Anda di halaman 1dari 32

BIOLOGI

BAB1

1. UN2011 4. UN2011
Di bidang pertanian, tanaman petai cina Perhatikan hewanhewan pada gambar
sangat bermanfaat pada daerah tandus berikutini!
karenadapatberperansebagai.
A. sumberkarbohidrat
B. sumberprotein
C. bahanantibiotik
D. pemasokbahanpengurai
E. pemasoknitrat Berdasarkanjenismakanannya,hewandi
atas mempunyai kekerabatan yang dekat,
2. UN2014 yaituketiganyatermasukordo....
Spesiesbakteriyangsesuaidenganpera A. rodentia D. primata
nannyaadalah. B. monotremata E. karnivora
A. Methanomonas methanika untuk pem C. marsupialia
buatankeju
B. Rhizobium radicula untuk menyu 5. UN2009
burkantanah Berikutininamalatinduajenishewan
C. Acetobacter xylinum untuk pembu 1.Pantherapardus(macantutul)
atanyoghurt 2.Pantheratigris(harimau)
D. Thiobacillus ferrooxidans untuk pem Dari nama latin hewan tersebut bahwa
buatancuka macam tutul dan harimau mempunyai
E. Lactobacillus casei untuk pembuatan hubungan kekerabatan yang paling
biogas dekatdalamtingkat....
A. spesies D. familia
3. UN2010 B. kelas E. genus
Contoh protista dan manfaatnya bagi C. ordo
manusiaadalah....
A. Geledium dan Diatomae sebagai ba 6. UN2009
hanagaragar Penulisan nama ilmiah yang benar
B. Radiolaria digunakan sebagai indika menurut aturan binomial nomenclatur
torminyakbumi adalah....
C. Euchema dan Spirulina digunakan se Keterangan
Nama Namapetunjuk
bagaiproteinseltunggal Namagenus
species
D. Entamoebagingivalismembantupen A Musa musa paradisiaca
cernaan Paradisiaca
E. Entamoeba coli membantu pemben B Musa musa paradisiaca
paradisiaca
tukanvitamin C musa musa paradisiaca
paradisiaca
D Musa paradisiaca musa
Paradisiaca
E Musa paradisiaca Musa
paradisiaca

7. UN2010 10. UN2008


Perhatikangambarhewanberikut! Berikutiniciriciriorganisme:
- berselsatuataubanyak
- intibersifateukariotik
- tidakberklorofil
- memilikihifa
- reproduksidenganspora
Perbedaan dari kedua hewan tersebut Organisme yang memiliki ciriciri ter
adalah.... sebuttergolong....
A. sistemrangkanya A. paku D. ganggang
B. jumlahruangjantungnya B. jamur E. bakteri
C. sisarespirasinya C. lumut
D. hasilrespirasinya
E. perubahansuhutubuhnya 11. UN2015
Ciricirijamur:
8. UN2011 1) Hifabercabangdantidaksekat.
Darihasilpengamatanairkolamdi 2) Pembiakanterjadisecaraseksualdan
bawahmikroskop,ditemukanprotozoa aseksual.
berikutini! 3) Menghasilkansporadalamaskus.
4) Mempunyaihifabersekatsekat.
5) Sporadibentukdalambasidium.
6) Membentuk spora berdinding tebal
yangdisebutzigospora.


Berdasarkan ciricirinya, protozoa 1, 2,
dan3secaraberurutantermasukkelom
pok....
A. Cilliata,Rhizopoda,danFlagellata
B. Rhizopoda,Flagellata,danCilliata
C. Rhizopoda,Cilliata,danFlagellata
D. Flagellata,Rhizopoda,danCilliata Ciriciri yang dimiliki oleh jamur pada
E. Sporozoa,Cilliata,danFlagellata gambaradalah....
A. 123 D. 346
9. UN2011 B. 126 E. 456
Kelompokjamuryangmenguntungkan C. 345
bagimanusia,antaralain....
A. Phytiumsp.,Phythopthorainfestans, 12. UN2015
danAspergilusfumigatus Pernyataan berikut merupakan ciriciri
B. Epidermophytonfloocosce,Ustilago suatutumbuhan:
maydis,danSaprolegnia (1) Berklorofil
C. Saprolegnia,Aspergilusflavus,dan (2) Berakarserabut
Aspergilusfumigatus (3) Memilikipembuluhangkut
D. Ustilagomaydis,Aspergilusflavus,dan (4) Berbungatidaksesungguhnya
Peniciliumcamembertii (5) Reproduksigeneratifdenganhifa
E. Volvariellavolvacecae,Auricularia (6) Sporaberkecambahmenjadi
polytrica,danAspergilusoryzae protalium

Ciriciri yang dimiliki oleh tumbuhan 16. UN2013


pakuadalah.... Dalamekosistemterjadirantaimakanan
A. (1),(2),dan(4) D.(2),(4),dan(5) berikut:
B. (1),(3),dan(5) E. (3),(4),dan(6) Padiburungpipitburungelang
C. (2),(3),dan(6) harimaudekomposer
Pernyataanyangmenunjukkanperan
13. UN2009 padarantaimakanantersebutadalah....
Suhu ratarata global pada permukaan A. padisebagaikonsumentingkatI
bumi telah meningkat 0,74 0,180C B. burungpipitsebagaikonsumen
selamaseratustahunterakhir.Hasilanalisis tingkatI
lingkungansebagaiberikut: C. burungelangsebagaikonsumen
1. Penurunanpermukaanairlaut. tingkatIII
2. Atmosfer diselimuti gas karbon di D. harimausebagaikonsumentingkatII
oksida. E. dekomposersebagaiprodusen
3. Berkurangnyavolumeesdikutub.
4. Eutrofikasisungaidandanau. 17. UN2012
5. Volumeozondiatmosferberkurang. Perhatikan diagram daur hidrologi beri
6. Efekrumahkaca. kutini!
Faktor yang berkaitan erat dengan
peningkatansuhupermukaanbumiadalah
....
A. 1,2,dan5 D. 2,3,dan6 X
B. 1,3,dan6 E. 3,4,dan5
C. 2,3,dan4

14. UN2009
Pernyataan berikut menjelaskan siklus BilaXterbakarhabis,dampakyangterjadi
karbon,kecuali... adalah....
A. Hutan berperan besar dalam siklus A. aliranairberkurang
karbon. B. tidak memengaruhi persediaan air di
B. Produsen mengubah karbon menjadi hutan
senyawaorganikkembali. C. bertambah besarnya aliran air dari
C. Fiksasi gas karbon dilakukan oleh gunung
organismeberklorofil. D. bertambah besar proses evapotrans
D. Respirasi makhluk hidup mengikat pirasi
karbon bebas menjadi senyawa or E. bertambahbesardayaseraphumus
ganik.
E. Batubaradanminyakbumiterbentuk 18. UN2009
oleh penumpukan senyawa berkar Perhatikangambardaurkarbonberikut!
bondilapisantanah.

15. UN2013
Dalam suatu ekosistem danau terjadi
perpindahanenergi.Energiyangtersim
panpalingtinggiterdapatdi....
A. ikan D. bentos
B. udang E. fitoplakton
C. burungbangau

Proses yang terjadi pada X dan Y secara perubahanfisikperairansungai,empang,


berurutanadalah.... ataudanaukarena.
A. oksidasidanrespirasi
B. respirasidanekskresi A. konsentrasiO2menurun,ikanmati,
C. transpirasidanrespirasi danterjadipendangkalan
D. fotosintesisdanekskresi B. peledakanpopulasibakterisehingga
E. fotosintesisdanrespirasi pertumbuhanplanktonterhambat
C. konsentrasipupukberlebihandapat
19. UN2012 meningkatkanpHperairan
Eceng gondok merupakan tanaman air D. populasitanamanpemfiksasi
yang berperan sebagai produsen pada nitrogensemakinmenurun
ekosistem air tawar. Pada kondisi ter E. berkurangnyakonsentrasioksigen
tentu pertumbuhan tanaman ini men dankarbondioksida
jadi sangat pesat karena adanya limbah
daripupuktanamanyangterbawaaliran 22. UN2014
air ke sungai, sehingga dapat menye Meningkatnyavolumekendaraandikota
babkan.... besarmengakibatkanpeningkatanpolusi
A. tanaman air yang lain dapat tumbuh udara.Carayangdapatdilakukanuntuk
denganpesatpula mengurangipolusitersebutadalah.
B. menumpuknya logamlogam beratdi A. melakukanpenghijauan
dasarsungai B. membuatmonoreldikotabesar
C. berkurangnya O2 di bawah permu C. menanampohonditiapruasjalan
kaanair D. lebihseringmengadakancarfreeday
D. berkurangnya CO2 di bawah permu E. membuat undangundang tentang
kaanair polusi
E. proses pembusukan berjalan sangat
lambatkarenatidakadaCO2 23. UN2013
Jika limbah organik yang berasal dari
20. UN2014 limbahrumahtanggadiekosistemsema
Pembakaranbahanbakarfosiluntukber kin banyak dan kadar oksigen terlarut
bagai kepentingan ternyata dapat me habis, proses pembusukan akan dilaku
nyebabkan terjadinya pencemaran ling kan oleh bakteri anaerobik. Akibat yang
kunganyangseriuskarena... ditimbulkan dari proses tersebut adalah
A. PolutanSO2danNO2menyebabkan ....
penipisanozon. A. timbulnyagasyangberbaubusuk
B. PolutangasCOmenyebabkan B. semakin menumpuknya sampah or
kematiantumbuhan. ganik
C. Polutan gas CO2 menyebabkan pe C. naiknyaphdiekosistemtersebut
manasanglobal. D. meningkatnya kadar oksigen pada
D. PolutanPO4menyebabkanterjadinya ekosistem
hujanasam. E. cepatnyapertumbuhantumbuhanair
E. Polutan CFC3 menyebabkan efek ru
mahkaca. 24. UN2011
Hutan yang dijadikan area industri akan
21. UN2014 mengakibatkan terganggunya keseim
Pemberian pupuk yang berlebihan di bangan makhluk hidup yang antara lain
area persawahan dapat menimbulkan ditunjukkanoleh....

