
tional change in the diet and especially The swollen abdomen is a typical sign of when you make the hole. It helps to
when cattle feed on the lush green gassy bloat. Photo PD put a tube or cannula through the
pastures causing the swelling of the average cow can produce over a thou- hole to keep the hole open. Pour some
rumen with gas. sand litres of gas in a day. Some of the vegetable oil into the rumen through
Clinical signs of bloat gas is removed by absorption into the the hole to help stop further gas or
The left side of the abdomen behind the blood stream, but most of it is removed froth formation. Do not carry out this
ribs becomes very swollen causing dis- by belching during cudding. If for procedure on your own. Contact a vet-
tressed breathing, and the animal alto- whatever reason the gas cannot escape, erinary doctor.
gether stops eating. Sometimes green the rumen is literally overblown and Prevention of bloat
froth comes out of the mouth and nose. the animal gets bloat. Feed the animals with dry grass to fill
Some animals may have diarrhoea. Types of bloat them up before you put them on new
The rumen of cattle, sheep and goats There are two types of bloat namely, wet lush pasture.
is like a large vat in which a mixture frothy bloat and gassy bloat. Do not water the animals just before
of partly digested feed and liquid is Animals get frothy bloat when the you put them on wet pasture.
continuously fermenting producing rumen becomes full of froth (foam) Do not graze the animals on wet
large quantities of gas. For example, an because the digestion is upset. Several green pasture early in the morning.
animals in the herd get this type of Wait until when the pasture has been
The Organic Farmer is an independent bloat at the same time when they graze dried up by the heat of the morning
magazine for the Kenyan farming com- on a lot of wet, green pasture mixed sun.
munity. It promotes organic with legumes in the field. Animals can You should increase grazing hours
farming and supports dis- also get it when they feed on ripe fruits of the animals on wet green pasture
cussions on all aspects of or other feeds that ferment easily. Some gradually for about a week.
sustainable development. The poisonous plants can cause sudden Avoid abrupt changes in the diet of
Organic Farmer is published and severe bloat. A sudden change in animals and always give newly intro-
monthly by icipe and distrib- the type of food can also cause frothy duced feeds in small quantities.
uted free of charge to farmers. The reports bloat. Frothy bloat normally happens
in the The Organic Farmer do not necessar- at the start of wet season when the diets
ily reflect the views of icipe. of grazing animals abruptly change
The Organic Farmer is sponsored by BioVi- from dry feeds to wet lush pastures.
sion, a Swiss-based foun- Animals get gassy bloat when the
dation for the promotion of rumen fills with gas because the oesoph-
sustainable development. agus is blocked. This type of bloat nor-
www.biovision.ch mally affects one or two animals in the
Publisher African Insect Science for Food herd at the same time. They get it when
and Health (icipe), P.O. Box 30772, 00100 they choke on something or eat plastics
Nairobi, KENYA, Tel: +254 20 863 2000, or when they get a disease like tetanus
icipe@icipe.org, www.icipe.org that paralyses and hinders them from
Editors Peter Kamau, Peter Baumgartner ruminating.
Secretariat Lucy W. Macharia Treatment of bloat
Layout In-A-Vision Systems, 0720 419 584 Depending on the type of bloat, several
Advisory Board Nguya Maniania, icipe, methods of treatment can be applied:
Charles Kimani, farmer, Wangige, Joseph Do not feed the animal for several
Mureithi, KARI, Henry Kiara, ILRI, Christian hours. Make them move around to
Borgemeister, icipe, Sunday Ekesi, icipe exercise and improve on digestion.
Address The Organic Farmer For less severe cases of frothy bloat,
P.O. Box 14352, 00800 Nairobi, KENYA give 500 mls and 100 mls of any edible
Tel: +254 20 445 03 98, 0738 390 715, vegetable oil, solid cooking oil, butter
0717 551 129, info@organickenya.org oil, ghee or milk orally to large and
www.organicfarmermagazine.org small animals respectively.
Nr. 50 July 2009
Jairus Lihanda
There are several reasons that prevent
bees from colonizing a hive. One of
them is pest infestation. Such pests
may include ants, wasp, and rats. If
the hive has rats nesting in it, it will
definitely never be colonized. Rats also
leave a bad smell even after they have
been removed from the hive. So first,
ensure the hives are free from any
pests. If there are pests clean the hive.
Secondly, have the hives waxed. In case
you are using the Kenya Top Bar hives,
wax the bars. For Langstroth hives,
wax the frames well.
