Anda di halaman 1dari 298

"-

taniah D. Soetikno
RF.KKS.1 7 .01 .201',1

Ristaniah D' Soetikno


Radiologi Emergensi

Vini Nilasari
dr'
Editor: dr. Mashuri, dr' Robby Hermawan'
Desain SamPul: CuYun Slamet
Setting & LaYout lsi: CuYun Slamet

Diterbitkan & dicetak oleh PT Refika Aditama


Bandung 40254
Jl' Mengger Cirang No' 98'
relp' 6"zz) 5205985, Fax' (o2D 5205984
Website: www'ref ika-aditama'com
Emai l: refika-aditama@yahoo'co'
id
Anggota lkaPi

Cetakan Pertama' November 201 1

lsBN 978-602-8650-60-1
02011
Hak Cipta Dilindungi Undang-Undang'
Dilarang mengutip t"tp"tU'rylft t;g"qLn atau seluruh isi buku ini
"a",
TANPA lzli\ TERTULIS dari penerbit'
vI

Daftar lsi
--a

l--::.,

E-::-

Kata Pengantar V

Bab 1 Kepata dan Wajah 1

:r -: Bab 2 Tutang SeMkat 37

Bab 3 Torak 53

Bab 4 Abdomen 115

Bab 5 Anggota Gerak Atas 171

Bab 6 Anggota Gerak Bawah 213

Bab 7 Kegawatdaruratan pada Pediatri zs1

Daftar Pustaka 297


Biografi Penutis 30'1
dan
Radiologi Emergensi

Kontusio serebri 2
Perdarahan elatradura[ /epidural 6
Fraktur wajah 10
Fraktur wajah (tanjutan) 12
Fraktur tengkorak 15
Fraktur tengkorak (tanjutan) 17
Stroke 19
Ferdarahan subaraknoid 29
Perdarahan subdural 32

l
1
Kepala dan Wajah

Kontusio serebri

KaraKeristik
. Bentuk yang paling umum dari cedera intra-akial akibat trauma.
o Kontusio teriadi pada permukaan inferior dan permukaan kutub dari
lobus frontalis dan lobus temporalis.
. Cedera terjadi secara sekunder akibat kontak dengan permukaan tulang
selama proses deselerasi dan teriadi akibat kerusakan pada pembuluh
darah parenkim yang menyebabkan perdarahan petekie dan edema.
r Kontusio sering terjadi pada perbatasan antara substansia grisea dan
substansia alba.
. Cedera dapat bersifat coup atau contra-coup.
. Kontusio serebri juga dapat disebabkan secara sekunder akibat fraktur
depresi pada tengkorak serta bersama dengan cedera intrakranial
yang lain.

Gambaran klinis
. Biasanya berhubungan dengan penilrunan kesadaran yang singkat.
Cejala kebingungan dan obtundasi dapat berkepanjangan.
o Defisit neurologis fokal dapat terjadi jika kontusio teriadi dekat dengan
kortek sensorik-motorik.
o Kebanyakan pasien dapat sembuh tanpa masalah berarti, namun
beberapa mengalami peningkatan tekanan intrakranial, kejang pasca
trauma dan defisit neurofokal yang menetap.
e Hati-hati pada pasien usia lanjut, pecandu alkohol dan pasien dalam
pengobatan antikoagulan, karena mereka memiliki risiko yang tinggi
terhadap perdarahan.

@mbaran radiologi
. Computed tomography (Cf) tanpa kontras bermanfaat pada periode
awal pasca trauma.
. Kontusio tampak sebagai area dengan atenuasi rendah yang bersifat
fokal atau multifokal. Area tersebut bercampur dengan area-area kecil
berdensitas tinggi yang menggambarkan suatu perdarahan.
. Luas cedera yang sebenamya menjadi lebih jelas seiring dengan waktu
akibat berlangsungnya proses nekrosis dan edema sel.
. Magnetic resonance imaging (MRl) merupakan modalitas yang terbaik
untuk memperlihatkan distribusi edema dan kontusio.
Radiologi Emergensi

t,E-:
t-_-
r:

h:_
:-: Kontusio muttifokat di
datam kedua lobus frontatis
yang disertai perdarahan
subaraknoid pada tentorium
(mata panah). Terdapat
pembengkakan jaringan
lunak (asterik)

c,_:

! :-

\=-

l: <
Kontusio pada area parieto-
oksipital kiri
Kepala dan Wajah

Kontusio luas di lobus


frontalis dan temporalis
kanan

Kontusio di lobus
temporalis kanan yang
disertai perdarahan
subaraknoid di sulkus
(panah) sebelah posterior
dari lesi.
Radiologi Emergensi

^.
Kontusio serebri pada kedua lobus frontalis (panah). Densitas rendah pada
area di sekitarnya menggambarkan edema [oka[.

I
6 | repala dan Wajah

Perdarahan ektradural / epidural

KaraKeristik
. Kebanyakan kasus berasal dari arteri (a. meningea media) dan sebagian
kecilberasal dari vena.
o Biasanya unilateral dan pada orang dewasa, berhubungan dengan
fraktur. Seringkali tidak terdapat fraktur tengkorak pada anak-anak,
oleh karena elastisitas dari tengkorak.
. Perdarahan terbentuk antara tabula intema dari tengkorak dan selaput
dura.
o Dapat disertai lesi seperti perdarahan subdural atau kontusio.
. Perdarahan arteri biasanya'berkembang dan timbul secara cepat
dalam t jam setelah cedera, sementara perdarahan vena dapat timbul
setelah beberapa hari.

@mbaran klinis
. Secara klasik muncul setelah cedera kepala dengan kehilangan kesadaran
pada fase awal yang diikuti oleh fase sadar (lucid interval) sebelum
kembali terjadi penurunan kesadaran.
. Hati-hati karena hanya 3o% pasien yang datang seperti ini.
. Geiala tergantung pada seberapa cepat perdarahan berkembang. Rasa
mengantuk yang progresif, sakit kepala, mual dan muntah merupakan
gejala yang patut diwaspadai.

Gambaran radiologi
. Pada CT scan terlihat area hiperdens elips bikonveks dengan batas
yang tegas. Densitas yang beragam menandakan perdarahan aktif.
. Perdarahan tidak melewati garis sutura.
. Dapat memisahkan sinus venosa atau falks dari tengkorak; hanya
perdarahan tipe ini yang dapat melakukan hal tersebut.
. Efek massa tergantung pada ukuran perdarahan dan edema yang
menyertainya.
. Perdarahan vena lebih bervariasi dalam bentuk.
. Garis fraktur yang berhubungan mungkin dapat terlihat.
Radiologi Emergensi 7

tI

a I
=1

:l

=-!L

=: at
r- cul
Perdarahan ekstradural akut
yang minimal (mata panah).

::?n

: asa

=<an

_'=:as

=-\'a

Perdarahan ekstraduraI akut


(mata panah).
8 Kepala dan Wajah

)
Perdarahan ekstradurat.
Tampak bayangan (panah)
hiperdens dan isodens yang
menunjukkan perdarahan
yang bersifat akut dan
subakut. Perdarahan
subaraknoid juga terdapat
(mata panah).

Perdarahan ekstradural
akut (mata panah),
perdarahan subaraknoid
(panah metengkung),
dan kontusio muttifokal
(panah).
Radiologi Emergensi

Perdarahan ekstraduraI yang berdensitas tinggi dan berbentuk lentiformis


di sebetahkri (panah). Perhatikan kontusio contra-coup di sebetah kanan
(mata panah).
10 I Kepala dan Walah

Fraktur wajah

lGrakteristik
. Seringkali bersifat sekunder, pada orang dewasa akibat penyerangan
dan pada anak-anak akibat jatuh. Penyebab fraktur wajah pada anak-
anak harus dicurigai bukan akibat kecelakaan.
. Kepentingan lebih terhadap diagnosis daripada terapi spesifik pada
kecelakaan dan keadaan emergensi. Kehilangan fungsi dan disabilitas
dapat bersifat signifikan setelah trauma pada wajah.
. Pertimbangkan adanya cedera tulang servikal.
. Diklasifikasi berdasarkan tempat - makila (sub-klasifikasi oleh Le Fort),
malar, infra-orbital, mandibular dan nasal.

Gambaran klinis
Italsila
. Umumnya berhubungan dengan cedera wajah yang masif dan cedera
organ lain. Pasien datang dengan pembengkakan jaringan lunak yang
masif, mo itas mid-f ace dan ma lokl u si. Rhinor rhoea
bil ca ira n serebrospina I

dapat terjadi sekunder akibat robekan dura.


. Epistaksis yang signifikan dapat terjadi dan membahayakan baik jalan
nafas maupun sirkulasi serta memerlukan intervensi.