A. hilangnyahumustanah 3. Contohprotistadanmanfaatnyabagima
B. berkurangnyasumberair nusiaadalahRadiolaria digunakan sebagai
C. hilangnyakeanekaragaman indikatoradanyaminyakbumi,sedangkan
D. menurunnyakesuburantanah organismelainadalah:
E. berkurangnyasumberoksigen GelediumdanEuchemauntukagaragar
Diatomaeuntukbahanpenggosok
25. UN2010 Spirulinauntukproteinseltunggal
Sampahplastikdapatmenyebabkanme Entamoebacoliparasitdiususbesar
nurunnyadayadukunglingkungan.Upa Entamoebagingivalisparasitdimulut
ya penangulangan yang tepat terhadap Jawaban:B
haltersebutadalah....
A. melarang masyarakat menggunakan 4. Berdasarkan jenis makanannya, yaitu
plastik hewan pemakan daging. Dengan demikian
B. membakarsampahplastik harimau, kucing, dan anjing mempunyai
C. meneliticarapenguraianplastik kekerabatan yang dekat, yaitu ketiganya
D. melakukandaurulangsampahplastik termasuk ordo Karnivora. Sementara itu
E. menguburplastikkedalamtanah untukordoyanglainadalah:
Rodentiamerupakanhewanpengerat
sepertitupaidantikus.
Monotremata merupakan mamalia
berparuh seperti bebek contohnya
platipus.
1. Bakteri nitrifikasi membentuk senyawa Marsupialia merupakan mamalia ber
nitrat (Nitrosomonas, Nitrococcus, dan kantungsepertikanguru.
Nitrobacter) adalah kunci dari daur Primata mamalia dengan kelenjar
nitrogen.Beberapahidupdibenjolanakar susudidadaadalahmanusiadankera.
petai cina, lainnya hidup bebas ditanah. Jawaban:E
Bakteriditanahmembautnitratdarinitrit
dan molekul nitrogen lainnya. Bakteri 5. Dari nama latin hewan tersebut, tampak
dalam benjolan akar kacang mengambil bahwa macan tutul dan harimau mem
nitratdaritanah. punyaihubungankekerabatanyangpaling
Jawaban:E dekatdalamtingkatgenus,yaitumemiliki
genus yang sama yaitu Panthera. Namun
2. Spesies bakteri yang sesuai dengan pera keduanya berbeda spesies. Tingkatan tak
nannyaadalah. sonkeduahewantersebutadalah:
A. Methanomonas methanika untuk pem Filum :Chordata
buatanbiogas. Classis :Mamalia
B. Rhizobiumradiculauntukmenyuburkan Ordo :Carnivora
tanah. Familia :Felidae
C. Acetobacter xylinum untuk pembuatan Genus :Panthera
Natadecoco. Spesies:Pantherapardus(macantutul)
D. Thiobacillus ferrooxidans untuk pemur Pantheratigris(harimau)
nianbijihbesi. Jawaban:E
E. Lactobacillus casei untuk pembuatan
keju. 6. Penulisan nama ilmiah yang benar me
Jawaban:B nurut aturan binomial nomenclatur adalah
Musa paradisiaca atau Musa paradisiaca.
Cara penulisan nama latin, yaitu dengan
dua tata nama yang digarisbawahi terpi
5

sah atau dicetak miring. Kata pertama Sementara itu kelompok jamur yang lain
merupakan nama genus diawali dengan berperansebagai:
hurufkapitaldankatakeduaadalahnama Phytiumsp.bersifatparasitmenyebab
petunjukspesiesyangdiawalihurufkecil. kanrebahsemaipadatumbuhan.
Jawaban:E Phythopthora infestans parasit di tana
mankentang.
7. Perbedaandarikeduahewantersebutada Aspergilus fumigatus menyebabkan
lah jumlah ruang jantungnya. Pada amfibi penyakitpernapasan.
(katak) jantung beruang tiga (2 serambi Epidermophyton floocosce menyebab
dan 1 bilik) dan pada pisces (ikan) jantung kanpenyakitkakiatletpernapasan.
beruang dua (1 serambi dan 1 bilik). Ustilago maydis parasit di tanaman ja
Sedangkanciriyanglainadalah: gung.
Sepertisistemrangkanyakeduahewan Saprolegniaparasitdiikan.
tersebut sama, yaitu rangka dalam Aspergilus flavus menyebabkan kanker
endoskeleton. mengandungracunaflatoksin.
SisarespirasinyasamaberupaCO2dan Jawaban:E
H2O.
Hasil respirasinya sama, yaitu adalah 10. Ciridiatasdimilikiolehkingdomfungiatau
ATP(energi). kelompok jamur adalah organisme uni
Perubahan suhu tubuhnya samasama seluler atau multiseluler, eukariotik/ber
berdarahdingin(poikiloterm)atausuhu membraninti, cara hidup heterotrof, tidak
tubuh berubah sesuai dengan lingku berklorofil,berspora,hidupditempatlem
ngannya. bap,memilikibenang/hifayangberkumpul
Jawaban:B membentukmiselium.
Jawaban:B
8. Berdasarkan ciricirinya protozoa tersebut
adalah: 11. Jamur yang ada pada gambar termasuk
Nomor 1 adalah Amoeba sp. termasuk jenis Rhyzopus yang tergolong filum
kelas Rhizopoda bergerak dengan kaki Zygomycota,denganciriciri:
semu. a. Hifabercabangdantidakbersekat.
Nomor 2 adalah Euglena sp. termasuk b. Bersifatkoenositik(mempunyaiinti).
kelas Flagellata bergerak dengan bulu c. Dindingseltersusundarikitin.
cambuk. d. Reproduksiaseksualdanseksual.
Nomor 3 adalah Paramecium sp. Terma e. Membentuksporaberdindingtebal
suk kelas Cilliata bergerak dengan bulu (zigospora).
getar. Jawaban:B
Jawaban:B
12. Ciriciritumbuhanpakuantaralain:
9. Kelompokjamuryangmenguntungkan a. Memiliki akar, batang, dan daun yang
bagimanusia,antaralain: sebenarnya (Kormophyta), akarnya be
Volvariella volvacecae adalah jamur rupaserabut,kecualipadapakutiang.
merang yang dapat dikonsumsi untuk b. Memiliki pembuluh angkut, terdapat
sumberprotein. lapisan pelindung sel (jaket steril) di
Auricularia polytrica adalah jamur sekeliling organ reproduksi, sistem
kuping yang dapat dikonsumsi untuk transportinternal,danhidupditempat
sumberprotein. yang lembap. Akar serabut berupa
Aspergilusoryzae,jamuruntuk rizoma, ujung akar dilindungi kaliptra.
membuattaucoataukecap. Selsel akar membentuk epidermis,

korteks, dan silinder pusat (terdapat 16. Perankomponenpenyusunekosistem:


xilemdanfleom). Padiprodusen, burungpipitkonsumen
c. Bersifat autotrof, beberapa hidup 1, burung elang konsumen 2, harimau
sebagai saprofit dan beberapa sebagai konsumen3,dekomposerpengurai.
epifit. Jawaban:B
d. Mempunyai daun tropofil (untuk foto 17. DaerahXmerupakanhutan,dimanahutan
sintesis) dan daun sporofil (penghasil berfungsisebagaipenahandanpenyimpan
spora). air serta menahan tanah agar tidak long
e. Fase sporofit lebih dominan daripada sor. Jika hutan terbakar habis, maka akan
fasegametofit. bertambahbesarnyaaliranairdarigunung.
Jawaban:E Jawaban:C

13. Faktoryangberkaitaneratdenganpening 18. Dalam daur karbon proses yang terjadi
katan suhu permukaan bumi adalah at pada X dan Y secara berurutan adalah
mosferyangdiselimutigaskarbondioksida fotosintesis dan respirasi. Di mana X ta
mengakibatkanefekrumahkaca.Selainitu, naman membutuhkan gas karbon diok
es di kutub bisa mencair (berkurangnya sida untuk berfotosintesis dan meng
volumeesdikutub)dannaiknyapermuka hasilkan gas oksigen dalam fotosintesis,
anairlaut. sehingga oksigen dimanfaatkan oleh he
Jawaban:D wanuntukbernapas/respirasi.
Jawaban:E
14. Karbonterdapatdiatmosferdalambentuk
Karbon dioksida yang akan masuk kom 19. Eceng gondok yang tumbuh lebat di per
ponen biotik melalui produsen. Karbon mukaanakanmenghalangisuplaioksigenke
dioksida akan digunakan untuk memben dalam perairan, sehingga jumlah oksigen
tuksenyawakarbon,yaituglukosa(karbon didalamairberkurang.Halinimenyebab
6).Yanghasilsampingannyaadalahoksigen kan biota air yang membutuhkan oksigen
yang akan digunakan oleh organisme akanmati.
autrotrofdanheterotrofyangmenghasilkan Jawaban:C
karbon dioksida. Pada tumbuhan, karbon
didapatkanpadabatang, dan setelah mati, 20. Pembakaran bahan bakar fosil akan me
tumbuhan, hewan, dan manusia akan ningkatkan kadar CO2, sehingga udara
diurai menjadi karbon dioksida juga. Di tercemar. Apabila kadar CO2 di udara te
kerak bumi terdapat pembakaran fosil rusmeningkatdanmelebihibatastoleransi
(bukan penumpukan) yang menghasilkan dan tidak segera diubah oleh tumbuhan
karbondioksida. menjadi oksigen, maka dapat menye
Jawaban:E babkan terbentuknya rumah kaca yang
efeknya akan meningkatkan pemanasan
15. Saling ketergantungan antara produsen globalsuhubumi.
dan konsumen tampak pada peristiwa Jawaban:C
makandandimakan.Energidalambentuk
makanan akan berpindah dari organisme 21. Eutrofikasi adalah proses pengayaan
tingkat tinggi ke organisme lain yang nutrien dan bahan organik dalam jasad air.
tingkatannyalebihrendahmelaluirentetan Eutrofikasi dapat dikarenakan beberapa hal
organisme memakan organisme sebelum diantaranyakarenaulahmanusiayangtidak
nyadansebagaipenyediabahanmakanan ramah terhadap lingkungan. Hampir 90%
bagiorganisme. disebabkan oleh aktivitas manusia di
Jawaban:E bidang pertanian. Para petani biasanya

menggunakan pestisida atau insektisida busuk yang menyengat di sekitar sampah


untuk memberantas hama tanaman agar tersebut.
tanaman tidak rusak. Penumpukan bahan Jawaban:A
nutrieniniakanmenjadiancamankehidupan 24. Hutan yang dijadikan areal industri akan
ikandibadandanaupadasaatmusimpan mengakibatkan terganggunya keseim
caroba. Adanya peningkatan suhu udara, bangan makhluk hidup yang antara lain
pemanasan sinar matahari, dan tiupan ditunjukkan oleh hilangnya keanekara
anginkencangakanmenyebabkanterjadi gaman.
nya golakan air danau. Hal ini menye Jawaban:C
babkan arus naik dari dasar danau yang
mengangkat massa air yang mengendap. 25. Upaya penanggulangan yang tepat untuk
Massa air yang membawa senyawa bera mengatasi sampah plastik adalah mela
cun dari dasar danau hingga menga kukandaurulangsampahplastik(recycle).
kibatkan kandungan oksigen di badan air Daur ulang bisa dilakukan di industri daur
berkurang. ulang dengan cara dibuat aneka produk
Jawaban:A baru. Sampah plastik termasuk sampah
anorganik sehingga keberadaannya di
22. Polusidariasapkendaraandapatdikurangi alam tidak terurai oleh mikroba tanah
denganmenanampohonditiapruasjalan, ataupun jika terurai membutuhkan waktu
semakin banyak pohon akan semakin ba yang lama, sehingga keberadaan sampah
nyaksuplaioksigendijalanrayatersebut. plastik akan menurunkan daya dukung
Jawaban:C lingkungan. Membakar sampah plastik
justru akan berakibat pada pencemaran
23. Bahan organik yang semakin menumpuk udara seperti keberadaan gas CO, CO2,
akan diuraikan oleh bakteri anaerobik me dandioksin.
lalui proses pembusukan. Akibatnya bau Jawaban:A

BAB2

1. UN2010 3. UN2010
Berikut ini adalah jaringan yang terdapat Pehatikangambarjantungberikutini!
padatumbuhan....
1.epidermis 4.xilem
2.sklerenkim 5.palisade
3.kambium 6.bungakarang
Jaringan yang hanya terdapat pada daun
mampu melangsungkan fotosintesis ada
lah....
A.1dan2
B.2dan3
C.3dan4 Bagian jantung yang berfungsi menam
D.4dan5 pungdarahyangtelahberedardariseluruh
E.5dan6 tubuhadalah....
A. 1 D. 4
2. UN2010 B. 2 E. 5
Perhatikan gambar persendian A dan B C. 3
berikut!
4. Perhatikandiagramsistemperedarandarah
padamanusiaberikut!