The second major reason is the apiary
siting. If the apiary is sited in a dampy
area, it is not a conducive site for bees. original site, repeat the procedure once to the bees to encourage them to stay
Bees need a site where they can main- more. on.
tain right moisture content in their Once you have the bees, leave the box You can also colonize your hives
honey. in a shady place until evening. Make by making colony divisions. Transfer
A third reason would be the condition sure it does not become hot in the comb with the queen cell, one other
of the hive. If the temperatures are too container by covering it with a damp comb of brood, and two combs of food
high in the hive, bees may dislike such cloth. (honey and pollen) into a catcher box/
a hive. Hives should be sited under a In the evening, take the bees home new hive. Include bees on all combs.
shade. and shake them into your empty hive. Shake in bees from other combs as
Lastly, the positioning of the hives can If you have other hives, take out a well. Remember to put brood combs in
keep the bees away because they do comb with some uncapped honey and the middle and honeycombs on either
enter hives mostly during swarming a brood comb with eggs and give them side to insulate the brood nest.
seasons. However, bees have swarm-
ing routes. These routes are high up
above buildings. Try placing your hives
Stingless bees
in catcher positions (on top of trees or Is it true we have a new variety of bees that in Kenya. We advise interested bee
buildings) or use a catcher box to catch do not sting? If yes, how can a farmer get keepers to concentrate on the honey
bees and transfer them into the hives. them and for how much? I am a farmer, Bee (Apis Mellifera). One of he major
now keeping rabbits. 0721 611 080. reasons that keep off interested bee-
Pack the bees in the hives keepers is fear, but just like you are
If you try all these and bees still do not
Yes, it is true; there is a species of used to your rabbits, you can get used
enter your hives, you can put them into
bees that do not sting because they to your bees.
the hives. There are different ways of
are stingless. These bees colonize dark First be careful, taking every precau-
doing this, but for this operation, it is
best to seek help from an experienced areas and are hard to try and domes- tion against the stings. Invite an expe-
friend. The swarm has a better chance ticate. They produce less quantity of rienced beekeeper to start you off. But
of staying in its new hive during a honey as compared to the stinging the more you visit the hives, the more
nectar flow. Do not waste time with bees. However their honey is highly you get used to the bees. In fact, for an
swarms smaller than a persons head medicinal. experienced beekeeper, the bee sting is
as they cause more trouble than they Keeping of stingless bees (meli- healthy!
are worth. poniculture) is not yet commercialized Jairus Lihanda
First, prepare your hive by smearing
it with some melted beeswax, so that from page 4: Worms ries, and nettle are also other plant
smells nice for bees. species with
Look for a swarm of bees clustering Cucurbits: Pumpkin seeds contain a deworming
on a branch from where you can catch deworming compound called cucur- properties
them. Wear your bee suit and smoke bitacin. The seeds may be fed directly that should
them very gently so as not to disturb to animals. be accessible
them. (Do not smoke if you can avoid Lupin: A diet made up entirely of in pastures.
it!) Shake the bees into a catcher box or freshly cut, lightly salted lupin is a F e n n e l
similar container, e.g., cardboard box. good dewormer. It is important not to leaves and
If the queen falls into the box, the rest allow free access to lupin; otherwise seeds are
of the swarm will follow. Wait for 20 symptoms of poisoning may occur. also used as
minutes or so. If they return to their Other plants: Blackberries, raspber- dewormers.
Nr. 51 August 2009
-TOF
governments regulatory agencies who anyone would ask themselves is: How
fear that such seeds could threaten the can a government that pledges to meet
entire industry if they are infected. the countrys food requirements fail Finally we are happy to inform you
to resolve such a small issue as recov- that the information and organic input
ering land meant for seed produc- (i- TOF) centres we promised you have
Alternative fodder 4 tion for almost two decades? And if started in four areas in the country. We
Beetroot can provide fodder for the recovery of the land is difficult, encourage farmers near these centres
your animals during dry season. are there no other ways that can be to make use of them to get information,
Internal parasits 5 devised to ensure the countrys capac- training and even buy organic inputs.
Liver flukes reduce milk production, ity to produce potato seed is not com- (See page 6). The future of agriculture in
fertility and cause death in livestock. promised? The potato seed shortage Africa depends on well-informed farmers
Poultry production 8 is a clear indication that we can no ready to adopt sustainable methods that
Take care of your eggs to reduce longer rely on the government to solve improve food production and income.
losses. farmers problems. See page 2 & 3
io
ad
FR
TO
Nr. 51 August 2009
As you read this copy of The Organic i-TOF Central: Gatuto/Kagio, Kirinyaga The following conditions apply to all
Farmer, the four information and organic district, in cooperation with the Amuka groups that will undergo the i-TOF train-
input centres (i- TOFs) which we had Farmers Self Help Group Gatuto; ing programmes:
promised you in the past two months i-TOF Eastern: Kangundo, in coopera- The training will be conducted free of
have been opened and are now opera- tion with the Kangundo Dairy Farmers charge to all farmers groups.
tional. Farmers living near these centres CBO, Kangundo. The farmers have to identify a training
can now be able to access information i-TOFs for farmers venue and organise a demonstration plot
and also buy organic inputs that are With the opening of the four centres, where the training will take place.
environmentally safe and which will help The Organic Farmer is moving closer Training will be offered to farmers
reduce reliance on chemicals. The use of to the farmers. The reason for this is groups with at least 15 members and
chemical products has been found to have that farmers have often made called us above.
damaging effect on soils, beneficial organ- requesting to know if we can be able to Each training session will take 4 to 5
isms and even human and animal health. visit them and offer training courses on hours, farmers must observe punctuality.