Klasifikasi Le Fort

Le Fort I melibatkan maksila yang menyandang

melibatkan maksila, tulang nasal dan I

aspek medial dari orbita. I

Le Fort I melibatkan maksila, tulang nasal, I

lll I vomer, etmoid dan tulang-tulang kecil


membentuk basis tengkorak.
dari basis

lrlalar
Zigoma dapat mengalami fraktur secara tersendiri atau lebih sering
meluas ke foramen infra-orbital dengan gangguan pada sutura
zigomatiko-temporal dan zigomatiko-frontal (fraktur tripod).
Perhatikan adanya pendataran pipi, lekukan yang teraba, kerusakan
saraf infra-orbital dan diplopia.
Pemeriksaan intra-oral dapat memperlihatkan iregularitas tulang di atas
dan di belakang gigi molar atas.
Radiologi Emergensi 11

=2ngan
-- .---t-
ldK-
-:

'i pada
'.: b ilitas

-= Foft),

'aedera
:< \"ang
r':spinal

< jalan
=

Fraktur mid-foce - Le Fort ll. Diastasis juga tampak pada sutura


zigomatiko-frontaI kiri (panah).
- senng
si-rtura

:-*sakan

I :i atas
12 Kepala dan Wajah

Fraktur wajah (tanjutan)

Fraktur infra-orbital (blow out)


. Emfisema enoftalmus dan orbital dapat terlihat. Diplopia dapat terjadi
sekunder akibat jeratan terhadap otot okular (atau lemak orbita).
. Cedera bola mata tidaklah jarang, misal ablasio retina

Itandibuta
. Nyeri, nyeri tekan dan lekukan yang terpalpasi dapat ditemukan.
Maloklusi juga umum ditemukan. Lokasi fraktur dapat teriadi berjauhan
dari lokasi impaki.
. Mati rasa pada bibir menyokong adanya kerusakan n. alveolar inferior.

Gambaran radiologi
Italsila
. Dilakukan foto facial view. Fraktur kadang-kadang sulit dilihat.
. CT scan seringkali bermanfaat untuk menggambarkan jumlah dan luas
fraktur. Berguna dalam perencanaan pembedahan dan tindak lanjut
berikutnya.

lialor
. Facial view ditambah submentovertex (SMV) view untuk menggambarkan
arkus zigomatikus.

lnfra-orbital
o Fociol view dapat memperlihatkan gambaran teor drop sign, yang
menunjukkan adanya jaringan lunak yang herniasi ke sinus makilaris.
Opasifikasi komplit dari sinus makilaris terjadi sekunder akibat perdarahan
dan edema, dan jika unilateral, harus dipertimbangkan sebagai fraktur
sekunder sampai dibuktikan sebaliknya.
. Depresi dari dasar orbita dapat terlihat. I

. Udara dalam jaringan lunak dapat terlihat pada emfisema orbita.

liandibulor
o Konfirmasi dengan pemeriksaan panoramik yang dikombinasi dengan
posisi antero-posterior (AP).
. Condylar view dapat memperlihatkan fraktur atau dislokasi sendi
temporomandibular (TMJ). CT koronal berguna pada kesulitan
memperlihatkan fraktur kondiloid.
Radiologi Emergensi 13

-!

ln.
an

tas
r.lt

Fraktur infra-orbita[.
(a)Teor drop sign. (b) CT
koronaI mempertihatkan hal
yang sama.

5
1S.
3n
:UT

:an

'rdi
an
14 Kepala dan Wajah

t'

Fraktur arkus zigomatikus kiri

G
Li
a

&
a

Panoramik: Fraktur pada korpus kanan dan ramus kiri dari mandibuta
tu
a
Radiologi Emergensi

Fraktur tengkorak

lGrakteristik
. Disebabkan oleh benturan langsung terhadap tengkorak
. Diklasifikasi sebagai linear, depresi, atau basal.
. Tipe tergantung pada besamya kekuatan yang mengenai dan rasio
antara kekuatan dengan area benturan.
. Secara klinis, sulit untuk dideteksi. Jika terdeteki, kemungkinan disertai
cedera otak.
. Berdampak signifikan jika terjadi fraktur terbuka, fraktur yang
berhubungan dengan sinus udara, fraktur depresi atau fraktur yang
memotong arteri atau sinus dura mayor.
. Waspada akan cedera yang bukan diakibatkan kecelakaan, terutama
pada bayi.

@mbaran klinis
Linear
. Seringkali tanpa disertai cedera otak, maka relatif asimptomatis.
. Jika garis fraktur melewati sinus, sutura atau lekuk dura atau vaskular,
terdapat peningkatan risiko komplikasi seperti perdarahan atau infeki.

Depresi
. Depresi tulang dapat dipalpasi. Hal ini sulit ditemukan jika terdapat
hematoma di atasnya. Pada fraktur terbuka, fragmen depresi dapat
terlewati karena mobilitas dari kulit kepala.
. Risiko cedera otak meningkat dengan kedalaman dari depresi. Sekitar
z5% pasien akan datang dengan penurunan kesadaran. Defisit neurologis
tergantung pada cedera otak yang didapat.
. Terdapat peningkatan risiko kejang dan meningitis.

Basis
Tanda klinis mencakup hemotimpanum (darah didalam kanalis akustikus),
rhinorrho ea, otorrhoeo, Battl es's sign (hematoma retro-a uriku Ia), Racoon
eyes (ekimosis periorbita) dan defisit saraf kranial (lll, IV, dan V).
Kertas saring berguna pada pasien dengan epistaksis untuk mendiagnosis
rhinorrhoea. Jika ditaruh di atas kertas saring, cairan serebrospinal akan
meluas dan tampak seperti cincin lusen di sekitar darah.
Kepala dan Waiah

(a) Fraktur depresi pada tengkorak (mata panah) dengan (b) gambaran
yang berkoretasi (pasien yang berbeda).
Radiologi Emergensi

Fraktur tengkorak (tanjutan)

Gambaran radiologi
. Foto polos tengkorak merupakan pemeriksaan awal dan beberapa
dilanjutkan ke pemerikaan CT.
. Fraktur linear akan tampak sebagai garis hitam berbatas tegas. Dapat
disalahartikan sebagai garis sutura atau alur vaskular. AIur vaskular
biasanya bercabang, memiliki batas sklerotik dan lokasinya teftentu.
' Fraktur depresi seringkali sulit dilihat. cari adanya peningkatan atau
densitas ganda yang berhubungan dengan tulang yang tumpang tindih,
jika fraktur terproyeki secara tangensial.
o Fraktur basis tengkorak tidak terlihat dengan baik pada foto polos.
cari adanya fluid level di dalam sinus sfenoid. Jika terdapat kecurigaan,
pasien harus diperiksa dengan CT.
. CT akan memperlihatkan fraktur tengkorak jika menggunakan bone
window dan CT juga berguna untuk menggambarkan komplikasi
sekunder.
tB I repala dan Waiah

A
Fraktur katvaria sederhana (mata panah)

Fraktur basis tengkorak (Panah).


Radiologi Emergensi 19

Stroke
Karakteristik
. Didefinisikan sebagai defisit neurologis fokal yang berasal dari kelainan
vaskular dan berlangsung >24 jam. Seringkali didahului oleh transient
ischaemic ottack (TlA) (to-t5%).
. Dapat akibat infark (8o%) atau perdarahan (zo%).
o Etiologi stroke infark:
0 - 5o% disebabkan ateromatosa pembuluh darah besar yang oklusif
0 z5% pada pembuluh darah kecil yaitu arteri penetrans (infark
lakunar)
0 20% akibat emboli kardiogenik
0 S% penyebabnya bersifat non-ateromatosa.
. lnfark biasanya sekunder akibat trombosis in situ yang dapat disebabkan
oleh aterosklerosis atau emboli (biasanya berasal dari jantung).
. Stroke perdarahan diasosiasikan dengan hipertensi yang biasanya telah
berlangsung lama.
. Baik pada stroke perdarahan maupun stroke iskemik, cedera jaringan
lokal akan mengakibatkan edema yang semakin memperburuk suplai
darah.

Gambaran klinis
. Stroke iskemik biasanya datang dengan defisit neurologis fokal. Onset
biasanya mendadak, namun bisa juga dengan progresi yang bertahap
(step-like). Sakit kepala, kehilangan kesadaran, dan muntah jarang
teriadi kecuali jika terdapat keterlibatan batang otak.
. Cedera hemisfer secara klasik datang dengan kelemahan kontralateral,
penurunan tonus otot dan refleks, penurunan fungsi sensoris dan
disfasia.
. Manifestasi stroke perdarahan beruariasi bergantung pada lokasi dan
tipe perdarahan. Sakit kepala, muntah, defisit neurologis fokal dan
penurunan kesadaran merupakan temuan khas. Hati-hati akan progresi
yang cepat menuju koma.

Peron pencitraon radiolqi


. CT tanpa kontras saatini merupakan teknik pencitraan terpilih untuk
mengekklusi perdarahan intrakranial.
. Pada 6 jam pertama, stroke iskemik sulit untuk dilihat.
o CTbergunauntukmendeteksiperdarahandanjugauntukmengidentifikasi
lesi struktural yang menyerupai stroke, seperti tumor, perdarahan
subdural atau ektradural dan abses.
. Gambaran CT normal tidak mengeksklusi peningkatan tekanan intrakranial.
o Jaringan iskemik pada CT tampak hipodens akibat kombinasi penurunan
perfusi darah dan edema sitotoksik.
20 Kepala dan Wajah

. Dalam j
jamwindow period untukterapitrombolitik sistemi( hipodensitas
biasanya minimal jika terlihat.
. Jika gambaran hipodens jelas terlihat, maka harus waspada akan
adanya kesalahan dalam pengambilan informasi riwayat onset stroke.
. Hal ini memiliki dampak besar dalam penentuan terapi karena semakin
jelas gambaran hipodens maka risiko perdarahan akibat terapitrombolitik
semakin besar.
. Modalitas pencitraan yang dapat mendeteksi stroke pada tahap yang
memungkinkan untuk dilakukan terapi tromboliti( sangat diperlukan.
MRI dengan teknik diffusion weight imoging (DWl) banyak digunakan
untuk kepentingan ini.