A B

Pernyataan yang benar tentang nama
sendidanmacamgeraknyaadalah....
A B
A Sendiengsel,gerak Sedipelana, Baganyangdilaluiolehdarahpadasistem
kesemuaarah geraksatu persedarandarahbesaradalah....
poros A. B3A4D
B Sendipeluru,gerak Sendiengsel, B. B4A3D
bebaskesemua geraksatu C. C2B4A
arah poros D. B1C2D
C Sendiputar,gerak Sendipelana, E. B2C13
berputar gerakterbatas
D Sendiovoid,gerak Sendikaku, 5. UN2010
kekanandankekiri gerakterbatas Perhatikan gambar sistem pencernaan
saja makananmanusiaberikutini!
E Sendipelana,gerak Sendiovoid,
terbatas gerakterbatas




Organ pencernaan yang melakukan pen X merupakan bagian dari paruparu yang
cernaan mekanis dan kimiawi secara ber berfungsi sebagai organ ekskresi. Pada
samaanditunjukkanolehbagianyangber bagiantersebutterjadiproses....
nomor.... A. inspirasidanekspirasidalam
A. 1dan2 D. 3dan4 B. pengeluarangasCO2danuapair
B. 1dan3 E. 4dan5 C. pengeluaran panas dan sisa meta
C. 2dan5 bolisme
D. pembentukanionbikarbonatdarah
6. UN2010 E. pembentukan senyawa karbominohe
Perhatikan gambar proses pernapasan beri moglobin
kut:
8. UN2010
Perhatikangambarotakberikut!




A. Inspirasi B.Ekspirasi

Pernyataan yang tepat berhubungan de
ngangambarsistempernapasantersebut
adalah.... Pusat pengendalian keseimbangan dan
A. gambarAototantartulangrusuk koordinasi gerak tubuh merupakan fungsi
kontraksi,tulangrusukterangkat, daribagian.
danudaramasuk A. 1 D.4
B. gambarAototantartulangrusuk B. 2 E.5
relaksasi,tulangrusukterangkat, C. 3
danudaramasuk
C. gambarBototantartulangrusuk 9. UN2010
kontraksi,tulangrusukturun,dan Perhatikangambarsistemindraperaba!
udarakeluar
D. gambarBototantartulangrusuk
relaksasi,tulangrusukturun,dan
udaramasuk
E. gambarBototantartulangrusukkon
traksi,tulangrusukturun,danudara
masuk

7. UN2010 Jikalenganseorangtergoresbendatajam,
Perhatikangambatberikutini! maka akan terasa sakit. Rasa sakit diteri
maoleholehreseptor....
A. 1 D.4
B. 2 E.5
C. 3




10

10. UN2010 Hubungan yang tepat untuk organ, enzim


Perhatikan gambar reproduksi pada wa dan peran enzim pada proses pencernaan
nitaberikut! dalamtabeltersebutadalah....
A. 1dan2 D.3dan4
B. 2dan3 E.3dan5
C. 2dan4

13. UN2008
Pernyataanyangtidaktepatmengenai Tabel berikut merupakan hasil uji makan
proses yang terjadi pada bagian X adalah an:
. No. Biuret Lugol Benedict
A. pembentukanzigot P Tidak BiruTua Merah
B. terjadinyaperistiwameiosis1 Berubah Bata
C. LHmeningkatmendorongovulasi Q Ungu Cokelat BiruTua
D. FSH memengaruhi pembentukan oosit R Ungu BiruTua Merah
sekunder Bata
E. pembentukan oosit sekunder dan satu
badanpolar Berdasarkan tabel tersebut dapat disim
pulkan bahwa makanan yang mempunyai
11. UN2011 nilaigizipalingtinggiadalah....
Perhatikan organorgan pencernaan beri A. P D.PdanQ
kut! B. Q E.PdanR
C. R

14. UN2011
Perhatikan skema pembentukan urine di
bawahini!
Kelenjar yang menghasilkan getah yang
mengandung NaHCO3 serta enzim lipase,
amilase,dantripsinogenadalah.
A. 1 D.4
B. 2 E.5
C. 3 urine

Proses yang terjadi pada nomor 2 dan
12. UN2009
filtratXsecaraberurutanadalah.
Perhatikantabelberikut!
A. reabsorbsidanurineprimer
No Organ Enzim PeranEnzim
1 Mulut Ptialin penguraian B. reabsorbsidanurinesekunder
amilum C. filtrasidanurineprimer
2 Lambung Renin menggumpalkan D. filtrasidanurinesekunder
kaseinsusu E. augmentasidanurinesesungguhnya
3 Usus Tripsino penguraian
Halus gen proteinmenjadi
pepton

4 Pankreas Erepsino maltosamenjadi
gen glukosa
5 Hati Steapsin penguraian
amilummenjadi
glukosa

11

15. UN2012 A. 1dan2 D.3dan4


Perhatikangambarnefronberikut! B. 2dan1 E.4dan1
C. 2dan4

18. UN2011
Hubunganantartulangyangterdapatpada
pangkallenganadalah....
A. sendiputar D.sendipelana
Y B. sendipeluru E.sendiengsel
C. sendigeser

Proses yang terjadi pada bagian Y dan
jenisurineyangdihasilkanadalah....
A. filtrasidanurineprimer 19. UN2011
B. filtrasidanurinesekunder Selspermatozoadihasilkanolehtestisdan
C. reabsorbsidanurineprimer selanjutnyaakanditampungdidalamkan
D. reabsorbsidanurinesekunder tung penyimpan sebelum dikeluarkan. Kan
E. augmentasidanurinesesungguhnya tung pemasakan spermatozoa ini disebut
....
16. UN2008 A. vesicaurinearia D. epididimis
Perhatikangambarberikutini! B. vesiculaseminalis E. uretra
C. vasdeferens

20. UN2011
Tabel berikut menunjukkan hubungan an
tara hormon dan fungsi hormon tersebut.
Manakahhubunganyangtepat?
Hormonyang
Fungsi
dihasilkan

mengatur
Apabilabagianorganpadagambardiatas keseimbangankadar
mengalamikelainanataukerusakan,maka A. Insulin
kalsiumdanfosfat
kita akan kesulitan dalam mengekskre dalamdarah
sikan.... meningkatkan
A. feses D.garam B. Adrenalin tekanandarahdan
B. urine E.CO2 denyutjantung
mengaturkadar
C. uapair C. Tiroksin
glukosadalamdarah
mengatur
17. UN2011 metabolismedan
D. Somatotropin
Perhatikan gambar alat reproduksi pria di pertumbuhanfisik
bawah! maupunmental
pembentukankorpus
E. Estrogen
luteumpadawanita


21. UN2011
Relaksasiototantartulangrusukpadaper
Tempat pembentukan sperma dan bagian napasan manusia menyebabkan tulang
yang diikat apabila mengkiuti program tulangrusuk....
vasektomisecaraberurutanadalahnomor

12

A. mengendur, rongga dada mengecil, 25. UN2009


danterjadiinsiprasi Hormon yang dihasilkan oleh kelenjar
B. mengendur, rongga dada mengecil, pituitari dan berperan dalam siklus
danterjadiekspirasi menstruasipadawanitaadalah....
C. terangkat,ronggadadamembesar,dan A. FSHdanLH
terjadiinspirasi B. ACTHdanLH
D. terangkat,ronggadadamembesar,dan C. FSHdanACTH
terjadiekspirasi D. relaksindanoksitosin
E. mengendur, rongga dada membesar, E. estrogendanprogesteron
danterjadiinspirasi
26. UN2009
22. UN2008 Insulin dihasilkan oleh kelenjar pankreas
Prosesmendengardimulaidenganadanya dan berperan dalam metabolisme tubuh,
gelombang bunyi yang masuk melalui yaitu....
lubang telinga dan menggetarkan mem
bran timpani. Selanjutnya getaran akan A. mengaturkadarguladalamtubuh
diteruskankenervusauditoriusmelalui.... B. membantudayaabsorpsilemak
A. incusmaleuskokleastapes C. mengaturtekanandarahdalamarteri
B. maleusincusstapeskoklea D. menetralisirzatzatyangberbahaya/
C. stapesmaleusincuskoklea racun
D. kokleaincusmaleusstapes E. mengaturkeseimbanganairdangaram
E. maleusstapesincuskoklea dalamdarah

23. UN2009 27. UN2015
Perhatikan gambar sistem pernapasan Seorang siswa melakukan pengamatan
manusiaberikut! pertumbuhan suatu tanaman hias. Media
tanamantersebutadayangdiberipupukA,
B,danC.Selama21haridilakukanpengu
kuran tinggi tanaman, jumlah bunga dan
kecerahanwarnabunga.
Hasil pengamatan ditampilkan pada tabel
berikut:
Media Tinggi Jumlah Warna
tanaman tanaman bunga bunga
diberi (cm)
Ketikabernapasudaradihirupdarirongga
pupuk
hidung masuk ke bagian trakea melewati A 75 10 cerah
nomor2yangdisebut.... B 90 25 sangat
A. laring D. bronkus cerah
B. faring E. epiglotis C 50 5 kurang
C. eustachius cerah
Yang menjadi variabel bebas dari pene
24. UN2011 litiantersebutadalah.
Gangguan pada pembuluh nadi yang me A. macammacampupuk
ngeras yang diakibatkan endapan lemak B. kelembapanmediatanam
disebut.... C. kecerahanwarnabunga
A. trombus D. aterosklerosis D. tinggitanaman
B. embolus E. arteriosklerosis E. jumlahbunga
C. hemoroid