Since this project is on a trial basis, we are organic farming. They have also made Close monitoring
working together with two agricultural numerous enquiries to us asking to show The i-TOFs are offering around 25 train-
institutions and with two active farmers them where they can buy organic inputs. ing modules in all areas of a sustainable
groups: For farmers groups, eager to get more agriculture to improve farming practices
i-TOF Baraka: Based in the Baraka Agri- knowledge in their profession, it is easy: for increased yield and income. We shall
cultural College, Molo, respectively in They can call the i-TOF extension workers monitor them closely. If we find that the
their outreach centres in Mau Summit, in their respective region (the cell phone farmers are gaining benefits from the
Kamara and Nyakinyua. numbers given below) and book them for information package including training
i-TOF Western: MajengolBuyangu, in a one day training on specific agricultural by our extension officers, then the project
co-operation with the Sustainable Organic areas. The extension workers are trained will be extended to other farming areas
Farming Development Initiative (SOF-DI) agronomists, equipped with a full infor- of the country in order to benefit more
in Buyangu, Ebunangwe, and Mukumu; mation package. farmers.
@ Q
farming methods and practises. It is for financial assistance to be able to hours. Farmers are therefore requested
also meeting one of the main objectives implement various projects within their to be at the training venue on time.
of The Organic Farmer, which is to move groups. We understand their wishes. The i-TOF programme is offering train-
closer to the farmers and solve their But The Organic Farmer as well as our ing modules in all areas of sustain-
problems in a more practical way. The radio programme and the i-TOFs are able agriculture and organic farming
project will be reviewed periodically concentrating on the information and to help farmers improve their farming
and the findings will form the basis for sharing of knowledge and skills within practises which will help them increase
the continuation of the i-TOFs and for a the small-scale farming community. We yields and income. The farmers are
possible expansion to other areas. do not offer any form of credit. Farmers also expected to use ecologically sound
Observe punctuality groups in need of credit facilities can farming methods that utilise the avail-
The i-TOFs have started very well. There make their own arrangements for these able resources in a way that protects the
are only two problems: with the various institutions that offer environment.
i-TOF centre, Kangundo, Eastern i-TOF centre Gatuto, Kerugoya
Host: CBO Kangundo Nairobi Host: Amuka Farmers Self- Nyeri
pm
ur ili
FR
TOF P.O. Box 14352, Nairobi 00800, Tel: 020 44 50 398, 0721 541 590, 0738 390 715, Email: info@organickenya.org
30
s
TO
Ki
C
KB
15
Nr. 47 April 2009
Charles Munyari, a tireless TOF distributor
Even after four years of distributing
TOF on foot, Mzee Charles Munyari
still likes his job
Felix Mbitu Murimi
At the second week of every month,
streams of farmers knock at my door
seeking to get a copy of The Organic
Farmer (TOF) magazine, says Mr.
Charles Munyari. What might look
like a complain is quickly translated
into a note of achievement and pride
when Mr. Munyari talks about his
experiences as TOF-distributor with
a lot of satisfaction.
Pushing groups ahead
Since the inception of TOF in 2005,
Charles Munyari, an organic farmer Charles Munyari, TOF distributor in Subukia valley, works on his compost. (Photo TOF)
in Subukia Valley, has been a success- other and eventually adopting organic Munyari is convinced that the future
ful distributor of TOF in his area. His farming, boasts the distributor. is bright for organic farmers in his
mode of distribution for the magazine Despite ensuring that the maga- area. His wish is summarised in a
is his legs or route 11 as it is popularly zine reaches farmers, over the years, proposal for a meeting of all organic
known. The energetic and focused Charles Munyari has helped in the farmers in the country. This forum, he
man (66) has defied limitations of his formation of farmers groups in his argues, would offer farmers a chance of
age, rough terrain and severe weather area. Through these groups, members sharing ideas and expertise on organic
conditions that are characteristic of this have been able to educate themselves farming, ecological balance and envi-
part of the Great Rift Valley to distrib- on various aspects of organic farming,
ute TOF to so many farmers groups ronmental protection. More to that,
sustainable agriculture and environ- farmers would have a chance to inter-
and schools. I feel happy when the mental management. I have learnt to
magazines reach the targeted people, act with their counterparts in looking
make compost, shifted form conven- for solutions to some of the challenges
quips Mr. Munyari. Furthermore, it tional to organic farming, and I will
is quite gratifying to see farmers dis- they face in organic farming.
never go back! declares the organic The answer to our question, on
cussing TOF articles, supporting each farmer with a distant look at his farm whether he will continue with the
The Organic Farmer is an independent that is an exhibit of his success in distribution of TOF comes very fast:
magazine for the Kenyan farming com- organic farming. Taking a walk around Of course! He shouts amidst some
munity. It promotes organic the farms in this area, it is evident that laughter. For me it is a good way
farming and supports dis- Charles Munyari is not the only one of meeting farmers and sharing with
cussions on all aspects of practicing organic farming but quite a them, he explains. I hope I can do
sustainable development. The number of farmers are. this for many years to come.