Gambaran CT pada stroke infark


lnfark hiperakut (<12 jam)
. CT tanpa kontras dapat normal pada 6o% kasus.
. Namun, bertentangan dengan pandangan sebelumnya, CT dapat
menghasilkan gambaran abnormal pada 75% pasien dengan infark a.
serebri media yang diperiksa dalam 3 jam pertama setelah onset.
. Tanda hyperdens orteri serebri media (MCA) menunjukkan trombus
intraluminal akut dan terlihat pada z5-5o% oklusi a. serebri media akut.
. Nukleus lentiformis yang secara normal terlihat jelas, menjadi tidak
jelas pada 5o-8o% oklusi a. serebri media.

lnfark akut
12-24 jam
. Ganglia basalis yang berdensitas rendah.
. Hilangnya batas substansia grisea dengan substansia alba akibat edema.
. Perhatikan insulor ribbon sign.
. Hilangnya pola sulkus yang norrnal mengesankan adanya edema yang
mendasari

1-7 hori
o Area hipodens pada distribusi vaskular (pada 7o% pasien) akibat edema
sitotokik
. Efek massa - kompresi lokal atau menyeluruh pada ventrikel, sistema
basalis dan midline shtft.
. Transformasi menjadi hemoragik dapat terjadi setelah z-4 hari pada
hampir 7o% pasien.

lnfark subakutlkonik (>7 hari - tulan)


. Efek massa berkurang dan terjadi dilatasi ex vdcuo dari ventrikel.
o HilanBnya massa parenkim dengan pelebaran sulkus atau ventrikel
akibat ensefalomalasia.
Radiologi Emergensi 21

:<

lnfark pada area arteri serebral media. Dua contoh arteri serebral media
yang hiperdens akibat trombus intratuminal akut (mata panah).

fa

A
Dua contoh infark dini pada area arteri serebral media kiri. Perhatikan
batas substansia atba dan grisea yang menjadi tidak jetas akibat edema
serta perhatikan juga insular ribbon sign yaitu hipodensitas dan edema
pada korteks insula (area yang sensitif terhadap iskemia akibat jaraknya
pating jauh dari aliran darah kotaterat)
22 Kepala dan Wajah

Area hipodensitas yang luas pada sisi kiri (gambar atas) dan sisi kanan
(gambar bawah) dari daerah vaskularisasi arteri serebra[ media yang
diakibatkan edema sitotoksik.
Radiologi Emergensi

lnfark lakunar nukleus lentiformis kiri lnfark [obus frontalis superior kanan
(mata panah) (panah)

A
lnfark serebet[um (mata panah) lnfark wotershed posterior kanan.
lni merupakan infark area wotershed
(perbatasan) antara area a. serebral media
dan a. serebra[ posterior.
Kepala dan Wajah

lnfark area a. serebral posterior (mata Atenuasi tuas pada substansia alba kedua
Panah) hemisfer serebrum akibat ketainan
pembutuh darah kecil (mata Panah)

lnfark tuas yang melibatkan a. serebral ^. frontalis superior


Contoh lain infark [obus
media dan posterior kiri. kanan.
Radiologi Emergensi 25

: -:.=uud lnfark kronik area a.serebri media. Area infark memitiki densitas cairan serebrospinal
':: -:1 karena hitangnya jaringan otak sekunder dari ensefatomatasia (CSS mengisi ruang
: l:^:ll yang bekas infark). Sebagai akibat, terdapat pelebaran sutkus [oka[ dan dilatasi
ex vacuo dari ventrikel di dekatnya, pada kasus ini adalah fisura Sytvi dan kornu
oksipitat dari ventrikel lateral kanan.

lnfark watershed kronik lnfark kronik area a. serebral posterior


dengan dilatasi ex vacuo kornu oksipital
ventrikel tateral kiri
I
Kepala dan Wajah

Ha[ ini
.'Area
-- luas
- berdensitas rendah pada hemisfer serebri kanan'
tnlnggumbarkan infark pada area a' serebral media'
Radiologi Emergensi 27

Gambaran CT pada stroke perdarahan


a CT tanpa kontras merupakan modalitas terpilih.
a Perdarahan akut bersifat hiperdens.
a Edema di sekitamya menyebabkan hilangnya batas substansia grisea
dengan substansia alba.
Efek massa akan menyebabkan kompresi sulkus di dekatnya, kompresi
ventrikular, midline shift dan berkurangnya ukuran sistema basalis.
Tempat dan ukuran perdarahan merupakan hal penting dan akan
mempengaruhi pilihan terapi.
28 Kepala dan Wajah

r.3a

Perdarahan parenkim di parieto- oksipitat Perdarahan di tobus frontalis kiri


kiri yang ruptur ke ventrikel dan disertai
perdarahan subaraknoid. ..8

\-tst

Perdarahan akut yang besar di area arteri Perdarahan akut parenkima[ pada hemisfer
serebral media dengan ruptur ke sistem serebetIum kanan.
ventrikeI dan disertai a

efek massa.
Radiologi Emergensi 29

Perdarahan subaraknoid

Karakteristik
Perdarahan subaraknoid (PSA) spontan biasanya terjadi sekunder akibat
ruptur aneurisma atau malformasi afterio-vena.
Aneurisma yang didapat paling sering di sirkulus Willis; pada bifurkasi
dengan aliran turbulensi.
. Umumnya sebelum usia 5o tahun, namun dapat terjadi pada usia
berapa pun.
a Darah dapat menyebabkan iritasi selaput meningen.
a Riwayat sakit kepala terjadi pada kurang lebih dua per tiga pasien.

Gambaran ktinis
Nyeri kepala berat dan akut yang seringkali dideskripsikan sebagai
nyeri kepala yang paling sakit selama hidup. Walaupun nyeri kepala
ringan tidak mengeksklusi PSA.
a Muntah, pucat dan berkeringat banyak dapat terjadi.
a Kaku kuduk, tanda neurologis fokal tkejang.
o Waspada terhadap perubahan tingkat kesadaran yang dengan cepat
menjadi koma.
Komplikasi meliputi hidrosefalus (obstruksi akut dan komunikans
Ianjut), vasospasme serebral yang mengarah pada infark dan hemiasi
transtentorium akibat peningkatan tekanan intra-kranial.
Menyerupai banyak keadaan lainnya termasuk ensefalitis, meningitis,
glukoma akut dan migren.

Gambaran radiologi
a CT tanpa kontras sensitif pada 4-5 jam pertama.
a Cari tanda perdarahan akut (peningkatan densitas) di sulkus kortikal,
sisterna basalis, fissura Sylvi, sisterna serebellar superior dan di dalam
risfer
ventrikel.
. MRI relatif tidak sensitif dalam 48 jam pertama, namun berguna
setelahnya dan pada perdarahan rekuren untuk melihat deposit
hemosiderin yang kecil.
-l
,./ Kepala dan Wajah

Dua contoh perdarahan subaraknoid yang minimal.


Bayangan darah subaraknoid
hiperdens yang samar-samar tertihat me-muatasi
zurtus serebrum (mata panah).

Darah di subaraknoid tertihat dominan di


Darah subaraknoid yang hiperdens
hemisfer serebrum kanan dengan kontusio
membatasi beberapa sutkus di hemisfer
jaringan lunak di atasnya.
serebrum kiri.
Radiologi Emergensi 31

Perdarahan subaraknoid ekstensif yang Darah subarakrroid di datam ststerna


hiperdens membatasi sisterna basatis suprasetlar (mata panah hitarn).
Perdarahan subdura[ akut juga terlihat
sepan;ang tentorium dan di atas lobus
temporalis kiri (mata panah putih).

Area Iinear berdensitas


tinggi yang multipeI
E-:.ET tertihat di dalam sutkus
serebri kanan (panah);
lni mengqarnbarkan area
perdarahan subaraknoid
a kut.
32 Kepala dan Wajah

Perdarahan subdurat

Karakteristik
. Pendarahan subdural (PSD) biasanya terjadi pada orang tua dan pada
anak-anak (waspada cedera bukan akibat kecelakaan).
. Terjadi di rongga subdural, yaitu rongga potensial antara membran
pia araknoid dengan membran dura.
a Disebabkan oleh robekan traumatik daribridgingvein di rongga subdural.
a Seringkali sekunder akibat cedera perlambatan atau akibat trauma
langsung dimana terdapat gerakan otak secara relatif terhadap tengkorak.
Waspada akan batu( bersin atau muntah yang hebat pada orang tua.
Tidak terdapat hubungan yang konsisten dengan fraktur tengkorak.

Gambaran klinis
. Seringkali tidak jelas akibat peningkatan tekanan yang berjalan lambat.
Efek massa yang diakibatkan dapat menyebabkan kerusakan iskemik
yang signifikan.
. Presentasi klinis bergantung pada besar trauma yang didapat dan
pada kecepatan akumulasi hematoma.
. Diklasifikasikan menjadi akut atau kronis.
. PSD akut datang dalam z4 jam setelah cedera yang biasanya disertai
penurunan kesadaran atau penurunan status mental. Tanda-tanda efek
massa harus dicari.
I
Gambaran radiologi
. CT memperlihatkan koleki cairan berbentuk bulan sabit antara otak
dengan permukaan dalam tengkorak. Batas dalam konkaf dengan
pergeseran substansia otak yang minimal.
. Melewati garis sutura, namun tidak melewati lipatan dural.
. Pada fase akut, koleksi cairan tampak berdensitas tinggi. Pada fase
subakut (z-4 minggu pasca cedera), koleksi bersifat isodens dengan
jaringan otak dan pada fase kronis (>4 minggu pasca cedera), koleki
tampak berdensitas rendah.
I Radiologi Emergensi 33

::r Pada

: il'rb ran

-: du ral.
:'auma
'i<orak.
Perdarahan subdural akut kiri yang sedikit Perdarahan subdural akut kanan yang
:^g tua. (panah). banyak (panah).
i<3rak.