13

28. SiswakelasXIISMAmelakukanpenelitian A. suhudanmediatumbuh


berkaitandenganpupukureadenganhasil B. suhudancahaya
pengamatansebagaiberikut: C. cahayadanmediatumbuh
RataratatinggiBayam(cm) D. kelembapandanmediatumbuh
Hari
10 20 30 40 E. unsurharadansuhu
ke
ppm ppm ppm ppm
2 5 5 5 5 30. Dalam percobaan pertumbuhan, Ani me
4 6,2 6,1 7,0 8,2 milih rumusan masalah: Apakah kelem
6 7,3 7,5 9,3 12,5 bapan berpengaruh terhadap pertum
8 8,5 9,2 13,1 16,4 buhan kacang hijau? Tanaman I ditanam
10 14,2 15,1 18,7 22,6 dalam kardus yang atasnya ditutup kain
12 16,7 20,2 25,0 29,8 kasa dengan lubang kasa 2 cm, ditem
Kesimpulan yang tepat untuk hasil pe patkan di teras, dan tiap pagi tanaman I
nelitiandiatasadalah.... disemprot1botolair.TanamanIIditanam
didalamkardusyangatasnyaditutupkain
A. tinggi tanaman bayam dikendalikan kasa dengan lubang kasa 2 cm, ditem
olehpupukurea patkan di teras yang sama, dan tiap pagi
B. pada hari ke12 tinggi tanaman bayam tanaman II disemprot 3 botol air. Berda
palingoptimal sarkan perlakuan di atas, alasan penyem
C. pupuk urea sangat baik untuk pertum protan air dengan jumlah yang berbeda
buhantanaman bertujuanuntuk....
D. peningkatan konsentrasi pupuk berpe A. memberiintensitassinaryangberbeda
ngaruhterhadappertumbuhanbayam B. memberikelembapanyangberbeda
E. semakin lama waktu tanam terdapat C. mengaturpenyerapanairolehtanaman
variasitinggitanamanbayam D. menjagakandunganairdalamtanah
E. menjaga kelembapan karena penutu
29. Perhatikan tabel percobaan pertumbuhan pankasa
kecambahberikut!
Rata
rata
Perla pertam
Media Cahaya Suhu
kuan bahan
tinggi
perhari 1. Jaringan yang hanya terdapat pada daun
I Tanah Tak 32oC 1cm mampu melangsungkan fotosintesis adalah
lang jaringan palisade dan jaringan bunga ka
sung rang.
II Kapas Lang 32oC 1,5cm
Jawaban:E
sung
III Tanah Gelap 32oC 3cm

IV Kapas Tak 32oC 1,6cm 2. A merupakan sendi peluru, yaitu sendi
lang dengan gerakan ke segala arah di gelang
sung bahu dan B adalah sendi engsel berporos
V Tanah Lang 32oC 0,5cm satudisikudanlutut.Sementaraitusendi
sung yanglainadalah:
Daridatatersebutdapatdisimpulkanbah Sendiovoid(gelung):gerakankekanan
wa faktor luar yang memengaruhi ke dankekiriberadadipergelangantangan.
cepatanpertumbuhantanamanadalah. Sendi pelana: gerakan 2 arah berada
antararuasjari.

14

Sendikaku:gerakanterbatasberadadi sampai makanan menjadikimus/bubur dan


antara tulang dada dengan tulang enzimatis menggunakan enzim renin/kasein
rusuk. untuk mengemulsi susu dan pepsin untuk
Sendi putar: gerakan rotasi berada memecah protein menjadi pepton. Se
antara tulang leher atlas dengan tulang dangkanbagianlain,yaitu:
tengkorak. Nomor 3 usus besar berfungsi untuk
Jawaban:B pembusukan makanan dan menghasil
kan vitamin K oleh bakteri Eschericia
3. Bagian jantung yang berfungsi menam colisertauntukpenyerapanair.
pungdarahyangtelahberedardariseluruh Nomor4adalahusushalusbagianusus
tubuh adalah serambi kanan (atrium dek serap yang mengandung jonjot usus
ster),yaitupadanomor5.Bagianyanglain (villi) untuk penyerapan sarisari ma
adalah: kanan.
vena pulmonalis (pembuluh darah Nomor 5 adalah hepar (hati) berfungsi
yangmasukkeserambikiridariparu untukmengeluarkanempeduyangber
paru), fungsisebagaipengemulsilemak.
aorta pembuluh darah arteri terbesar Jawaban:A
yangkeluardaribilikkiriuntukmega
lirkandarahkeluarkeseluruhtubuh, 6. Pernyataan yang tepat berhubungan
bilik kiri memompa darah ke seluruh dengan gambar sistem pernapasan ter
tubuh,dan sebut adalah gambar A adalah inspirasi
bilikkananmemompadarahkeparu saat udara masuk, yaitu otot antartulang
paru. rusuk kontraksi, tulang rusuk terangkat,
Jawaban:E dan udara masuk. Sedangkan gambar B
adalah ekspirasi saat udara keluar, yaitu
4. Baganyangdilaluiolehdarahpadasistem otot antartulang rusuk relaksasi, tulang
peredaran darah besar/sistemik adalah rusukturun,danudarakeluar.
jantung seluruh tubuh jantung. Dari B Caramenghafal
(bilikkiri)menujukeaorta(4)dipompake Pernapasandada:
seluruh tubuh, yaitubagian (A), kemudian Inspirasi :Kontraksiantartulangrusuk
dari seluruh tubuh ke nomor 3 (vena cava Ekspirasi :Relaksasiantartulangrusuk
inferior)danmasukkeserambikanan(D). Pernapasanperut:
Sedangkan peredaran darah kecil, yaitu Inspirasi :Kontraksidiafragma
darijantung(bilikkanan)dipompakeparu Ekspirasi :Relaksasidiafragma
paru kemudian kembali lagi ke jantung Jawaban:A
(serambikiri).
Jawaban:B 7. X merupakan alveolus atau gelembung
paruparu yang merupakan gelembung
5. Organ pencernaan yang melakukan pen tersusun oleh selapis yang diselimuti
cernaan mekanis dan kimiawi secara ber kapilerdarah dan berfungsi sebagai organ
samaanditunjukkanolehbagianyangber pertukaran gas antara oksigen dengan
nomor 1 dan 2, yaitu mulut dan lambung. karbondioksida.Alvelolusberperandalam
Di mulut terjadi pencernaan mekanik pengeluaran gas CO2 dan uap air. Semen
menggunakangigidanlidahsertaenzimatis taraitubagianyanglainadalah:
menggunakanenzimptialinuntukmemecah Berfungsi sebagai pengeluaran panas
amilum menjadi maltosa. Sedangkan di sisa dan metabolisme adalah kulit se
lambung terjadi pencernaan mekanik bagaipenghasilkeringat.
denganadanyapengadukangerakperistaltik
15

Pembentukan ion bikarbonat darah 10. Pada bagian X adalah ovarium tempat
adalah ikatan antara CO2 dan H2O pembentukan ovum dan hormon proges
membentuk H2CO3 dan lepas menjadi terondanestrogen.Bagianinimerupakan
H++HCO3(ionbikarbonat). tempat terjadinya peristiwa meiosis 1, LH
Pembentukan senyawa karbomino meningkat mendorong ovulasi, FSH me
hemoglobin adalah ikatan antara mengaruhi pembentukan oosit sekunder,
hemoglobindegankarbondioksida(Hb pembentukan oosit sekunder, dan satu
+CO2HBCO2). badan polar. Jadi, ovarium bukan me
Inspirasi dan ekspirasi dalam terjadi di rupakan tempat pembentukan zigot ka
dalamsel(intrasel). renazigotterbentukdioviduk/tubafalopi.
Jawaban:B Sedangkan pembentukan zigot, yaitu
terjadi di saluran oviduk atau tuba falopi
8. Pusat pengendalian keseimbangan dan karena di saluran ini terjadi proses fer
koordinasi gerak tubuh merupakan fungsi tilisasi/pembuahan ovum oleh sperma
dari bagian otak kecil/serebelum pada tozoa.
nomor4,sedangkanbagianlain,yaitu: Jawaban:A

nomor 1 otak besar/cerebrum untuk
11. Kelenjar pankreas menghasilkan getah
pusat kegiatan sadar (melihat, men yang mengandung NAHCO3 serta enzim
dengar, mencium, bicara, kecer lipase,amilase,dantripsinogen.
dasan,dansikap), Jawaban:B
nomor 2 adalah otak tengah/mesen
cephalonmerupakanrelaiantarapen 12. Ptialin mengubah amilum menjadi disa
dengarandenganpenglihatan, karida, renin mengendapkan kasein, trip
nomor 3 hipothalamus berfungsi un sinogen mengubah pepton menjadi
tuk pusat lapar dan pusat pengatur dipeptida, erepsin mengubah dipeptida
suhu,dan menjadiasamamino,dansteapsinmengu
nomor 5 adalah sumsum tulang bela bah lemak menjadi asam lemak dan
kang/medulaspinalismerupakanpusat gliserol.
refleksanggotagerak. Jawaban:A
Jawaban:D
13. Berdasarkanhasilujimakanandalamtabel
9. Jika lengan seorang tergores benda tajam terlihat bahwa pada kolom R bahan
maka akan terasa sakit, yaitu rasa nyeri makanan setelah diberi biuret berubah
yangditerimaolehujungsarafbebasyaitu menjadiunguyangberartibahanmakanan
nomor 3. Bagian saraf kulit yang lain mengandung protein, jika lugol diberi
adalah: biuret menjadi biru tua berarti mengan
nomor1perabapanas(sarafRuffini), dung karbohidrat dan jika benedict diberi
nomor 2 peraba sentuhan (saraf biuret menjadi merah bata berarti me
Meissner), ngandungglukosa.Dengandemikian,ma
nomor 3 peraba sakit (ujung saraf kanan yang mempunyai nilai gizi paling
bebas), tinggiadalahR.
nomor 4 peraba dingin (saraf Krause), Jawaban:C
dan
nomor5perabatekanankuat(saraf 14. Ginjal berperan dalam proses pemben
Paccini). tukan urine yang terjadi melalui serang
Jawaban:C kaian proses, yaitu penyaringan, penye
rapankembali,danaugmentasi.