Organic Farmer is published Some challenges
monthly by icipe and distrib- At times, the activities of the organic
uted free of charge to farmers. The reports farmers in Subukia Valley suffer from
in the The Organic Farmer do not necessar- some setbacks. Firstly, the Agricultural
ily reflect the views of icipe. Extension Officers in the area, who
The Organic Farmer is sponsored by BioVi- visit farmers on their farms, tend to
sion, a Swiss-based foun- emphasize on conventional methods
dation for the promotion of of farming as opposed to the organic
sustainable development.
www.biovision.ch
ones. This trend, regrets Charles
Munyari, might water down the efforts
TOF celebrates
Publisher African Insect Science for Food of farmers groups because such gov- fourth birthday
and Health (icipe), P.O. Box 30772, 00100 ernment officers are always seen as In April 2004, we launched your mag-
Nairobi, KENYA, Tel: +254 20 863 2000, having much authority and knowl- azine, The Organic Farmer. In view of
icipe@icipe.org, www.icipe.org edge. The only contradiction in this the commemoration of this event in
Editors Peter Kamau, Peter Baumgartner situation is that the same Agricultural April, we published a short series on
Secretariat Lucy W. Macharia Officers often ask for copies of TOF farmers groups in Subukia valley as
Layout In-A-Vision Systems, 0720419 584 and use them as reference material on an example of all the farmers groups
Advisory Board Nguya Maniania, icipe, farming. we are dealing with. How has TOF
Charles Kimani, farmer, Wangige, Joseph Unavailability of most of the organic influenced their farming methods and
Mureithi, KARI, Henry Kiara, ILRI, Christian farm inputs usually proposed by TOF their social life? And what is the expe-
Borgemeister, icipe, Sunday Ekesi, icipe is yet another hurdle that farmers in rience of Charles Munyari, a TOF
Address The Organic Farmer this area have to overcome. Finally, distributor since the inception of the
P.O. Box 14352, 00800 Nairobi, KENYA just as in any other area, farmers in magazine?
Tel: +254 20 445 03 98, Subukia Valley would wish that they In this third and last article on this
0721 541 590, 0738 390 715 have enough copies for each one of page, we feature the work of Charles
e-mail: info@organickenya.org, them every month. Munyari, TOF distributor and organic
www.organicfarmermagazine.org All these hurdles aside, Charles farmer from Subukia valley.
Nr. 47 April 2009
Good opportunities
Huge interest for biogas units for organic farming
Our article on biogas (TOF Nr.45 Febru-
Organic farming offers Africa the
ary 2009) has attracted a lot of interest
best chance of breaking the cycle
from farmers. We have received dozens of
of poverty and malnutrition it
calls, SMS and even e-mails from farmers
has been locked in for decades,
who want to put their own units in their
according to a major study from
farms. Erastus Kiruiro, the KARI scientist
the United Nations. The head
who is training farmers on the new biogas
of the UNs Environment Pro-
technology, was also overwhelmed by
gramme, Achim Steiner, said
calls from interested farmers across the
the report indicates that the
country (Erastus allowed us to give his
potential contribution of organic
phone contact to farmers in our article).
farming to feeding the world
The response shows that farmers are
maybe far higher than many
eager to embrace appropriate technology
had supposed.
especially if it addresses critical areas
The research conducted by the
that affect them such as energy, and if
own units can get in touch with Kiruiro UN Environment Programme
this technology is affordable. A group of
(Tel 0722 30 38 81). He is willing to offer suggests that organic, small-
farmers in Kakamega even went ahead
advice but the farmers should be able to scale farming can deliver the
and put up their own units following the
meet his transport costs and cost of mate- increased yields which were
instructions we gave them in the article.
thought to be the preserve of
Any farmer group willing to put up their rials to be used for the units.
industrial farming, without
the environmental and social
Trap the condensed water in the gas pipe damage which this form of agri-
culture brings with it.