=rrbat.
><-omik

:=: dan

: seftai
:: efek

- otak
::: ga n

c3 fase Perdarahan subdural akut sepanjang Perdarahan subdural akut di atas


tentorium dan di atas lobus temporatis kiri konveksitas serebrum kiri dengan
::ngan (panah putih). Terdapat juga perdarahan perdarahan subduraI interhemisfer yang
io ieksi subaraknoid (panah hitam). bersifat ocute on chronic.
34 Kepala dan Wajah

l.
Perdarahan subdural kiri dengan densitas Perdarahan subdurat kiri yang isodens/
campuran (panah) dan efek massa yang hipodens (panah) dengan midline shiftke
signifikan serta midline shilt ke kanan. kanan.

Perdarahan subdural kiri yang isodens/ Perdarahan subdural kronik kiri yang
hipodens (panah) dengan efek massa. besar (panah).
Radiologi Emergensi

(a) PSD akut; (b) PSD


subakut; (c) PSD kronik.
Tulang Servilal
Radiologi Emergensi 37

'/il<al

Cedera tulang seMkat 38


38 Tulang Servikal

Cedera tutang seMkal

a
r<
Karakteristik (
. Kebanyakan terjacli setelah kecelakaan lalu lintas. Jatuh dari ketinggian g
dan kecelakaan olahraga merupakan kelompok penyebab tersering r./
yang kedua. F
Kebanyakan terjadi pada pria muda. Peningkatan relatif dari insidensi
terdapat pada orang tua karena artritis dan perubahan degeneratif.
Pada sekitar 3o-5o% pasien, foto konvensional dapat menegakkan
diagnosis dan tidak memerlukan pemeriksaan lebih laniut. Pada sisanya
5o-7o% pasien perlu dievaluasi dengan teknik pencitraan cross-sectional.
Fraktur yang tersembunyi paling baik diperika dengan multiple'detector
row computed tomography (MDCT), sementara cedera jaringan lunak
paling baik diperiksa dengan magnetic resononce imagrng (MRl).
Diklasifikasi berdasarkan mekanisme trauma:
0 Cedera fleki
0 Cedera rotasional
0 Cedera ektensi
0 Cedera kompresi vertikal

"a

Gambar A memperlihatkan
mekanisme cedera
Radiologi Emergensi

Tipe Fraktur Odontoid

,5

Ktasifikasi fraktur
processus odontoid.

i--.:ZCtOr
'=.' lnak
!,:
Tipe Fraktur Tulang Belakang

Baji

Tipe-tipe fraktur
vertebra.
4o Tulang Servikal

Cedera fleki
. Fraktur baji sederhana: Fraktur kompresi pada aspek antero-superior
korpus vertebra. Secara umum stabil kecuali jika disertai disrupsi
ligamentum posterior.
. Fraktur teardrop: Fraktur melalui aspek antero-inferior dari korpus
vertebra, seringkali dengan displocement fragmen ke anterior. Biasanya Per
diasosiasikan dengan disrupsi ligamentum, oleh karena itu fraktur
dianggap tidak stabil. Tinggi korpus vertebra sisi anterior biasanya
berkurang sesuai dengan mekanisme cederanya.
. Fraktur clay shoieler: Fraktur processus spinosus setelah trauma
Iangsung atau avulsi ligamentum - cedera stabil.
. Dislokasi atlanto-okipital dan atlanto-akial: Sangat tidak stabil. Dapat
berasosiasi dengan fraktur odontoid.
. Dislokasi faset bilateral: Memerlukan kekuatan yang besar dan sangat
tidak stabil. Paling baik dilihat pada proyeksi lateral. Korpus veftebra
sebelah atas bergeser ke anterior paling tidak 5o% diameter AP korpus
veftebra. Faset seringkali terlihat mengunci.
. Fraktur odontoid: Dibagi berdasarkan tempat. Tipe I terjadi pada ujung
dan bersifat stabil. Tipe z melibatkan perbatasan odontoid dengan
korpus vertebra. Tipe 3 terjadi pada aspek superior dari Cz pada
basis dari odontoid. Tipe z dan 3 bersifat tidak stabil terutama jika
berhubungan dengan pergeseran ke anterior atau ke lateral.
. Fraktur processus uncinatus: Teriadi akibat fleksi lateral. Cedera yang
stabil.

Cedera rotasional
. Dislokasi faset unilateral: Biasanya sekunder akibat cedera fleksi atau
rotasi. Faset superior mengalami dislokasi ke anterior melalui faset a\
inferior. Dianggap stabil kecuali jika terjadi pada tingkat C1lC2.

Cedera ektensi
. Fraktur arkus posterior dari atlas: Terjadi sekunder akibat tekanan
kompresif antara aksis dan oksipital. hm
. Fraktur t eardrop; Ligamentum longitudinal anterior mengavulsi pojok tepi r(
inferior dari korpus vertebra. Umum pada Cz dan C5-C7. Tinggi korpus d
vertebra tetap dipeftahankan. Cedera ini tidak stabil pada ekstensi. d
. Fraktur hangman: Fraktur bilateral melalui pedikel Cz. Sedikit sublukasi o!
C2 terhadap C3 dapat terjadi. Biasanya pada kecelakaan lalu lintas -
cedera yang tidak stabil.

Cedera kompresi vertikal


. Fraktur Jefferson: Kondilus oksipital menekan massa lateral Ct ke lateral
yang mengakibatkan fraktur arkus anterior dan posterior dengan ruptur
Radiologi Emergensi 41

Iigamentum transversum - cedera yang tidak stabil.


o Fraktur burst: Diskus intervertebra tertekan ke korpus vertebra di
: --) bawahnya. Fragmen fraktur dapat menghimpit medulla spinalis, maka
dari itu dianggap tidak stabil, walaupun fraktur itu sendiri bersifat stabil.
: -: .-s
5:-''a Pemeriksaan klinis

5:-" 3
' semua pasien dengan trauma di atas klavikula harus dianggap memiliki
cedera-tulang servikal sampai terbukti sebaliknya. pasien ini harus
mendapat imobilisasi tulang servikal sampai terbukti normal melalui
=- d pemeriksaan klinis dan radiologi.

:-iL
' Dapatkananamnesisyangakuratsebelum pemeriksaan, jika memungkinkan.
Mekanisme cedera seringkali akan membantu menemukan abnormalitas.

1: :dL ' Periksa dari ujung kepala sampai ujung kaki secara sistematis untuk
mencari tanda-tanda trauma. Bicara pada pasien untuk menenangkan
'.=lfa
-:US dan mencari lokasi cedera yang potensial seperti nyeri pada tangan
'I
dapat menunjukkan adanya cedera tidak stabil pada C6lC7.

--
nd
b ' Tulang servikal dapat diperiksa sementara diimobilisasi. palpasi leher
untuk melihat ada tidaknya spasme otot, nyeri tekan tulang di garis
_ - t- tengah, lekukan yang teraba dan krepitasi.
- 3Ud
-= lika ' Nilai sistem neurologis secara cermat dan catat temuan besefta waktu
temuan.
' cedera medulla spinalis yang komplit didefinisikan sebagai kehilangan
yang komplit dari fungsi motoris dan sensoris di bawah tingkat
cedera medulla spinalis. Jika gejala menetap >24 jam, kemungkinan
penyembuhan kecil. Syok spinal dapat menyerupai gejala ini, walaupun
s atau fungsi kembali <24 jam.
'faset
' cedera yang tidak komplit secara umum dapat dikelompokkan menjadi
tiga sindrom- cedera medulla spinalis sentral, sindroma Brown-sequard
dan cedera medulla spinalis anterior.