16

a. Penyaringan(filtrasi)(nomor1)
Hasil penyaringan di glomerulus dise
butfiltratglomerolusatauurineprimer, Ku Pa HatGinjal (KulitParuparuHati
mengandung asam amino, glukosa, Ginjal): kulit menghasilkan keringat, paru
natrium, kalium, dan garamgaram parumenghasilkangasCO2danH2Odalam
lainnya(filtratX). bentuk uap air, hati untuk ekskresi urea,
b. Penyerapan kembali (reabsorbsi) (no danginjaluntukproduksiurine.
mor2) Jawaban:D
Penyerapan air terjadi pada tubulus
proksimaldantubulusdistal.Substansi 17. Bagianreproduksilakilaki:
yang masih diperlukan seperti glukosa a. Vasdeferens
dan asam amino dikembalikan ke da Vas deferensberfungsi sebagai saluran
rah. Zat amonia, obatobatan seperti tempatjalannyaspermadariepididimis
penisilin, kelebihan garam, dan bahan menuju kantung semen atau kantung
lain pada filtrat dikeluarkan bersama mani (vesikula seminalis). Program va
urine. Setelah terjadi reabsorbsi, maka sektomi, yaitu memutus sperma tidak
tubulus akan menghasilkan urine se bisamenujusaluranpengeluaran.
kunder dan zatzat yang masih diper b. Testis
lukantidakakanditemukanlagi.Seba Fungsi testis secara umum merupakan
liknya, konsentrasi zatzat sisa meta alat untuk memproduksi sperma dan
bolisme yang bersifat racun bertam hormon kelamin jantan yang disebut
bah,misalnyaurea(filtratY). testosteron.
c. Augmentasi(nomor3) c. Tubulusseminiferus
Urineakankeluarmelaluiuretra.Kom Pematanganselterjadiditubulussemini
posisi urine yang dikeluarkan melalui ferusyangkemudiandisimpandiepidi
uretraadalahair,garam,urea,dansisa dimis.
substansilain, misalnya pigmen empedu d. Vesikulaseminalis
yangberfungsimemberiwarnadanbau Vesikulaseminalisataukantungsemen
padaurine. (kantung mani) merupakan kelenjar
Jawaban:A berlekuklekukyangterletakdibelakang
kantung kemih. Dinding vesikula semi
15. Yadalahtubuluskontortusproksimalyang nalis menghasilkan zat makanan yang
akan mereabsorsi hasil filtrasi dari glo merupakan sumber makanan bagi
merulus. Hasil reabsorbsi adalah urine se sperma.
kunder. Jawaban:B
Jawaban:D
18. Hubunganantartulangyangterdapatpada
16. Apabila organ kulit mengalami kelainan pangkal lengan adalah sendi peluru, yaitu
atau kerusakan, maka kita akan kesulitan di gelang bahu yang memungkinkan ge
dalam mengekskresikan kelenjar keringat rakan ke segala arah dan berporos tiga
yangberisigarammineral.Organekskresi arah.Sedangkansendiyanglainadalah:
yanglainsebagaiberikut: o Sendi putar: gerakan rotasi terdapat di
hubungan tulang leher teratas (atlas)
dengantulangtengkorak,
o Sendi pelana: gerakan dua arah ter
dapat di hubungan tulang telapak ta
ngan dan tulang pergelangan tangan
padaibujari,

17

o Sendi engsel: berporos satu arah se dan rongga dada membesar dan terjadi
perti pada siku, lutut, maka kaki, dan inspirasi.
ruasantarjari,dan Jawaban:B
o Sendi geser disebut juga sendi luncur
memungkinkan gerakan menggeser dan 22. Urutan proses pendengaran adalah se
tidak berporos, misalnya di antara tu bagai berikut: daun telinga saluran te
langpergelangantangan. linga luar gendang telinga (membran
Jawaban:B timpani) tulang pendengaran (martil/ma
leus, landasan/incus, sanggurdi/stapes)
19. Kantung pemasakan spermatozoa disebut tingkap oval saluran limpa, dan berakhir
epididimis.Sedangkanbagianlain,yaitu: ke koklea/rumah siput yang penuh organ
vesica urinearia merupakan kantung pe kortiterdapatsarafauditori.
nyimpanurinesementara, Jawaban:B
vesicula seminalis merupakan kantung
semen yang berfungsi untuk memberi 23. Ketikabernapasudaradihirupdarirongga
nutrisibagispermatozoa, hidung masuk ke bagian trakea melewati
vas deferens merupakan saluran sperma nomor 2 yang disebut faring/tekak, yaitu
untuk menyimpan sementara sperma, saluranpenghubungantararonggahidung
dan denganronggamulut.
uretra merupakan saluran pengeluaran Jawaban:B
urinedansperma.
Jawaban:D 24. Gangguan pada pembuluh nadi yang
mengeras yang diakibatkan endapan le
20. Hubungan antara hormon dan fungsi mak disebut aterosklerosis, sedangkan
hormon yang tepat adalah adrenalin gangguan pada pembuluh nadi yang
berfungsi meningkatkan tekanan darah mengerasyangdiakibatkan endapan kapur
dan denyut jantung, sehingga dapat me disebutarteriosklerosis.Trombusmerupa
ngubahglikogenmenjadiglukosa.Semen kangumpalantidakbergerakdidarahbisa
taraituuntukhormonyanglainadalah: di pembuluh arteri koronaria menyebab
o Insulin untuk mengatur kadar glukosa kan jantung koroner. Embolus merupakan
dalamdarah. gumpalanbergerakdipembuluhdarah.
o Tiroksin untuk mengatur metabolisme Jawaban:D
danpertumbuhanfisikmaupunmental.
o Somatotropin untuk proses pertum 25. Hormon yang dihasilkan oleh kelenjar
buhan. pituitari dan berperan dalam siklus
o Estrogen untuk menjaga penebalan menstruasi pada wanita adalah FSH dan
endometrium serta berperan dalam LH. FSH berfungsi untuk pematangan
penentuan ciri seks sekunder perem folikel serta untuk merangsang keluarnya
puan. estrogen. Sedangkan LH untuk ovulasi
Jawaban:B ataupelepasanovum.
Jawaban:A
21. Relaksasi otot antartulang rusuk pada
pernapasan manusia menyebabkan tulang 26. Insulin dihasilkan oleh kelenjar pankreas
tulangrusukmengendur,ronggadadame bagian pulau Langerhans sel beta dan
ngecil, dan terjadi ekspirasi. Sedangkan berperan dalam metabolisme tubuh, yaitu
saat inspirasi (udara masuk), maka terjadi mengaturkadarguladalamtubuhdengan
kontraksiototantartulangrusuk,atauotot mengubahglikogenmenjadiglukosa.
antartulang rusuk mengerut terangkat, Jawaban:A

18

27. Variabelbebasmerupakanperlakuanyang 29. Faktor luar yang memengaruhi kecepatan


dibuattidaksamaatauberbeda.Padape pertumbuhan tanaman adalah media dan
ngamatan tersebut perlakuan yang ber ada tidaknya cahaya. Suhu tidak berpenga
bedaadalahmacammacampupuk. ruh, karena suhu dibuat seragam semua,
Jawaban:A yaitu32oC.
Jawaban:C
28. Pada tabel terlihat ratarata tinggi bayam
mengalamipeningkatanseringdenganpe 30. Penyemprotan air dengan jumlah yang
ningkatan konsentrasi pupuk urea yang berbeda bertujuan untuk memberi kelem
diberikanpadamasingmasingperlakuan. bapan yang berbeda pada masingmasing
Jawaban:D perlakuan.
Jawaban:B


19

BAB3

1. UN2011 4. UN2008
Organelselmempunyaiciriciri:berbentuk Perhatikangambar!
oval, mempunyai dua lapisan membran,
membran dalam berlaku untuk memper
luas bidang permukaan untuk menyerap
oksigen.Namadanfungsiorganeltersebut
adalah....
A. kloroplassebagaitempatreaksiterang
B. retikulumendoplasmasebagaipenghu
bungintidansitoplasma Proses perubahan yang terjadi pada
C. mitokondria sebagai alat pengeluaran gambarXmenjadigambarYdisebabkan....
sisametabolisme A. osmosiskarenaairdarilarutanAmasuk
D. kloroplassebagaitempatpembentukan ke dalam bagian B, karena B bersifat
ATP hipertonikterhadapA
E. mitokondria sebagai tempat pemben B. osmosiskarenaairdarilarutanAmasuk
tukanenergi ke dalam bagian B, karena B bersifat
hipotonikterhadapA
2. UN2010 C. osmosiskarenaairdarilarutanAmasuk
Organel sel berupa saluran halus yang ke dalam bagian B, karena B bersifat
berbatasan dengan sistem membran erat isotonikterhadapA
kaitannyadengansistemtransportasipada D. osmosiskarenaairdarilarutanAmasuk
sistemsintesisproteinadalah.... ke dalam bagian B, karena B bersifat
A.ribosom plasmolisisterhadapA
B.mitokondria E. osmosis karena larutan B masuk ke
C.retikulumendoplasma dalam bagian A, karena A bersifat
D.plasmodesma homogenterhadapA
E.sentrosoma
5. UN2011danUN2010
3. UN2015 Bacalahpernyataanberikutdengansaksa
Perhatikanstrukturkimiamembransel ma!
berikut! 1. Dapat menduplikasikan diri pada saat
membelah.
2. Mengandunginformasigenetik.
3. Kadarnya berubahubah berdasarkan
sintesisprotein.
4. Membentukrantaitunggalyangpanjang.
Senyawa penyusun membran sel yang Pernyataan yang merupakan ciriciri DNA
ditunjuk oleh gambar 1, 2, dan 3 adalah adalah....
secaraberurutanadalah.... A. 1dan2 D. 2dan4
A. fosfolipid,protein,dankolesterol B. 1dan3 E. 3dan4
B. fosfolipid,protein,danfosfolipid C. 2dan3
C. kolesterol,protein,dangliserol
D. glikoprotein,proteinintegral,danasam
lemak
E. glikolipid,protein,danglikoprotein


20

6. UN2011 Pernyataanyangtepatberdasarkan
Tahapansintesisprotein: gambartersebutadalah....
(1) PenempelanRNApolimerasepadamo A. kerjaenzimmenentukanarahsuatu
lekulDNA. reaksi
(2)Pergerakan RNA polimerase, sehingga B. enzimhanyamampubekerjapada
dihasilkanrantaiRNA. substrattertentu
(3)PemisahanrantaiRNAdaritemplate. C. enzimmampumempercepatreaksi
(4)Penambahan senyawa kimia sehingga D. enzimtidakmemengaruhikeseim
dihasilkanmRNAlengkap. bangankonsentrasizat
Tahapanselanjutnyadarisintesisprotein E. enzimtidakdapatdipengaruhioleh
tersebut(tahapke5)adalah.... reaksikimia
A. pembuatan rangkaian asam amino
yangdibawaolehtRNA 9. UN2010
B. mRNA selesai dicetak meninggalkan Salah satu teori yang menjelaskan kerja
nukleusmenujusitoplasma enzim adalah teori kuncigembok (lock
C. pengenalan kodon AUG oleh subunit and key hypothesis). Cara kerja enzim
ribosomkecil menurut teori ini adalah enzim bekerja
D. pemasangansubunitribosom karenaadanya....
E. pengenalankodonUAGolehribosom A.kesesuaiansuhudanpH
B.kesesuaianbentuksubstrat
7. UN2011 C.induksisubstrat
Di bawah ini tahaptahap pada sintesis D.apoenzimpadasubstrat
protein: E.inhibitorpadasubstrat
(1) Asam amino berderetderet sesuai de
ngankodepembentukanprotein. 10. UN2011
(2) dRNA meninggalkan inti menuju ribo Transpor elektron yang berlangsung di
som. dalam mitokondria, prosesnya akan ber
(3) tRNA mengangkut asam amino sesuai akhir setelah elektron H+ bereaksi dengan
dengan kode genetika/kodon yang di oksigen yang berfungsi sebagai akseptor
bawadRNA. terakhirdanakanmembentuk...
(4) Proteinyangterbentukmerupakanen A.CO2 D.FADH
zimyangmengaturmetabolismesel. B.H2O E.NADH
Urutantahapansintesisproteinadalah... C.asampiruvat
A. (1)(2)(3)(4)(5)
B. (2)(3)(1)(4)(5) 11. UN2011
C. (3)(2)(1)(5)(4) Perhatikanpersamaanreaksifotosintesis
D. (4)(2)(1)(3)(5) berikutini!
E. (4)(2)(3)(1)(5) 6CO2+6H2OCahayaC6H12O6+X
Klorofil

8. UN2011 Xyangdihasilkanpadareaksifotosintesis
Perhatikangambarkerjaenzimberikut! tersebutterbentukpadatahap....
A.fotolisisdarihasilpenguraianH2O
B.fotolisisdarihasilpenguraianCO2
C.fiksasiCO2padasaatgelap
D.berlangsungfiksasiCO2
E.reaksiterangdarihasilgliseradehid3p

enzimsubstrat kompleksenzimsubstrat

21

12. UN2011 16. UN2010


Dalam proses pembuatan tape ketan Berikut ini adalah proses katabolisme
terjadi proses fermentasi. Urutan proses karbohidrat:
fermentasitersebutadalah.... 1. Menggunakan CO2 sebagai akseptor
A.tepunggulaalkohol elektron.
B.gulaalkoholtepung 2. Tidakmenggunakanoksigen.
C.tepungalkoholgula 3. Pembentukanatppadajalurglikolisis.
D.alkoholgulatepung 4. Pembentukan ATP pada sistem trans
E.gulatepungalkohol porelektron.
Yang merupakan proses respirasi anaerob
13. UN2011 adalah....
Perhatikan diagram proses metabolisme A. 1dan3 D.2dan4
berikut: B. 1dan4 E.1dan2
C. 2dan3

17. UN2011

Perhatikangambarpembelahanselyang

memilikiempatkromosomberikut!