According to the feedback from An analysis of 114 projects in
farmers, we have noted another
problem with farmers who are making
1 Digester on lower
24 African countries found that
yields had more than doubled
ground than the
their own biogas units. Biogas carries where organic, or near-organic
house.
wit it some vapour that condenses practices had been used. That
inside the gas pipe during cold times Inlet increase in yield jumped to 128
(especially at night or during cold per cent in East Africa.
weather). If this water is not trapped in The study found that organic
a container, it will block the gas from Water trap bottle at practices outperformed tradi-
flowing to the kitchen, hence the gas the lowest point of tional methods and chemical-in-
is blocked by the water from reaching the gas pipe. tensive conventional farming. It
the kitchen. To solve this problem, also found strong environmen-
farmers can fix a bottle at the lowest tal benefits such as improved
part of the pipe. All they need is a Outlet soil fertility, better retention of
T-junction for the pipe and a trans- water and resistance to drought.
parent water bottle, as the sketches And the research highlighted
shown In this page illustrate. Digester on higher the role that learning organic
The water trap should preferably 2 ground than the Inlet practices could have in improv-
be a transparent plastic bottle (3 or 5 house. ing local education. Promoters
litre jerry can) so that one can see the of GM foods insist that a tech-
level of the water. If the lowest point nological fix is needed to feed
of the gas pipe is near the kitchen the world. But this form of agri-
(sketch 1), this is the point to fix the culture requires cash to buy the
water bottle. On the other hand, if the patented seeds and herbicides
lowest point is near the digester, then both at record high prices cur-
the bottle should be installed about a Bottle at the lowest rently needed to grow GM
metre away from the digester (sketch point of the gas pipe. Outlet crops.
2). A T-junction should be fitted at Regional farming experts have
the point where you decide to install long called for good farming,
Water trap bottle
the bottle. At the same time, a 12 cm Gas pipe rather than exclusively GM
long pipe, fixed into the T- junction, T-junction or organic. Better seeds, crop
should lead into the bottle that is rotation, irrigation and access
half-filled with water (sketch 3). The to markets all help farmers.
end of this pipe has always to be in Water bottle Organic certification in devel-
the water. This stops the gas from oped countries still presents a
Pipe for condensed high barrier to most African
escaping. If the condensed water fills
the bottle, it will overflow and the water exporters, the report points
pipe will always allow the gas to flow Water out. It calls for greater access to
uninterrupted from the digester to 3 markets so farmers from devel-
the kitchen. oping countries can get the best
prices for their products. TOF
Nr. 58 March 2010
TOF contains all a farmer needs 5Years TOF makes our work easier
TO
Mary Wanyonyi, Farm manager NYS-Centre, tre, Will
William Ndirangu, District Agricultural Officer,
Turbo Rongo District, came across the magazine in the
Mary Wanyonyi came was given a copy of The Organic year 2006, when he worked as the deputy DAO, Kisii
Farmer by an official from Etang (K) Ltd. She immediately
+ "
G//
X &
applied and uses the five copies for training NYS recruits Z&
[
+ \]
and farmers in the surrounding areas. The magazine my office with diseased plants and pests seeking solu-
has become an important reference material in her train- tions, which I can solve using the infonet-biovision CD
ing programme. Mary Wanyonyi is happy that some of and TOF. The magazine has enabled him to know many
the farmers have adopted sustainable agriculture. TOF farmers groups who now consult him on various prob-
covers every aspect of the agricultural enterprise from lems. About 20 agricultural extension officers from the
planning, budgeting and even the expected gross profit 4 districts use the magazine to train farmers on different
margins, Mary says. agricultural ventures.
Nr. 59 April 2010 Answers in brief
Dry season Sukumawiki
from page 2 fruit flies Please advise me on a variety of Suku-
mawiki seeds that can withstand dry
displaced at lowland areas by Bactroc- Orchard sanitation, which entails the col- season. Edwin Okello, Fort Ternan
era invadens but they remain a threat to lection and destruction of all unwanted 0713 458 363.
mango production in the highlands. fruits containing fruit fly maggot on the Most varieties of sukumawiki require
Ceratitis rosa and its close relative Cera- tree and on the ground, can contribute sig- water to grow well. Perhaps you can
titis fasciventris: Attack a broad range of nificantly to reduction in damaging fruit try Kale 1000 head that has some toler-
cultivated and wild fruits in addition to fly population in the orchard. This is a ance to drought.
mangoes. very laborious exercise but can be quite
Control methods effective if the fruits are collected regularly Spacing for pawpaws
There are several methods of controlling and destroyed twice a week for the entire I would like to grow pawpaws. What
season. The collected fruits should be is the best spacing? Wellington Njeru
fruit flies. African Insect Science for Food
placed in an Augmentorium (See picture). Tel. 0720 996 322.
and Health (icipe) promotes a combina-
tion of methods through the use of Inte- The Augmentorium which can be locally The planting holes should be 60 cm
grated Pest Management (IPM) technique. made serves the dual purpose of field sani- x 60 cm. Spacing will determine the
The primary management techniques are: tation and conservation of natural enemies number of plants to be planted. 2.5 m
of fruit flies. It is a tent-like structure that x 2.5 will accommodate 1600 plants.