El(anan
Pemeriksaan radiologi
pktepi Cedera tulang servikal jarang terjadi pada pasien yang sadar (tidak
korpus dalam pengaruh alkohol atau obat) tanpa nyeri leher, nyeri tekan tulang,
stensi. defisit neurologis fokal atau cedera dengan nyeri yang mengganggu.
bluksasi Dapatkan proyeksi lateral, Ap dan open mouth peg view jika cedera
hltas - tulang servikal dicurigai:
0 Proyeksi lateral. Perika ABCS:
. A Alignmentand adequacy:Visualisasi mulai dari basis tengkorak
sa m pa i ke pe rbatasa n C7 lT.t. I n-line ar m tr a ction n cr oss tabl e
: Lateral d en ga

r ruptur
lateral atau swimmer's view dapat membantu memperlihatkan
42 Tulang Servikal

C7fl-t. Perhatikan kurva di anterior dan posterior vertebra serta


garis spino-laminar (lihat diagram). eada anak-anak, pseudo-

l
subluksasi C2 terhadap C3 dapat membingungkan. Pada kasus
seperti ini, perika garis spinolaminar dari Ct ke C3. Jika basis
dari processus spinosus terletak >2mm dari garis ini, cedera
harus dicurigai. Korelasikan dengan temuan jaringan lunak (lihat
bawah). Jarak antara arkus anterior Ct dengan odontoid harus
<3mm pada orang dewasa dan <5mm pada anak-anak.
. B Bone: Nilai bentuk dan densitas tulang. Peningkdtan densitas
dapat rnengindikasikan fraktur kompresi.
. C Cartiloge: Celah intervertebralis harus seragam. Pelebaran
celah ini atau jarak interspinosus dapat mengindikasikan
dislokasi yang tidak stabil. Peningkatan jarak interspinosus >5o%
mengesankan adanya disrupsi ligamentum. Spasme otot dapat
membuat interpretasi sulit.
. S Soft tissues: Pembengkakan jaringan lunak retro-faring
dapat menjadi satu-satunya tanda cedera. Ukuran yang normal
adalah kurang dari 7mm Cz-4 (setengah korpus vertebra pada
tingkat ini) dan kurang dari zzmm di bawah C5 (selebar
korpus vertebra). Udara dalam jaringan lunak mengesankan
ruptur esofagus atau trakea/bronkus. Penonjolan pre-vertebral
fat stripe merupakan tanda awal.
0 Proyeksi AP. Ujung dari processus spinosus harus terletak dalam
garis lurus di garis tengah. Processus spinosus bifida dapat
mempersulit interpretasi. Nilai jarak interspinosus untuk ruptur
ligamentum.
0 Open mouth view. Jarak antara odontoid dengan massa lateral
Ct harus simetris. Asimetris dapat disebabkan rotasi kepala. Pada
kasus-kasus tersebut batas lateral harus tetap segaris. Fraktur dapat
serupa dengan anomali kongenital dan non-fusion pada anak-anak.
Jaringan lunak, oksiput dan gigi juga dapat menyerupai fraktur
(usahakan untuk melacak garis yang dicurigai, apakah berjalan
Iebih jauh dari batas korteks tulang).
o Proyeki lain: Oblik dan proyeksi fleksi/ekstensi juga bermanfaat. Foto ar

a lngat jika fraktur ditemukan, ada kemungkinan terdapat abnormalitas 1. Fm


Iain.
2. sen
3. Den
CT: Digunakan untuk mengevaluasi lebih lanjut abnormalitas ketika foto 4. TUL
polos tidak adekuat. Secara teknis lebih superior dibandingkan dengan 5. Prq
foto polos dalam menilai fraktur, jaringan lunak dan kanalis spinalis. 6. tutq
7. itd
MRI: Digunakan untuk menilai jaringan luna( Iigamentum dan medulla 8. Serx
spinalis. 9. Pra
Radiologi Emergensi 43

s:fta
-:JUU-
)^
<3SUS
lasts
SCera
.,ihat
l a r'us

: s itas

5aran
,rikan
>>U/o
.apat

;: rin,,b
d
-
:mal
:ada
: ebar
::kan
:ebral

:alam
:3Dat
--:tu r

::eral
?ada
:apat
-= rak.
-:ktur
:ialan

Foto anteroposterior vertebra servikal normal


: a itas
1. Foramen magnum 10. Sendi uncovertebral
2. Sendi attantoakial 11 . Processus artikutaris yang tumpang tindih
3. Dens dari akis 12. Processus uncinatus
i ULU 4. Tutang okipitat 13. Pediket
.- gan 5. Processus tranwersalis 14. Processus transversalis
- a lis. 6. Arkus vertebra '15. Diskus intervertebratis
7- Massa latera[ dari C1 16. Processus transversus Tl
=dulla 8. Sendi atlantoakial 17. Trakea
9. Processus spinosus (bifid) 18. Costa 1
44 Tulang Servikal

10
13

14
12

15
17

19

Foto lateral vertebra seMkal normal


1.
2.
3.
4.
5.
6.
7.
Arkus anterior attas
Basis tengkorak
Processus odontoid
Arkus posterior atlas
tulandibula
Processus spinosus
Korpus dari akis (C2)
(C1 ) 11. Facies artikularis superior
12. Facies artikutaris inferior
13. End plote korpus vertebra superior
14. End plote korpus vertebra inferior
15. Sendi faset interveftebralis
16. Diskus intervertebralis
17. Lamina
t
8. Batas anterior superior 18. Pilar aftikular

I
korpus vertebra 19. Processus spinosus
9. Processus transveruus 20. Trakea
10. Batas anterior inferior
korpus vertebra
Radiologi Emergensi 45

11

12

t5
t7

19

Gambar ini memperlihatkan pentingnya visualisasi seturuh tutang servikat


sampai ke perbatasan serviko-torakal. Biloterol locked focet pada C6/C7.

Posisi swimmer untuk mempertihatkan vertebra servikat bawah


46 Tulang Servikal

Setalu nilai garis vertebra


anterior (A), posterior (P)
dan spinotaminar (SL).

Garis yang metalui


processus spinosus harus
lurus, demikian juga garis
batas di kedua tepi korpus
vertebra.
Radiologi Emergensi 47

Fraktur baji (kompresi) pada


c7

Fraktur teordrop pada C3.


Tulang Servikal

Fraktur cloy-shoveler pada processus spinosus C6.


Radiologi Emergensi 49

Fraktur Jefferson.

Fraktur Hangmon.
5o Tulang Servikal

A
Fraktur processus odontoid tipe 2.
Radiologi Emergensi 51

Bilateral [ocked facets.


Toraks
Radiologi Emergensi 53

raks

Gagat jantung dan edema paru 54


Efusi pteura 62
Kontusio Paru 73
Ruptur aorta dan aneurisma aorta 76
Fenyakit paru obstruktif kronik 80
AteleKasis 83
Ruptur/hemia diafragmatika 93
Flail chest 95
lnhatasi benda asing 97
Benda asing yang tertelan 99
Hemotoral<s 101
Ferforasi/ ruptur esofagus 103
Pneumonia 105
Pneumotorak 108
Fraktur costa/stemum 112
!{ I Toraks

Gagal, jantung dan edema Paru

KaraKeristik
.Gagaliantungterjadiketikajantunggagalmempertahankansirkulasi
yang
pada tekanan pengisian
yang adekuat untuk mensupiai oksgen
normal.
.Gagaljantungda.patdibagimenjadigagaljantungkanandangagal
iantung kiri.
.Gagaliantungkananmenyebabkanalirandarahkeparuberkurangdan
cagal iantung kirimenyebabkan
teriadi kongesti Oilrtingun lunak tubuh'
teriadi kongesti di paru'
aliran darah t<e sistem"'* berkurang dan
. Disebut juga sebagai gagal jantung kongestif (congestiv,e hea,rt failure)
"po#pl akumulasi cairan
karena k"g"g.r"n ;tnt'ng iktn t"ny"babkan
di Paru dan iaringan lunak tubuh'
. Penyebab gagal jantung antara lain:
0 PenYakit iantung koroner
0 HiPertensi
0 KardiomioPati
0 PenYakit katuP iantung
0 Aritmia
0 HiPertiroid
0 Anemia gravis
' 0 PenYakit iantung kongenital
satu
. Pemeriksaan radiollgi (foto polos toraks) merupakan salah
gagal secarzr
pemeriksaan penunlaig awal untuk mendeteksi iantung
pZmeriksaan kimiawi darah dengan mengukur
dini. Akhir-anrir ini
banyak digunakan untuk
kadar broin natriuretiZ peptide (BNP) mulai
mendeteksi gagal iantung secara dini'

Gambalan ktinis
. Sesak, lemah, batuk dan mengi'
. OrtoPnea' poroxysmal nocturnal dyspnoea'
. Sianosis, aritimia, nyeri dada, sinkop'
. HiPertensi atau riwayat angina atau infark
miokard'

. Edema, hepatomegali.
HiPoksia
'
. Bisa tidak disertai geiala.
Radiologi Emergensi 55

Gambaran radiologi
u Foto polos torak
. Gagal jantung kanan
0 Biasanya akibat penyakit paru kronik, seperti penyakit paru
obstruktif kronik (PPOK) atau tuberkulosis paru.
-rllasi 0 Terdapat kardiomegali dengan apeks yang terangkat akibat
- :nd hipertrofi ventrikel kanan.
0 Arteri pulmonalis juga membesar yang menyebabkan pinggang
-_ --t
jantung menonjol.
=J$dl 0 Efusi pleura dapat terjadi dengan cairan mengisi fissura oblik dan
horisontal. Hati-hati karena hal ini dapat dikelirukan sebagai massa
-i dan
pada foto polos toraks.
:
=5kan . Gagal jantung kiri

t;ilure) 0 Kardiomegali dengan apeks yang tertanam pada diafragma.