Asam piruvat dari proses respirasi aerob

akan megalami perubahan, secara bertu

rutturutyangditunjuknomor1dan2ada

lah....

A. O2danglukosa
Berdasarkansusunankromatiddanjumlah
B. O2danasetilkoA
calon sel anak, gambar tersebut menun
C. CO2danglukosa
jukkanfase....
D. CO2danasetilKoA
A. profaseImeiosis
E. CO2danasamlaktat
B. metafaseIImeiosis

C. anafasemitosis
14. UN2011
D. telofaseIImeiosis
Oksidasi glukosa dalam sel tumbuhan
E. telofasemitosis
menghasilkan 38 ATP, terjadi melalui tiga

tahap yaitu glikolisis, siklus Krebs, dan
18. UN2011
transferelektron.JumlahATPyangdihasil
Berikut ini adalah halhal yang berkaitan
kanpadaprosesglikolisisadalah....
denganreproduksisel:
A. 2 D.8
(1) Sifat sel anak tidak identik dengan sel
B. 4 E.1
induk.
C. 6
(2) Terjadipadaselsomatik.

(3) Sifatselanaksamadenganselinduk.
15. UN2010
(4) Terjadipadagonad.
Reaksi yang terjadi pada respirasi aerob
(5) Pembelahanberlangsungduakali.
adalah....
Ciripembelahanmitosisadalah....
A. glukosapiruvatlaktat A. (1)dan(2) D.(3)dan(4)
B. glukosapiruvatasetildehidetanol B. (1)dan(4) E. (4)dan(5)
C. 2piruvatasetilkoA2CO2 C. (2)dan(3)
D. etanolasamcukaH2O D. (3)dan(4)
E. asamcukaetanolH2O E. (4)dan(5)

22

19. UN2010 22. UN2010


Perhatikangambarmitosisberikut! Kasuskasus berikut yang dapat diatasi
melalui penerapan prinsip bioteknologi
konvensionaladalah....
F. produksi tanaman tahan hama dan
penyakit
G. produksiyoghurtmenggunakan
Gambar tersebut menunjukkan sel yang Lactobacillusbulgaricus
sedangmembelahpadafase.... H. produksikentangberkarbohidrattinggi
A. interfase D. profase I. produksi hormon insulin bagi penderita
B. anafase E. metafase diabetesmelitus
C. telofase J. pengobatan penyakit hemofilia dan
20. UN2011 thalasemia
Bioteknologi tidak selalu aman bagi ling
kungan. Tanaman hasil rekayasa genetik 23. UN2010
(transgenik), juga dikhawatirkan menim Suatu perkebunan membutuhkan tana
bulkan ancaman terhadap lingkungan manyangmemilikikemampuanataudaya
karena.... tahanterhadaphamadanpenyakit.Teknik
A. membutuhkan banyak pestisida untuk bioteknologi yang dapat dilakukan untuk
membunuhhama memenuhikebutuhantersebutadalah....
B. tanah menjadi tandus akibat pemakai A.kloningtransferinti
anpupukkimia B.transgenik
C. bakteri dan jamur pembusuk mening C.kulturjaringan
katjumlahnya D.kloningembrio
D. terjadipencemarangenmenyerbukita E.hibridoma
namansejenis
E. timbulnya wabah penyakit baru yang
sulitdiobati

21. UN2011 1. Organelselmempunyaiciriciri:berbentuk
Berikut ini adalah contoh mikroorganisme oval, mempunyai dua lapisan membran,
dan manfaatnya dalam bidang biotek membran dalam berlaku untuk memper
nologi: luas bidang permukaan untuk menyerap
Namabakteri Manfaat oksigenadalahmitokondriayangberfung
1. Acetobacter a. pembuatan si untuk respirasi aerob/oksidasi glukosa
xylinum asamcuka menghasilkanenergi.
2. Lactobacillus b. menghasilkan Jawaban:E
bulgaricus antibiotik
3. Aspergillusoryzae c. pembuatan 2. Organel sel berupa saluran halus yang
4. Azotobacter natadecoco berbatasan dengan sistem membran erat
chlorococum d. pembuatan kaitannyadengansistemtransportasipada
5. Rhizopus tempe sistem sintesis protein adalah retikulum
oligosporus e. pembuatan endoplasma. Sementara itu organel yang
kecap lainberfungsi:
Hubungan yang benar antara mikro ribosom:tempatsintesisprotein
organismedenganperanannyaadalah.... mitokondria: tempat respirasi aerob/
A. 1danc D. 4danb oksidasimakananpenghasilATP
B. 2dana E. 5dane
C. 3dand
23

plasmodesma: celah/pit/noktah di din translasi,yaitupembuatanrangkaianasam


ding sel tumbuhan yang merupakan aminoyangdibawaolehtRNA.
penjuluran sitoplasma berfungsi untuk Jawaban:B
komunikasiantarsel
sentrosoma: untuk pembentukan be 7. Urutantahapansintesisproteinadalah:
nangspindel/gelendongpembelahan (1) dRNA meninggalkan inti menuju ri
Jawaban:C bosom.
(2) tRNAmengangkutasamaminosesuai
3. Strukturkimiamembransel dengan kode genetika/kodon yang di
bawadRNA.
(3) Asam amino berderetderet sesuai de
ngankodepembentukanprotein.

(4) Proteinyangterbentukmerupakanen
Jawaban:E zimyangmengaturmetabolismesel.
Jawaban:B
4. Proses perubahan yang terjadi pada gam
8. Pernyataan yang tepat berdasarkan gam
barXmenjadigambarYdisebabkanosmo
bar tersebut adalah enzim hanya mampu
sis, karena air dari larutan A masuk ke bekerja pada substrat tertentu. Satu en
dalambagianBkarenalarutandiBbersifat
zim,satusubstratbekerjasepertilockand
hipertonik terhadap larutan A. Osmosis
key, yaitu gembok dan kunci. Enzim me
merupakan perpindahan air dari konsen
nyesuaikanbentuksubstrat.
trasirendah(hipotonis)menujukelarutan
Jawaban:B
konsentrasi tinggi (hipertonis). Akibat air
dari A masuk ke B akhirnya larutan B 9. Cara kerja enzim menurut teori kunci
menjadimenggelembung. gembok ini adalah enzim bekerja karena
Jawaban:A adanya kesesuaian bentuk substrat de
ngan enzim. Satu enzim satu substrat.
5. Pernyataan yang merupakan ciriciri DNA
Contohnya adalah substrat lipid enzimnya
adalah dapat menduplikasikan diri pada adalah lipase. Substrat emilum enzimnya
saat membelah, yaitu pada saat interfase
adalah amilase. Sementara itu ciri yang
(istirahat) pada subfase S (sintesis DNA) lainadalah:
dan mengandung informasi genetik yang
Enzim bekerja dipengaruhi oleh suhu
akanditurunkankeanakmelaluipewarisan
(semakin tinggi suhu enzim semakin
sifat.SedangkanciriRNAadalahkadarnya bekerja cepat), suhu terlalu tinggi en
berubahubahberdasarkansintesisprotein
zim akan rusak (denaturasi) dan jika
membentukrantaitunggaldanpanjang.
suhu terlalu rendah enzim akan tidak
Jawaban:A
aktif.

Enzim dipengaruhi pH seperti enzim di
6. Tahapan selanjutnya dari sintesis protein mulut bekerja dalam suasana netral, di
tersebut (tahap ke5) adalah mRNA sele
lambung asam, di usus basa, dan di
sai dicetak meninggalkan nukleus menuju
dalam sel tubuh pH dalam kondisi
sitoplasma kemudian menuju ke ribosom. netral.
Setelah sampai di ribosom terjadi pe
Apoenzim pada substrat adalah enzim
ngenalankodonAUGolehsubunitribosom
yangtersusunolehproteinsajasemen
kecil.Selanjutnyaterjadipemasangansub
taraenzimbekerjaharusadaduakom
unit ribosom dan diakhiri pengenalan
ponen, yaitu apoenzim dan koenzim
kodon UAG oleh ribosom dan proses (nonprotein)membentukholoenzim.