Baiting techniques 2.5 m x 3 m will take 1332 plants and 3
confines fruit flies that emerge from fallen
The traditional method of fruit fly control m x 3 m, 1110 plants. Well-composted
rotten fruits that are collected from the
is based on use of food baits mixed with manure should be mixed with the top-
field and deposited in the structure while
a pesticide. The bait attracts the fruit flies at the same time conserving their natural soil and the holes filled with this soil
from a distance to the spot of application, enemies by allowing parasitoids to escape mixture when planting.
where the flies feed on the bait, ingest the from the structure through a fine mesh at
pesticide and die. The bait after mixing is Tissue culture bananas
the top of the tent. I would like to grow Cavendish tissue
normally applied to 1 square meter spot
on the canopy (away from the fruit) or on Mechanical fruit protection culture banana varieties where can I
the trunk of each tree in the orchard on a Wrapping or bagging of individual fruits get seedlings? Tel 0722 926 631
weekly basis starting from when the fruits with newspaper The common varieties being produced
are about in size and continues till the or plastic bags under the tissue culture method are
very end of the harvest. to prevent adult & -
A couple of commercial baits are avail- fruit flies from endish, Dwarf Cavendish. Farmers
able in the market such as Mazoferm, laying eggs on interested in buying these tissue
NuLure, Buminal and Solbait that can be the fruits is also culture bananas can contact the fol-
mixed with pesticide such as Spinosad a practice of lowing organisation: Africa Harvest,
and applied as above. Another commer- producing fruits P.O.Box 642 -00621, Nairobi, Tel.020
]^G_/`{+# that are free 7124083/1/6/5/2.
is already pre-mixed with pesticide (Spi- from fruit flies.
To be effective, Effective use of diatomite
nosad) and can be applied using the on- Can diatomite be applied to grains
label information on the container. the fruits must be wrapped or bagged
well before fruit fly attack, at least one already affected by weevils or any
Although pesticides are not permitted in other pests and work effectively.
organic farming, the principle of pot appli- month before harvest. Although laborious,
cation either on the canopy away from the it is an effective method for expensive fruit No chemical or biological control
fruit or tree trunk permeate the principles species produced for export or fruits pro- agent can kill pests already inside the
of organic farming. duced in backyard gardens for family use. grain. Once the pests get in, it is dif-
Research at icipe has shown that a Inoculate with fungal pathogen ficult to kill them until they come out.
protein bait from brewers yeast obtained During development mature maggot Diatomite and even the other chemi-
as industrial by-products when applied of fruit flies drop from the fruits to the cals used to control pests work by
in low volumes as spot spray to 1 square ground, burrow into the soil and form a contact with the pest. So only grains
metre of mango canopy or to mango trunk resting stage called the puparia. An impor- that are not affected by pests are pro-
provided good control of mango infesting tant part of fruit fly suppression research tected. But once the pest leaves the
at icipe includes soil treatment with fungal grain it is immediately killed. So you
fruit flies. Research is however continuing
pathogens to kill the mature maggot and are advised to apply diatomite early
at formulating the bait to enhance it attrac-
puparia. The active ingredient in the gran- enough before the pests set in.
tiveness to fruit flies and should be avail-
able as alternative to imported product in ules is a fungus called Metarrhizium aniso- Diatomite does not expire
the very near future. pliae, a naturally occurring fungus that is Does diatomite expire in cereals?
Orchard sanitation used worldwide as a biological pesticide = =
=+}+
Poorly managed or abandoned orchards for controlling different kinds of insect Diatomite does not expire when
and a variety of wild hosts can result in pests. The fungus is formulated as gran- applied in cereals. A farmer can keep
high population build up of fruit flies. ules and can be manually distributed by cereals as long they like, some have
hand and then raked into the soil under managed to preserve cereals for as
the mango canopy. Application is usually long as 3 years.
done once in the season at the onset of
fruiting and the fungus can persist in the Using moisture bottle
soil for over one year. Icipe is discussing Can we use any type of a bottle for
with a commercial company that may be testing moisture in grains or do we
willing to commercialize the fungus in the have specific one for this practice?
near future. Both plastic and glass bottle can be
Dr Sunday Ekesi & M.K. Billah have produced a
used to test moisture in cereals; but it
book on the control of the fruit fly and related must be transparent so that one can
pests: A Field Guide to the Management of Eco- see through the bottle to determine if
nomically Important Tephritid Fruit Flies in Africa there is any moisture in the grain to
An augmentorium attracts fruit fly predators (icipe)- ISBN 92 9064 209 2 (Nairobi, 2010). be stored
Nr. 59 April 2010
Use composted manure!