; calran
0 Gambaran radiologi di paru bertahap sesuai dengan tingkat
keparahan penyakit yang dapat dilihat dari pulmonary capillory
wedge pressure (PCWP). PCWP normal adalah 5-tommHg.
0 Tahap t : kranialisasi atau sefalisasi (PCWP to-t5mmHg).
o Terdapat diversi darah ke vena-vena di lobus superior dengan
penebalan vena-vena di lobus superior bilateral.
. Fenomena ini terjadi oleh karena dua mekanisme. Peftama
adalah akibat penurunan komplians pembuluh darah di basis
paru yang disebabkan edema pada dinding pembuluh darah
tersebut. Kedua adalah akibat mekanisme vasokonstriksi
pembuluh darah di basis paru akibat hipokia.
o Penebalan peribronkial terkadang sudah dapat terlihat di bagian
basis paru sebelum gambaran kranialisasi tampak.
ah satu 0 Tohap z : edema paru interstitial (PCWP zo-z5mmHg).
g secara . septa interlobular.
engukur \ ,Penebalan
Garis Kerley B yang biasanya terlihat pada basis paru (dekat
rn untuk
sulkus kostofrenikus) yang ketebalannya tidak lebih dari rmm
dan panjangnya i-2cm serta berialan horisontal.
, Garis Kerley B mulai terlihat pada PCWP r5-zommHg
r Penebalan septa ini jika berlangsung lama dapat mengalami
fibrosis dan menetap sehingga disebut garis Kerley B yang
kronis.
) Garis Kerley A merupakan distensi saluran anastomosis antara
saluran limfatik perifer dengan saluran limfatik sentral.
t Caris Kerley A (panjang dapat mencapai 6cm) tampak
berjalan oblik dari hili dan tidak mencapai bagian perifer
seperti halnya garis Kerley B.
> Garis Kerley C tampak sebagai garis retikular pada basis
paru yang merupakan garis Kerley B yang terlihat en foce.
r

o Penebalan peribronkial pada kedua hili.


> Tampak seperti doughnut-shaped rings yang rherupakan
penebalan dinding bronkus akibat cairan.
I Adanya cairan pada fissura.
> Cairan bisa terdapat antara dua lapisan pleura viseral yang
membentuk fissura (mayor, minor).
> Cairan juga bisa terdapat di rongga subpleura (di bawah
pleura viseralis, antara pleura viseralis dengan parenkim paru).
I Efusi pleura.
> Normalnya terdapat z-5 mL cairan di rongga pleura dan
cairan ini tidak terlihat pada foto polos toraks.
> Pada gagal jantung dengan PCWP sekitar 2ommHg, dapat
terjadi efusi pleura.
> Efusi pleura biasanya bersifat bilateral.
) Efusi pleura dapat asimetris, biasanya pada sisi kanan.
> Jika terjadiefusipleura kirimaka harus dipikirkan kemungkinan
penyakit lain seperti metastasis, tuberkulosis, penyakit paru
tromboemboli. \
Tahap j : edema paru alveolar (PCW\ >z5mmHg).
o Perbercakan di bagian z/3 medial paru yang memberikan
gambaran Bat's wing.
I Edema paru lebih dominan di lapang paru bawah.
. Walaupun edema paru alveolar merupakan kelainan di rongga
udara (air space disease), namun gambaran air bronchogram
jarang ditemukan oleh karena penumpukan cairan yang terjadi
pada edema paru alveolar bersifat difus sehingga bronkus
seringkali ikut terisi cairan.

Ekokordiogrofi
. Diagnosis yang lebih spesifik didapatkan dengan alat ini. Foto polos
torak digunakan untuk pemantauan dan jika teriadi deteriorasi yang
akut.

Gambaran radiologi edema paru non-kardiogenik


a Edema alveolar yang terjadi cenderung lebih ke perifer.
a Redistribusi ke lobus superior lebih jarang ditemukan.
a Dapat disebabkan oleh:
0 Kelebihan cairan
0 ARDS (Acute respiratory distress syndrome)
0 OAINS (obat anti-inflamasi non-steroid)
0 Penyakit intrakranial (edema paru neurogenik)
0 Tenggelam
Penyakit Iain seperti perdarahan paru, infeki atau penyakit granulomatosa
dapat menyerupai gambaran edema paru.
Radiologi Emergensi 57

1.:a

=^3

_L

: can

: lDat

:<inan
:-- paru

r erikan

rongga
ilogram
i teriadi
bronkus

r. Dolos
rasi yang

Gagal jantung kanan. Massa yang berbatas tegas tertihat di lapang tengah dan
bawah paru kanan. Pseudotumor ini menggambarkan cairan pteura yang tertetak
pada fisura horisontal dan fisura obtik (panah).

'tulomatosa
58

A
(panah)'
Gambar mempertihatkan kraniatisasi/sefatisasi

pada basis paru'


Gambar mempertihatkan garis Kerley B (panah)
Radiologi Emergensi

Garnbar yang memperlihatkan garis Kerley A, B, dan C. Garis Kerley A


dipertihatkan oleh panah putih. Garis Kerley B dipertihatkan oteh matjpanah
putih. Garis Kerley C dipertihatkan oleh mata panah hitam.
Toraks

Gambar sebetah kiri mempertihatkan penebatan peribronkia[ yang menyerupai


donat (panah). Gambar sebetah kanan mempertihatkan penebatan fisura minor
(panah).

Edema paru interstitiat.


Radiologi Emergensi 6t

_l

Edema paru alveotar yang memberikan gambaran Bat's wing.


Cril
Efusi pLeuna FE
ol
1

Karakteristik a

e Merupakan akumulasi cairan di dalam rongga pleura'


I

. cairan diproduksi di pleura parietal dari pembuluh kapiler paru


dan a

diabsorbsi oleh pleura viseral serta oleh pembuluh limfatik di pleura


parietal.
. Efusi pleura dapat disebabkan oleh:
0 Peningkatan Produksi
. peningkatan tekanan hidrostati( seperti pada gagal iantung kiri'
. penurunan tekanan onkotik, seperti pada hipoproteinemia.
. Peningkatan permeabilitas kapiler, seperti pada pneumonia
atau reaksi hiPersensitivitas'
0 Penurunan resorbsi
. penurunan absorbsi saluran limfatik baik oleh karena sumbatan
(tumor) atau karena peningkatan tekanan vena yang menurunkan
transportasi cairan melalui duktus torasikus'
o Penurunan tekanan di rongga pleura, seperti pada atelektasis
akibat sumbatan bronkus.
. Efusi pleura juga dapat berasal dari perpindahan cairan
peritoneum
melalui diafragma atau melalui saluran limfatik
dari rongga ab-domen
dari proses di subdiafragma.
. Efusi pleura dapat dibagi meniadi transudat atau eksudat berdasarkan
kandungan Protein.
0 Transudat (protein < 3gr/dL) - biasanya bilateral akibat peningkatan
tekanan hidrostatik (gagal iantung atau gagal ginial) atau akibat
penurunan tekanan ont otit (sindroma nefrotik atau sirosis hepatis).
0Eksudat(protein>3grldL)-biasanyaakibatpeningkatan
permeabilitas kapiler (infeksi, empiema, keganasan, darah, kelainan
iaringan kolagen dan pankreatitis).

Gambaran klinis
. Dapat asimPtomatik
. Sesak
. Batuk yang dapat disertai dahak atau darah (hemoptisis)
. Nyeri dada
. Edema generalisat
. Penurunan berat badan dan maloise
. Gejala yang berhubungan dengan penyakit sistemik yang mendasari,
seperti artritis rematoid, pankreatitis, atau gagal ginial kronik'
' Hipoksia
. Penurunan suara pernafasan pada saat auskultasi dan redup saat
diperkusi
Radiologi Emergensi 63

Gambaran radiologi
Foto polos torak \
. Diperlukan volume cathn sejumlah t3oom! agar efusi pleura dapat
terlihat pada foto torak tegak.
o Foto lateral dapat mendeteksi efusi pleura sejumlah t75mL dan foto
lateral dekubitus dapat mendeteki cairan sebanyak r5-zoml.
. Foto lateral dekubitus selain untuk mendeteksi efusi yang minimal
juga berguna untuk:
0 Penentuan apakah efusi dapat mengalir secara bebas atau tidak. Hal
penting untuk diketahui sebelum dilakukan aspirasi cairan pleura.
0 Melihat bagian paru yang sebelumnya tertutup cairan sehingga
kelainan yang sebelumnya terselubung dapat terlihat.
. Efusi pleura memiliki gambaran yang bervariasi antara lain:
0 Efusi subpulmonal
o Hampir semua efusi awalnya terkumpul di bawah paru antara
'l pleura parietal yang melapisi liafragma dengan pleura viseralis
't
lobus inferior.
r Gambaran diafragma bukan merupakan diafragma yang
sebenarnya, melainkan cairan pleura yang terkumpul di atas
diafragma.
-l
. Menggesertitiktertinggi diafragma (bukan diafragma sebenarnya)
k ke arah lateral.
o Pada efusi pleura subpulmonal kiri terdapat peningkatan jarak
antara udara lambung dengan udara di paru.
o Pada foto lateral biasanya terdapat penumpulan sulkus
n
kostofrenikus posterior.
rt
0 Penumpulan sulkus kostofrenikus
).
n
o Sulkus kostofrenikus posterior (foto lateral) menjadi tumpul
n terlebih dahulu, kemudian diikuti sulkus kostofrenikus lateral
(foto torak tegak).
o Penebalan pleura juga dapat menyebabkan penumpulan sulkus
kostofrenikus, namun penebalan pleura biasanya berbentuk ski-
slope (lereng untuk ski) dan tidak akan berubah jika terdapat
perubahan posisi pasien.
0 Tanda meniskus
o Tanda ini sangat sugestif akan adanya efusi pleura.
o Akibat sifat paru yang elastis, maka cairan pleura lebih tinggi
di bagian tepi.
0 Perselubungan pada hemitoraks
o Teriadi ketika rongga pleura mengandung zL cairan pada
orang dewasa.
lt
6+ Toraks

r Paru akan kolaps secara pasif.