24

Inhibitor pada enzim adalah pengham Siklus Krebs menghasilkan 6 NADH, 2


batkerjaenzimsepertiHg. FADH,2ATP,4CO2
Induksi substrat: enzim bekerja berda Transferelektronmenghasilkan34ATP
sarkan induksi/rangsangan substrat dan dan6H2O
bersifatfleksibel. Jawaban:A
Jawaban:B
15. Reaksipadarespirasiaerobadalah:
10. Transpor elektron yang berlangsung di 2piruvatasetilKoA2CO2
dalam mitokondria, prosesnya akan ber Repirasianaerob/fermentasi
akhir setelah elektron H+ bereaksi dengan a. Fermentasiasamlaktat:
oksigen yang berfungsi sebagai akseptor glukosapiruvatlaktat
terakhir dan akan membentuk H2O. b. Fermentasialkohol:
Reaksi: glukosapiruvatasetildehidetanol
2H++O2H2O Fermentasicuka:
Jawaban:B etanolasamcukaH2O
Jawaban:C
11. X (oksigen) yang dihasilkan pada reaksi
fotosintesistersebutterbentukpadatahap 16. Yang merupakan proses respirasi anaerob
reaksi terang tahap fotolisis dari hasil adalah respirasi yang tidak menggunakan
penguraianH2O.Reaksi: oksigen dan pembentukan ATP pada jalur
H2O 2H++O2 glikolisis sebanyak 2 ATP. Sedangkan ta
Jawaban:A hap transfer elektron membentuk ATP
merupakantahapdarirespirasianaerob.
12. Dalam proses pembuatan tape ketan ter Fermentasialkohol:
jadi proses fermentasi. Urutan proses fer glukosapiruvatasetildehidetanol
mentasi tersebut adalah tepung gula Tahapglikolisismenghasilkan2ATPdan2
alkohol. NADH.
Amilum(tepung)glukosa2C2H5OH+ Jawaban:C
2CO2+2ATP
Jawaban:A 17. Berdasarkansusunankromatiddanjumlah
calon sel anak, gambar tersebut menun
13. Asam piruvat dari proses respirasi aerob jukkan fase anafase mitosis (kromatid
akan megalami perubahan, secara ber tertarikkekutubyangberlawanan).
turutturut yang ditunjuk nomor 1 adalah Jawaban:C
CO2 dan 2 adalah asetilKoA. Proses ini
terjadi di matriks mitokondria yang dise 18. Ciri pembelahan mitosis adalah nomor (2)
butprosesdekarboksilasioksidatifdengan terjadipadaselsomatik/tubuhdan(3)sifat
menghasilkan produk berupa asetil KoA, sel anak sama dengan sel induk, serta
2NADH,dan2CO2. pembelahan berlangsung satu kali. Se
Jawaban:D dangkan ciri yang lain seperti (1) sifat sel
anak tidak identik dengan sel induk, (4)
14. Tahapan glikolisis menghasilkan produk 2 terjadi pada gonad, (5) pembelahan ber
ATP, siklus Krebs 2 ATP, dan transfer langsung dua kali merupakan ciri pem
elektron 34 ATP. Sementara itu bagian belahanmeiosis.
yanglainmenghasilkan: Jawaban:C
Glikolisismenghasilkan2asampiruvat,
2ATP,dan2NADH
Dekarboksilasi oksidatif menghasilkan
2asetilCoA,2CO2,dan2NADH

25

19. Gambar tersebut menunjukkan sel yang o Lactobacillus bulgaricus untuk pembu
sedang membelah pada fase metafase atanyoghurt.
(kromosom berada di garis ekuator). o Aspergillus oryzae untuk pembuatan
Sementaraitubagianyanglainadalah: kecapatautauco.
Interfase: terjadi metabolisme, sintesis o Azotobacter chlorococum mampu me
DNA, penyiapan energi, dan duplikasi ngikat nitrogen bebas, sehingga ber
organel. manfaatsebagaipenyuburtanah.
Profase:pembentukankromosom,kro o Rhizopus oligosporus untuk pembuatan
mosom berduplikasi menjadi dua kro tempe.
matid. o Peniciliumnotatumuntukmembuatanti
Anafase: kromosom tertarik ke kutub biotik.
yangberlawanan. Jawaban:A
Telofase: kromosom berubah kembali
menjadi benang kromatin dan sel 22. Prinsip bioteknologi konvensional adalah
membelah menjadi dua sel anak baru melalui proses fermentasi dengan meli
(sitokinesis). batkanjasamikroorganismeuntukmeng
Jawaban:E hasilkan produk baru seperti produksi
yoghurt menggunakan Lactobacillus
20. Tanaman hasil rekayasa genetik (trans bulgaricus. Sementara itu untuk mengha
genik), juga dikhawatirkan menimbulkan silkan hormon insulin dan tanaman tahan
ancaman terhadap lingkungan karena ter hama dengan menggunakan teknik reka
jadi pencemaran gen menyerbuki tana yasagenetika.
man sejenis. Sehingga tanaman sejenis Jawaban:B
akan menghasilkan keturunan menjadi
tanaman transgenik dan berakibat meng 23. Teknikbioteknologiyangdapatdigunakan
hilangkan sifat asli tumbuhan (galur mur untukmendapatkantanamantahanhama
ni). adalahpembuatantanamantransgenik
Jawaban:D (transplantasi gen) dengan rekayasa gen
dimana gen bakteri Bacillus thuringiensis
21. Hubungan yang benar antara mikro dapat disisipkan ke tanaman kapas se
organisme dengan peranannya adalah no hingga kapas akan tahan hama karena
mor1Acetobacterxylinumdenganc,yaitu bakteri ini mampu menghasilkan racun
pembuatan nata de coco. Sementara itu (betaendotoxin)untukmelawanhama.
untuk mikroorganisme yang lain berman Jawaban:B
faatuntuk:

26

BAB4

1. UN2011 A.M1m1M2m2><M1m1m2m2
Warna bulu hitam pada kucing diken B.M1M1M2m2><m1m1M2m2
dalikanolehgenHyangdominanterhadap C.M1m1M2M2><m1m1M2m2
gen bulu putih (h). Perkawinan dua ekor D.M1M1M2m2><M1m1m2m2
kucing menghasilkan keturunan dengan E.M1m1M2m2><M1m1M2m2
rasio fenotipe hitam : putih = 1 : 1.
Genotipe kedua induk masingmasing 5. UN2011
adalah. Tanamankedelaiberkulithitam(HhKk)di
A. HHdanHH D. Hhdanhh silangkandengankulitkuning(hhKk).Jika
B. HHdanhh E. hhdanhh gen H = hitam epistasis terhadap gen K =
C. HhdanHh kuning, perbandingan fenotipe hitam :
kuning : putih yang muncul pada ke
2. UN2008 turunannyaadalah....
Seorang peneliti menyilangkan galur mur A.2:1:1 D. 4:3:1
ni kacang kapri berbiji bulat warna kuning B.2:2:1 E. 6:2:2
(BBKK)danbijikeriputwarnahijau(bbkk). C.4:2:2
Persilangan dilakukan sampai mendapat
keturunan F2 yang menghasilkan biji se 6. UN2008
jumlah3.200buah.Secaraberurutan,jum PadapenyilanganbungaLinariamarocana
lahbijibulatwarnakuningdanbijikeriput bunga merah (AAbb) dengan bunga putih
warnahijauadalah.... (aaBB) menghasilkan bunga ungu (AaBb).
A. 200dan600 D. 600dan200 Apabila F1 disilangkan dengan bunga me
B. 200dan1200 E. 1800dan200 rah (Aabb), berapa rasio fenotipe F2 nya
C. 200dan1800 antaraungu:putih:merah?
A.3:2:3 D.9:4:3
3. UN2013 B.6:2:8 E.12:3:1
Seorang petani menyilangkan tanaman C.9:3:4
semangka buah besar, rasa tidak manis
(BBmm) dengan tanaman buah kecil, rasa 7. UN2013
manis(bbMM).Keturunanpertama(F1)di Perhatikangambarprosespembentukan
silangkansesamanya,persentaseketurun selkelaminberikut!
an yang mempunyai sifat besar manis
sebesar....
A. 6,25% D. 25%
B. 12,5% E. 56,25%
C. 18,75%

4. UN2011
Warnabijigandummerahditentukanoleh
M1 dan M2. Dari persilangan gandum me
rah sesamanya didapat keturunan dengan Tahappembentukanspermatositsekunder
rasio15gandumbijimerahdan1gandum ditunjukkanoleh....
bijiputih.Genotipeparentalyangdisilang A. 1 D. 4
kantersebutadalah.... B. 2 E. 5
C. 3

27

8. Pada peristiwa oogenesis, setiap 1 oogo danuapairbereaksi.PercobaanMillerber


niumyangmengalamimeiosisakanmem tujuanuntukmembuktikanbahwa....
bentuk.... A. makhluk hidup bersel satu terbentuk
A.1ovumfungsionaldan1badankutub darireaksiH2,CH4,NH3,danH2O
B.1ovumfungsionaldan3badankutub B. campuran gas merupakan bahan dasar
C.2ovumfungsionaldan2badankutub pembentuksel
D.3ovumfungsionaldan1badankutub C. C, H, O, dan N adalah unsur utama
E.4ovumfungsional penyusunselmakhlukhidup
D. Senyawa organik dapat terbentuk
9. Pernyataanyangmenunjukkanperbedaan secara perlahan dari zat anorganik
spermatogenesisdanoogenesis: dalamkondisiabiotik
Spermatogenesis Oogenesis E. asam amino dan nukleotida adalah se
A. dihasilkan4sel dihasilkan1sel nyawakomplekspembentuksel
spermafungsional ovum
B. adabadankutub tidakada 12. UN2009
badankutub Dibawahiniadalahteoriteoritentangasal
C. diketemukan tidak usul kehidupan yang pernah disusun oleh
spermatid ditemukan paraahli,diantaranya:
ootid 1. Kehidupan diciptakan oleh zat supra
D. meiosisI meiosisI naturalpadasaatistimewa(teorikreasi
menghasilkansel menghasilkan khas).
primer selsekunder 2. Kehidupanmunculdaribendatakhidup
E. spermatogonia oogoniatak padaberbagaikesempatan.
terbatas terbatas 3. Kehidupantidakberasalusul.
4. Kehidupan datang di planet ini dari
10. UN2011 manasaja.
Pernyataan yang sesuai dengan teori evo 5. Kehidupanmunculberdasarkanhukum
lusi biologi tentang asal usul kehidupan fisikakimia.
pertamakaliadalah.... Secaraberurutan,teoriusulkehidupandari
A. organisme pertama terbentuk di at Aristoteles dan Alexander Oparin adalah
mosfersebagaihasilreaksipetir ....
B.sel primordial yang bersifat heterotrof A.1dan2 D.3dan5
terbentukpertamakalidilautan B.2dan3 E.4dan5
C.organisme terbentuk sebagai hasil re C.2dan5
aksiunsurC,H,O,danN
D.organisme pertama di lautan sebagai 13. UN2015
timbunanorganikyangbelumteruji Rasanjingpudeldananjingbuldogsecara
E. sop purba sebagai kumpulan senyawa alami tidak melakukan interhibridisasi.
homogen pertama kali terbentuk di Hambataniniterjadikarena....
lautan a. isolasitingkahlaku
b. ketidakmampuanhibrida
11. UN2010 c. koreksiterhadapperkawinan
StanleyMillermenyimulasikondisiatmos d. kemandulanspesies
fer purba di dalam laboratorium. Miller e. isolasimekanik
memasukkan gas H2, CH4 (metana), NH3
(amonia), dan air ke dalam suatu alat,
kemudian memberi sumber energi yang
bertindaksebagaihalilintaragargasgas