Is it advisable to use poultry manure
Use of avocado and Aloe Vera extract
directly to plant potatoes or any other ve us more information on the uses
crop? Peter Thiongo 0710 858 317 of avocados and Aloe Vera plants. They
do well here in Bomet. John Koech
All fresh animal manures contain Kenfap. Tel. 0725 033 900.
high amounts of ammonium which
may cause burning of crops. Fresh tsz Avocado has many uses due to its
manures may also contain pathogens high nutritional benefits. Like all fruits,
that are dangerous for people. Com- it is rich in minerals and vitamins. It is
posting eliminates both these risks and recommended as a high-energy food
it is more pleasant to apply composted for diabetics and people with high
material. If you apply fresh manure, blood pressure. It contains a very ben-
use only small amounts and spread it eficial and easily digestible fat.
thinly on the soil surface around plants Avocado cannot be cooked but
that are already established. Compos- should be eaten raw on bread and
ted manure can be used for everything, salads together with lemon juice, salt
e.g. for seedlings and at planting, and and pepper and sugar. It is also used
should be mixed into the topsoil. as a flavouring in the preparation of
ice creams, milk shakes and soups.
Lablab and dhania related? Avocado oil is also widely used in
Does lablab share anything with products for skin and hair care and NOTE: Pregnant women should never
dhania (coriander)? They both produce other cosmetics. take aloe vera as it causes uterus con-
a similar scent. Aloe vera on the other hand has many traction, which can create complica-
There is no scientific proof that the medicinal properties. It is widely used tions. Young children should also not
two belong to the same species. So it in herbal medicine and beauty prod- be allowed to take it internally.
is difficult to say if they have anything ucts because of its many benefits. In Recipe for a tasty avocado spread
in common. Lablab is a leguminous medicine, it is used to speed up healing 2 large ripe avocados
plant, a bean, while coriander belongs of burns. It is also said to control heart- 12 boiled eggs
to the Apiaceae family (together with burn, arthritis, rheumatism, swelling Juice of 2 4 lemons
parsley, carrots, and celery). These are and even asthma. Aloe vera is said to Salt, pepper, parsley, coriander etc,
two completely different plant fami- be a good laxative, antifungal, immune according to taste.
lies. But plants do not have to be system stimulant, antiviral, anti-bacte- Remove the shells from eggs and avo-
related to have common properties. It rial as well as a nutritional supplement. cados, mash and mix them together
may be possible that lablab and cori- Many poultry farmers in the counc- with the lemon juice. Add salt and
ander produce a similar scent but this try mix a few drops of Aloe vera gel spices to taste.
does not in any way show they are the with chicken drinking water to prevent Spread generously on bread, fill into
same. poultry diseases. tomato halves, eat with potatoes etc.
Rabbit keepers are frustrated of Ksh 30,000 for the smallest plant
to Ksh 55,000 for a plant with gas
storage capacity of 7 cubic meters. In
Many farmers have gone into that has no cholesterol and is therefore some cases this is as much as 30% of
rabbit keeping without verifying considered healthy. A large number of construction costs depending on the
the markets needs. people would consume rabbit meat if material used. The models are perma-
they knew of these benefits, thereby nent in the sense that they are guaran-
The Organic Farmer increasing demand and a ready market teed to work for a minimum of about
for local rabbit keepers. '/
+ #^
When a farmer makes a good return trained technician has to supervise
from a particular farming enterprise,
Not enough for export
A number of companies especially the construction. Farmers can contact
most farmers rush into the same one of the technicians promoting this
from China have expressed interest
expecting to make good money only to system, please call Mr Kamande from
in buying rabbit meat and even skins
end up being frustrated when the com- Thika Tel 0724 394 699 for details.
from Kenya. However, rabbit keepers
modity floods the market. This reduces
lack adequate quantities for a consis-
prices. Unfortunately, many farmers Dairy goats: We are looking for pedi-
tent supply to the external markets.
sometimes do not make any research gree dairy goats to provide high
Therefore rabbit breeders in every
before going into production. Market quality milk for HIV/AIDS patients to
region need to work together to be able
research is a very important aspect of be able to boost their immune systems
to raise enough rabbits whenever there
any business. and nutrition. Please give us their
is a market opportunity.