o Efusi paru yang besar ini akan mendorong jantung dan trakea
menjauhi sisi yang terkena efusi.
r Pemerikaan CT diperlukan untuk melihat keadaan paru yang
terselubung.
0 Efusi yang terlokalisir
. Terjadi akibat adhesi antara pleura viseral dengan pleura parietal.
o Adhesi lebih umum terjadi pada hemotorak dan empiema.
o Memiliki bentuk dan posisi yang tidak lazim (tetap di bagiah
apeks paru pada foto tegak).
0 Pseudotumor fisura
o Disebut iuga vanishing tumor.
o Merupakan koleksi cairan pleura yang berbatas tegas dan
terletak di fisura atau subpleura di bawah fisura.
r Bersifat transudat dan hampir selalu terjadi pada pasien dengan
gagal jantung.
r Gambarannya khas dan tidak boleh dianggap sebagai tumor.
o Berbentuk lentikular dan memiliki ujung yang runcing pada
kedua sisinya (seperti buah lemon).
. Biasanya pada fisura minor (75%).
I Tidak berubah dengan perubahan posisi pasien.
o Menghilang ketika gagal jantung diterapi dan cenderung muncul
di tempat yang sama ketika teriadi gagal iantung kembali.
0 Efusi Iaminar
o Bentuk efusi pleura yang menyerupai pita tipis di sepanjang
dinding lateral torak, terutama di dekat sulkus kostofrenikus.
r Sulkus kostofrenikus cenderung tetap taiam.
I Biasanya akibat gagal jantung atau penyebaran limfatik dari
suatu keganasan.
I Tidak bergerak bebas sesuai posisi pasien.
0 Hidropneumotoraks
o Terjadi jika terdapat pneumotoraks dan efusi pleura secara
bersamaan.
o Biasanya akibat trauma, pembedahan, atau fistula bronkopleura.
o Ditandai oleh air-fluid level di hemitorak.
. Batasnya tidak berbentuk meniskus, melainkan berupa garis Iurus.
Sisi yang terkena pada efusi pleura dapat memberikan petuniuk
mengenai penyebab efusi
0 Bilateral
o Cagal jantung
o Lupus eritematosus
Radiologi Emergensi 6S

0 Satu sisi, bisa sisi kiri ataupun kanan


I Tuberkulosis
. Penyakit tromboemboli paru
. Trauma
0 Sisi kiri
. Pankreatitis
o Dressler's syndrome
o Obstruki duktus torasikus distal
0 S.isi kanan
c Mei{s syndrome
I Artritis rematoid
o Obstruki duktus torasikus prokimal
Ultrosonqrafi
r Untuk konfirmasi ukuran cairan pleura.
. Berguna untuk identifikasi lokulasi.

CT
. Dapat mengidentifikasi efusi yang minimal, penyebab efusi dan adanya
penebalan pleura.

s
66 Toraks

Ea

hitam). Bayangan yang tampak seperti diafragma berubah konturnya (panah


kosong hitam) ketika berbatasan dengan fisura mayor.

Gambar kiri mempertihatkan sulkus kostofrenikus normal yang tajam (panah


kosong hitam) dan jaringan paru normal yang meluas sampai ke iga (panah hitam).
Gambar kanan memperlihatkan sulkus kostofrenikus yang tumpul (panah kosong
putih).
7

Penebalan pteura yang menyerupai efusi pteura. Penebalan pleura


memitiki gambaran ski -sloPe.
I

Radiologi emergensi I 69

Tanda meniskus pada efusi pleura


Toraks

Persetubungan hemitoraks
akibat efusi pteura yang
mendorong trakea dan
jantung ke kiri.

Efusi pteura yang tertokalisir.


Radiologi Emergensi 71

A
Pseudotumor atau vanishing tumour yang berbentuk seperti buah temon

Gambar kiri merupakan foto normal dimana jaringan paru metuas sampai
ke tepi
iga (panah kosong hitam), sedangkan gambar kanan mempertihatkan eiusi taminar
(panah kosong putih) dengan sutkus kostofrenikus yang masih tajam (panah
hitam).
1') Toraks

Kc

Kn
a

Cat
a

Hidropneumotoraks. Batas
udara dengan cairan
berbentuk garis Iurus.

Cra

Pengaruh posisi pada gambaran efusi pteura. Gambar kiri merupakan foto
yang diambit pada posisi tegak, sedangkan foto sebelah kanan diambi[ pada
posisi berbaring. Pada posisi berbaring, efusi pleura memberikan gambaran
persetubungan haIus.
Radiologi Emergensi 73

Kontusio Paru

Karakteristik
a Komplikasi tersering dari trauma tumpul torak.
a Merupakan perdarahan di intra-alveolar dan interstitial, biasanya pada
lokasi benturan.
a Dapat disertai edema dan mikroatelektasis.
a Kelainan ini lebih sering ditemukan pada pasien usia muda, oleh
karena dinding torak lebih komplians sehingga lebih banyak kekuatan
impaki yang dihantarkan pada jaringan paru.

Gambaran klinis
Riwayat trauma merupakan informasi yang sangat penting oleh karena
gambaran kontusio paru sulit dibedakan dengan penyakit oirspace lain
(pneumonia, aspirasi).
a Sesak nafas.
a Demam ringan.
a Hemoptisis.

Gambaran radiologi
. Perbercakan cenderung terdapat di bagian perifer dan terletak pada
titik dengan benturan yang maksimal.
. Air bronchogram biasanya tidak terdapat oleh karena darah selain
mengisi alveoli juga mengisi bronki.
. Biasanya muncul 6 jam setelah trauma dan karena darah cepat
diabsorbsi, maka gambaran tersebut akan menghilang dalam 7z jam.
. Jika gambaran menetap lebih dari 7z jam, maka kelainan lain harus
dicurigai (pneumonia aspirasi atau laserasi paru).
. Laserasi paru sulit didiagnosis pada beberapa hari pertama karena
tertutup gambaran kontusio paru
. Laserasi paru memiliki gambaran:
0 Massa ovoid jika terisi darah secara sempuma.
0 Air fluid level jika terisi sebagian oleh udara dan sebagian oleh
darah.
0 Seperti kista jika terisi seluruhnya oleh udara.
. Gambaran laserasi paru memerlukan waktu berminggu-minggu atau
berbulan-bulan untuk bersih sempuma.
Kontusio paru memberikan gambaran air'sPoce diseose'
memperti
Laserasi paru. Gambar atas gah paru kanan
Gam
beserta fragmen-fragmen peturu. yang diambit 72
jam berikutnya yangmemperlihatkan adanya taserasi
paru.
76 Toraks

Ruptur aorta dan aneurisma Aneu


rI
aorta ol
fi

oA

Karakteristik CTfi
. Sekitar 8o-9o% pasien meninggal sebelum tiba di rumah sakit. Rupflr
r!
' Berhubungan dengan tedera perlarnbatan, seperti jatuh dari ketinggian
d
atau kecelakaan lalu lintas dengan kecepatan di atas 64 km/jam.
o Aofta biasanya ruptur pada daerah istmus (88-95%), sedikit distal dari tueri
awal arteri subklavia kiri. ofi
o Aneurisma aofta merupakan faktor predisposisi terhadap terjadinya d:
ruptur aofta. o l"l
. Aneurisma didefinisikan sebagai pembesaran pembuluh darah lebih oP1
dan 5o% ukuran normal
ut
. Penyebab aneurisma antara lain atherosklerosis, hipertensi, sindroma
Marfan, dan sindroma Ehlers-Danlos.

Gambaran klinis
. Ruptur aorta harus dicurigai dari mekanisme cedera.
. Nyeri dada atau inter-skapula
' Perbedaan tekanan darah brakial atau perbedaan isi nadi brakial dan
femoral merupakan pertanda. i

' Aneurisma aorta biasanya tidak memiliki gejala, walaupun jika besar
dapat memberikan gejala nyeri yang menjalar ke punggung (aneurisma
aorta desenden).

Gambaran radiologi
Foto polos torak
Ruptur aorta memberikan gambaran:
. Mediastinum yang melebar (>8cm pada proyeksi Ap dengan posisi
berbaring).
o Batas aorta yang kabur dengan hilangnya dortic knob.
. Pleural cap di apek kiri.
. Hemotorak sebelah kiri.
. Bronkus kanan yang naik atau bronkus kiri yang turun.
. Deviasi trakea ke kanan.
. Selang nasogastrik yang terdorong ke kanan.
Radiologi Emergensi 77

Aneurisma aorta memberikan gambaran:.


. Bayangan aorta ascenden lebih kanan dari batas jantung kanan pada
foto polos toraks yang diambil secara simetris.
. Aortic knob lebih besar dari 35mm dari pinggir trakea
. Aofta descenden menjauh dari vertebra torakalis.

CT torok
Ruptur aorta
. Disrupsi dinding pembuluh darah atau darah ektra-luminal yang sejalan
ggran
dengan aorta adalah indikasi adanya ruptur.
n.
ri dari Aneurisma aorta
. Aneurisma aorta didefinisikan sebagai ukuran diameter yang lebih
d inya dari 4cm.
. Ukuran aofta 5-6cm memiliki risiko tinggi untuk ruptur.
lebih . Pembesaran aneurisma yang >rcm / tahun juga memiliki risiko tinggi
untuk ruptur.
l:oma

dan

D ESAT
nsma ?
a

posisi
78 Toraks

A
Ruptur aorta traumatik: deviasi trakea ke kanan, bronkus utama kanan yang
terdepresi; hemotoraks kiri, batas arkus aorta yang tidak jelas dan pleurol opical
cap kiri. Fraktur costa dan hernia diafragmatika traumatik kiri juga at ditihat.
Radiologi Emergensi 79

Cara mengukur aortic knob. Jarak normal dari tepi trakea (panah kosong
hitam) ke aortic knob (panah putih) adatah kurang dari 35mm.