28

14. UN2011 berkulit normal homozigot dan hetero


Hardy dan Weinberg mengatakan kese zigotsecaraberurutanadalah....
timbangangendangenotipedarigenerasi A.6.400dan1.600 D. 3.200dan400
ke generasi selalu tetap. Frekuensi gen B.6.400dan3.200 E. 1.600dan400
berubahapabila.... C.3.200dan1.600
A. emigran sama besar dengan imigran
padagenyangsama
B. perkawinan antarindividu tidak terjadi
secaraacak 18. UN2009
C. kemungkinan mutasi Aa atau aA Beberapafaktayangterjadidialamantara
sama lain:
D. viabilitas dan fertilitas AA, Aa maupun 1. Semua spesies mempunyai potensi re
aasama produksiyangtinggi.
E. populasidalamsuatukomunitassangat 2.Terdapatvariasiyangditurunkandian
besar taraindividusatuspesies.
3.Terdapatbanyakhomologiorgan.
15. UN2011 4. Ditemukannya hewan yang sama di
Di bawah ini contohcontoh tentang ana tempatyangberbeda.
logi dan homologi sebagai bukti terja Fakta yang menjadi dasar teori evolusi
dinyaevolusi: adalah....
1. Sayap kupukupu dengan sayap bu A. 1dan2 D. 2dan4
rung. B. 1dan4 E. 3dan4
2. Sayapkupukupudengankakibuaya. C. 2dan3
3. Sayapburungdengansayapkelelawar.
4. Kakibuayadengansayapkelelawar. 19. UN2013
5. Kakibuayadengansiripdadaikan. Beberapa pernyataan di bawah ini ber
Pasangan organ tubuh yang termasuk kaitandenganteorievolusi:
organanalogadalah.... 1) Kesamaan individu dalam satu ketu
A. 1dan2 D. 2dan4 runan.
B. 1dan3 E. 4dan5 2) Seleksialam.
C. 1dan5 3) Perubahanlingkungan.
4) Pertambahanpopulasi.
16. UN2010 5) Terjadinyamutasi.
Di suatu kota berpenduduk 100.000 jiwa. Pernyataanyangmenyebabkanterjadinya
Dengan komposisi lakilaki dan perem mekanismeevolusiadalah....
puan sama, terdapat 5% penduduk laki A. 123 D. 245
lakimenderitabutawarna.Pendudukkota B. 134 E. 145
tersebutyangbersifatnormaltetapimem C. 235
bawa gen buta warna diperkirakan ber
jumlah.... 20. UN2008
A. 500orang D. 9.500orang Bila pada populasi manusia ada 9 orang
B. 4.750orang E. 45.125orang mengalamigangguanmentaluntuksetiap
C. 5.000orang 10.000 populasi penduduk. Maka jumlah
populasimanusiayangheterozigotnormal
17. UN2009 tiap10.000pendudukadalah....
Pada suatu daerah dengan 10.000 pen A. 582orang D. 91orang
duduk, terdapat 4% warga yang albino. B. 291orang E. 9orang
Maka perbandingan jumlah orang yang C. 109orang

29

m1 M1m1 M1m1 m1m1 m1m1


M2 M2M2 M2m2 M2M2 M2m2
m1 M1m1 M1m1 m1m1 m1m1
m2 M2m2 m2m2 M2m2 m2m2
1. P :Hh><hh Jadi,rasiofenotipe=15merah:1putih.
G :Hdanhh Jawaban:E
F :Hh(hitam)danhh(putih)=1:1
Jawaban:D 5. Parental:HhKk><hhKk
HK Hk hK hk
2. Parental :BBKK >< bbkk hK HhKK HhKk hhKK hhKk
Gamet :BK bk hitam hitam kuning kuning
Filial1 : BbKk hk Hhkk Hhkk hhKk hhkk
Filial2 :BbKk >< BbKk hitam hitam kuning putih
BK Bk bK bk Jadi,perbandinganfenotipe=4hitam:3
BK BBKK BBKk BbKK BbKk kuning:1putih.
Bk BBKk BBkk BbKk Bbkk Jawaban:D
bK BbKK BbKk bbKK bbKk
bk BbKk Bbkk bbKk bbkk 6. Parental:AaBb><Aabb
RasiofenotipeF2adalah=9:3:3:1 AB Ab aB ab
9 bulat kuning : 3 bulat hijau : 3 keriput A AABb Aabb AaBb Aabb
kuning:1keriputhijau b (Ungu) (Merah) (Ungu) (Merah)
1800 bulat kuning : 600 bulat hijau : 600
keriputkuning:200keriputhijau a AaBb Aabb aaBb Aabb
Jikasemuaketurunanjumlahnya3200ma b (Ungu) (Merah) (Putih) (Putih)
ka jumlah biji bulat warna kuning adalah
1800 biji dan biji keriput warna hijau ber RasiofenotipeF2nyaantaraungu:putih:
jumlah200biji. merah=3:2:3
Jawaban:E Jawaban:A

3. P1 :BBmm><bbMM
7. Perhatikangambarberikut!
G :BmbM
F1 :BbMm
P2:BbMm><BbMm
F2 : B_M_ =9(besarmanis)
B_mm =3(besartidakmanis)
bbM_ =3(kecilmanis)
bbmm=1(keciltidakmanis)
Persentaseketurunanyangmempunyaisi
fatbesarmanis9/16x100%=56,25%
Jawaban:E

4. Parental:M1m1M2m2><M1m2M2m2

M1M2 M1m2 m1M2 m1m2
M1 M1M1 M1M1 M1m1 M1m1
M2 M2M2 M2m2 M2M2 M2m2
M1 M1M1 M1M1 M1m1 M1m1
Jawaban:C
m2 M2m2 m2m2 M2m2 m2m2

30

8. Perhatikangambarberikut! Jawaban:E
12. Teori asal usul kehidupan dari Aristoteles:
kehidupan muncul dari benda tak hidup
pada berbagai kesempatan (abiognesis/
generatio spontanea), sedangkan teori
Alexander Oparin: kehidupan muncul ber
dasarkan hukum fisikakimia yang terben
tuk makhluk hidup (evolusi biokimia).
Makhlukhidupmunculdariairhasilreaksi
Pada gambar di atas terlihat bahwa se kimia dari gas atmosfer purba (CH4, NH3,
tiap 1 oogonium yang mengalami meio H,danH2O)bereaksimembentukasamami
sis akan membentuk 1 ovum fungsional no, kemudian di lautan berkumpul mem
dan3badankutub. bentuksuppurbadanmenjadiselprimitif.
Jawaban:B Jawaban:C

9. Perbedaanspermatogenesisdan 13. Anjing pudel termasuk anjing yang bertu
oogenesis: buhkecilsedangkananjingbuldogterma
sukanjingbertubuhbesar.Keduajenisan
Spermatogenesis Oogenesis jing tersebut berbeda bentuk tubuh, de
A. dihasilkan4sel dihasilkan1sel ngan hal ini tidak bisa melakukan perka
spermafungsional ovum winankarenaperbedaanukuranalatkela
B. tidakadabadan adabadan min(isolasimekanik).
kutub kutub Jawaban:E
C. diketemukan diketemukan
spermatid ootid 14. Hardy dan Weinberg mengatakan kese
D. meiosisI meiosisI timbangangendangenotipedarigenerasi
menghasilkansel menghasilkan ke generasi selalu tetap. Frekuensi gen
sekunder selsekunder berubah apabila perkawinan antarindividu
E. spermatogoniatak oogonia tidak terjadi secara acak. Syarat hukum
terbatas terbatas HardyWeinbergadalah:
Jawaban:A Emigran sama besar dengan imigran
padagenyangsama.
10. Pernyataan yang sesuai dengan teori Perkawinanantarindividuterjadisecara
evolusi biologi yang dikemukakan Oparin acak.
tentang asal usul kehidupan pertama kali KemungkinanmutasiAaatauaA
adalahselprimordialyangbersifathetero sama.
trofterbentukpertamakalidilautan. Viabilitas dan fertilitas AA, Aa, mau
Jawaban:B punaasama.
Populasidalamsuatukomunitassangat
11. Percobaan Miller bertujuan untuk mem besar.
buktikan bahwa reaksi H2, CH4, NH3, dan Jawaban:B
H2O yang dimasukkan ke dalam alat per
cobaannya diberi loncatan listrik dapat 15. Pasangan organ tubuh yang termasuk
menghasilkan asam amino. Asam amino organ analog (memiliki kesamaan fungsi
dianggap sebagai protobion (zat dasar organ tubuh) adalah 1. Sayap kupukupu
penyusun makhluk hidup), sehingga asam dengan sayap burung serta 3. Sayap
amino dan nukleotida adalah senyawa burung dengan sayap kelelawar. Sama
komplekspembentuksel. sama organ sayap yang berfungsi untuk
31

terbang. Sedangkan homolog (memiliki 19. Faktorfaktor yang memengaruhi meka


kesamaan asal usul, namun fungsi organ nismeevolusi:
berbeda)sepertikakidepanbuayadengan a. Mutasi
sayap kelelawar serta kaki depan buaya Mutasimengakibatkanterjadinyaperu
dengansiripdadaikan. bahan frekuensi gen, sehingga meme
Jawaban:B ngaruhi fenotipe dan genotipe. Mutasi
dapat bersifat menguntungkan dan
cb
16. X =5%dari100.000 merugikan.Keduasifattersebutterjadi
Xcb =5000 jikadapatmenghasilkansifatbaruyang
Xcb =jumlahlakilakibutawarna/populasi lebih menguntungkan, dapat mengha
=5000/100.000 silkanspesiesyangadaptifdanmemili
=0,05 ki peningkatan daya fertilitas dan via
Frekunsigenlakilakibutawarna=0,05 bilitas.
Jadi,frekuensigennormal=10,05=0,95 Mutasi bersifat merugikan, jika meng
Maka,jumlahwanitacarrier=2XCbXcb=2. hasilkan sifatsifat yang berkebalikan
0,95.0,05.50.000=4.750orang dengansifatsifatdiatas.
Jawaban:B b. Seleksialamdanadaptasi
Adaptasi akan diikuti dengan proses
17. Populasi=10.000, seleksi. Individu yang memiliki adap
Albino:4/100x10.000=400 tasi yang baik akan dapat memper
Frekuensi gen albino = jumlah penderita tahankan hidupnya, memiliki resistensi
albino/populasi yang tinggi dan dapat melanjutkan ke
aa=400/10.000=0,04 turunannya. Sedangkan individu yang
aa= 0,o4 =0,2 tidakdapatberadaptasiakanmati.
Frekuensigennormal Jawaban:C
A=10,2=0,8
Normalhomozigot: 20. Menurut teori evolusi Darwin yang ada
AAxpopulasi=0,8x0,8x10.000=6.400 hubungannya dengan evolusi jerapah
Normalheterozigot: adalahnomor2dan4.Padamasalampau
2Aa x populasi =2 x 0,8 x 0,2 x 10.000 = terdapatjerapahberleherpanjangmaupun
3.200 berleher pendek kemudian jerapah ber
Jawaban:B leherpendekmati,sedangkanjerapahber
leher panjang tetap lestari/hidup akibat
18. Fakta yang menjadi dasar teori evolusi seleksialam.Sementaraituevolusijerapah
adalah: menurut Lamarck adalah jerapah berleher
1. Adanyavariasiyangditurunkandianta panjang berasal dari induk jerapah berle
raindividusatuspesies. herpendek,perubahanleherjerapahyang
2. Semua spesies mempunyai potensi re pendek dapat memanjang karena penga
produksiyangtinggi. ruhlingkungan.
3. Bertambahnyapopulasitidaktakterba Jawaban:D
tas.
4. Untuk survive butuh makanan dan ru
angyangcukup.
Jawaban:A

32