This is exactly what has happened to milk production rates and let us know
According to a prominent rabbit
rabbit production. Many Kenyans now if they can do well in South Rift Valley
<
&
&
face scarcity of land; rabbit keeping do not have the technical knowledge highlands. Joseph Koskei, Rural Proj-
should be an ideal venture as they do on how to prepare rabbit skins in the ects Support Facility, CBO, email:
not require a lot of space and initial right way to maintain the required e08kitur@yahoo.com
capital to rear. They can also be a quality. He says most of the skins being
cheap source of protein in many rural offered by farmers are poorly done Cassava, bananas for sale: I have
households. It is therefore important and therefore cannot get buyers locally, cassava and bananas for sale.
that farmers who keep rabbits only leave alone the export market. Any farmer who needs these prod-
rear a small number they can sell to It is important that farmers explore ucts can get in touch with me. Tel.
fellow farmers and also use for home the possibility of selling their rabbits to 0718476260/ 0727502903, Oliver
consumption. They can only produce fellow farmers in their area for the time Wetete Masungo.
in commercial quantities at such a time being. From there they can explore email-olivermasungo@gmail.com
that they can find a reliable market. potential markets and only rear the
number of rabbits, which they can be Rabbit Posters~ <
Awareness creation important various rabbit breeds and their best
The market for rabbit meat is not yet +
work in groups, this is one way they commercial use e.g. meat, skins and
well established in Kenya. In many
+ _X
communities rabbits are still consid- can share their experience and even
be able to raise enough rabbits when for only Ksh 200 and a free rabbit
ered unfit for consumption, in such management handbook. Farmers
communities only children are allowed the markets are established. There is
interested can contact James Wathuge
to keep rabbits and eat them. Most 0720 419 584, 0733 893 300
consumers of rabbit meat can only they only buy rabbits when they have
be found in urban areas, and this is orders. Farmers can contact the slaugh- Organic produce wanted:
a minority. Selling rabbit meat and terhouse on 0724 856 878, ask for Alice. Dreams / Food Network East Africa
skins is therefore a bit tricky and needs The ministry of Livestock and Fish- Ltd is urgently looking for organic
some bit of planning on the side of the eries Development has plans to start produce for its Nairobi stores. Farmers
farmer. educating people on rabbit breeding, with vegetables, fruits, grains, etc
A big awareness campaign is needed but the programme is yet to start. can contact Triza on 0721 793 411 or
to educate Kenyans on the benefits of In the May issue: More about skin prepara- Mwaniki on 0726 283 866 or email:
eating rabbit meat. It is a white meat tion and breeding. info@organic.co.ke
Text Formattierungen
paragraph
[paragraph]
... text ...
[/paragraph]
oder
[p]
... text ...
[/p]
ein paragraph ist ein einfacher abschnitt, oben und unten wird ein wenig platz gelassen.
list
es wird ne normale liste dargestellt mit jeweils nem - vor jedem eintrag.
[list]
[listitem]item 1[/listitem]
[listitem]item 2[/listitem]
[listitem]item 3[/listitem]
[/list]
title
es wird ein titel gesetz, das heisst der text ist fett und wird wie ein paragraph behandelt.
[title]Dies ist ein Titel[/title]
b
der text wird fett dargestellt. fr titel besser den title-tag benutzen.
[b]ich bin fett[/b]
br
es wird ein zeilenumbruch gemacht. wenn mglich paragraph benutzen.
[br]
link
es wird ein link erstellt.
[link XXX YYY]text[/link]
es gibt verschiedene links sie werden durch den oben mit XXX markiertn wert unterschieden. YYY ist
jeweils die adresse.
web
es wird ein normaler link erstellt welcher auf die angegebene seite verweist.
[link web http://www.google.ch]link zu google[/link]
email
es wird mailto link erstellt
[link email spam@spam.com]mail me some spam[/link]
document
es wird ein dokument aus dem documents bereich verlinkt. die angegeben nummer ist die id des
dokumentes und kann im dokumente bereich rausgefunden werden.
[link document 32]ein dokument[/link]
local
es wird ein lokaler link angesprungen, der lokale link muss ber einen target tag definiert worden sein.
die links gehen nur auf der gleichen seite.
[target]hallo[/target]
[link local hallo]ein lokaler link[/link]
image
es wird ein bild angezeigt. es kann eine der drei folgenden formen verwendet werden.
[image id]
[image id type]
[image id type width height]
"id" ist die id des bildes, sie kann bei dem bildupload rausgefunden werden.
"type" ist der typ des bildes, im augenblick ist nur "default" mglich. so wird das bild ganz normal
eingefgt ohne textfluss rechts oder links.
"width" und "height" geben die maximale breite und hhe des bildes an. standardmssig sind 300x200
pixel eingestellt.
tabelle
tabellen werden wie folgend definiert:
[table xxx yyy]
[row]
[cell]spalte 1 zeile1[/cell]
[cell]spalte 2 zeile1[/cell]
[/row]
[row]
[cell]spalte 1 zeile2[/cell]
[cell]spalte 2 zeile2[/cell]
[/row]
[/table]
"xxx" steht fr "left", "top" oder "leftTop" oder nichts oder "none". wenn left angegebn wird, wird die
erste spalte als header markiert, wenn top angegebn wird wird die erste zeile als header markiert. bei
"leftTop" werden beide als header markiert. yyy steht fr das lyout. im augenblick gibt es nur "simple"
welches keine umrandungen hat, gegenber dem default layout welches erscheint wen gar nix
angegeben wird.