, 'H
Fa6d

A
Aneurisma aorta yang ditandai dengan aorta ascenden yang lebih kanan
dari batas jantung kanan (panah putih), oortic knob yang membesar, dan
aorta descenden yang tertetak jauh dari vertebra torakalis (panah kosong
hitam).
8o Toraks

Penyakit paru obstruktif kronik

Karakteristik
. Penyakit paru obstruktif kronik (PPOK) didefinisikan sebagai keterbatasan
aliran udara yang tidak reversibel secara sempuma. Keterbatasan aliran
udara bersifat progresif dan berasosiasi dengan respon peradangan
abnormal paru terhadap partikel atau gas yang berbahaya. c'a
. Definisi terdahulu dari PPOK mencakup istilah bronkitis kronis dan
emfisema
. Bronkitis kronik merupakan diagnosis klinis yaitu adanya batuk dan
produksi sputum paling sedikit selama 3 bulan dalam setahun untuk
z tahun berurutan.
. Emfisema merupakan istilah patologi untuk menggambarkan adanya
dilatasi yang kronik dan ireversibel pada rongga udara distal dari
bronkiolus terminalis akibat kerusakan dindingnya.
. Etiologi: roko( asma kronik, defisiensi G1-antitripsin dan infeksi kronik.
. Pemerikaan radiologi dapat membantu diagnosis PPOK, namun PPOK
harus dikonfirmasi dengan pemerikaan spirometri.

Gambaran klinis
. Eksaserbasi umumnya dicetuskan oleh infeksi.
. Batuk, dispnea, takipnea, mengi, dan lip pursing (usaha untuk
meningkatkan positive end expiratory pressure (PEEP) dan penggunaan
otot-otot pemafasan tambahan. \

. Sianosis, pletora, dan tanda-tanda gagal jantung jika sudah berat.


. Tanda-tanda hiperkarbia yang meliputi tremor kasar, pulsasi yang besar,
vasodilatasi perifer, mengantu( bingung, dan penurunan kesadaran.
. Manifestasi PPOK secara klasik dibagi menjadi dua:
0 Pink puffer: Pasien biasanya kurus dan tidak sianosis (pink).
Pasien tampak terengah-engah (puffer). Manifestasi ini muncul jika
kelainan emfisema lebih dominan. Oleh karena kelainan emfisema
. Iebih dominan, maka pasien akan melakukan kompensasi dengan
hiperventilasi dan penurunan curah jantung agar rasio ventilasi
dengan perfusi menjadi seimbang (VlQ ratio). Hiperventilasi
menyebabkan pasien tampak terengah-engah dan penurunan
curah jantung menyebabkan pasien kurus.
:asan
a iran
rgan
Gambaran radiologi
dan o Foto polos torak tidak terlalu sensitif (40-60%), sangat spesifik.
0 Metode yang mudah diperoreh daram menirai luas dan derajat
i dan kerusakan struktur parenkim.
ntuk
i.l
0 Pada keadaan emergensi, foto konvensional bermanfaat untuk
menilai komplikasi sepefti pneumonia, gagal jantung,,atelektasis,
Janya pneumotoraks atau fraktur costa.
I dari 0 Gambaran radiografik mencakup paru yang hiperekpansi dengan
pendataran kedua diafragma, penurunan corakan bronkovaskular,
-'onik. barrel-shoped chest dan bulla.
PPOK

u ntuk
unaan

"t.
besar,
laran.

pink).
:ul lika
fisema
engan
rntilasi
ntilasi
runan
Paru mengatami hiPerlnflai
dengan Pendataran kedua
diafragma

Barrel-shoPed chest'
Peningkatan rongga udara
retrosterna[. Perhatikan
diafragma Yang mendatar.
Radiologi Emergensi 83

Atetektasis

Karakteristik
o Atelektasis merupakan kehilangan volume disebagian atau seluruh paru.
. Atelektasis disebut juga kolaps paru.
. Penyebab atelektasis dapat dibagi menjadi:
0 Relaksasi/kompresi/pasif
o Ekspansi paru dihambat oleh pneumotorak atau efusi pleura
0 Absorbsi/obstruktif/resorbsi
o Akibat oklusi lumen bronkus yang diikuti oleh absorbsi udara
di jaringan paru bagian distal dari obstruksi.
I Obstruksi dapat disebabkan oleh tumor, sumbatan mukus,
benda asing, peradangan bronkus atau kompresi ekstrinsik
(pembesaran kelenjar getah bening)
0 Adesif
I Surfaktan berfungsi untuk menurunkan tegangan permukaan
alveoli.
r Pada kelainan yang mengganggu fungsi surfaktan tersebut,
kolaps dari alveoli dapat terjadi, sepefti pada kasus-kasus dcute
respiratory distress syndrome (ARDS) dan hyaline membrane
disease (HMD).
0 Sikatrildkontraksi
o Teriadi ketika proses fibrosis pada paru atau pleura menghambat
ekspansi paru.
o Atelektasis kecuali yang disebabkan sikatri( biasanya bersifat reversibel.

Gambaran klinis
. Sesak
. Batuk
. Hemoptisis
o, Asimptomatis
. Cejala yang berhubungan dengan penyakit yang mendasari (penurunan
berat badan, kahekia, anorekia dan keringat malam).
8+ Toraks

Gambaran radiologi
. Secara umum tanda-tanda atelektasis dapat dibagi menjadi:
0 Tanda langsung:
I Perubahan letak fisura interlobaris.
o Penambahan opasitas (penurunan aerasi)
I Corakan bronkovaskular yang bertambah
0 Tanda tidak langsung:
r Elevasi diafragma
I Pergeseran mediastinum
o Pergeseran trakea
. Pergeseran letak hilus
. Hiperaerasi kompensasi dari paru yang normal +
. Penyempitan sela iga
. Atelektasis juga memiliki gambaran khas tersendiri berdasarkan jenis
atelektasis.
0 Atelektasis subsegmental (diskoidlplatdike)
Pada pasien yang kurang aktif seperti pasca operasi dan pasien
dengan nyeri pleuritik.
I Berhubungan dengan gangguan fungsi surfaktan.
I Gambaran linear dengan berbagai ketebalan yang biasanya
paralel dengan diafragma
o Terlihat paling sering pada bagian basis paru.
o Tidak mengakibatkan penurunan volume yang cukup besar
untuk menyebabkan pergeseran struktur-struktur di rongga dada.
0 Kompresif
. Terdapat gambaran pneumotorak atau efusi pleura yang tidak
menyebabkan pendorongan struktur di rongga dada.
0 Atelektasis bundar (round)
o Dapat dianggap sebagai tumor pada foto polos torak.
o Tampak sebagai massa homogen yang dapat berukuran sampai
5cm dengan batas yang tidak tegas.
r Pemerikaan CT bersifat diagnostik
o Pada pemerikaan CT, kelainan ini selalu berbasis di pleura dan
terdapat gambaran vaskular yang beradiasi seperti ekor komet.
. Selain itu, pola atelektasis di tiap lobus juga berbeda-beda.
Radiologi Emergensi

IS

5ar
Ca.

lak

lan

Atelektasis lobus superior kanan. Peningkatan opasitas (panah kosong hitam)


terdapat pada lobus superior kanan.Fisura minor (panah putih) tertarik ke atas.
Trakea (panah hitam) deviasi ke kanan.
86 I roraks
Radiologi Emergensi 8l

Atetektasis tobus inferior kanan. tampai densitas berbentuk kipas yang dibatasi
pada bagian superior oteh fisura mayor (panah kosong putih). Opasitas membentuk
silhouettes sign dengan diafragma (panah kosong hitam).

i=

UIJ;rytf--
Toraks

^. persetubungan di tapang atas paru kiri


Atetektasis lobus superior kiri. Terdapat
#;;;'ii;ittt kiri lpanah h-itam)' Fisura mavor tertarik
(panah kosong hitam) dan
ke anterior (Panah Putih)'
Radiologi Emergensi

Atelektasis [obus inferior kiri. risurimayor tertarik ke posterior


(panah
hitam).
Atetektasis subsegmental. Ierdapat densitas berbentuk garis yang paralel
dengan diafragma (panah kosong hitam)'

pteura' Tidak terdapat deviasi trakea


Atetektasis kompresif (pasif) akibat efusi peningkatan votume
(panah hitam) atau lantung 6inan kosong hitam)karena
pteura dixoripensasi oteh plnurunan votume dari atetektasis'
akibat efusi
Radiologi Emergensi

$ e*euret apae+
d* Psi*sbi deura
Proses terjadinya atetektasis bundar. Reaki inflamasi pteura menyebabkan
penyatuan pleura yang disertai dengan penebalan pleura yang progresif. Hat ini
mengakibatkan kompresi jaringan paru serta oktusi bronkus yang menyebabkan
sebagian paru menjadi kolaps.

Atetektasis bundar pada pasien dengan riwayat pajanan asbes. pada pemeriksaan
Cl tampak massa bundar dengan bronkovaskutar yang mengarah ke hitus
memberikan gambaran ekor komet.
92

I
t

kanan (panah putih)


Gotden s sign merupakan atetektasis lobus superior
(panah kosong
yang disertai massa yang menyebabkan.atetektasis tersebut
Radiologi Emergensi 93

Ruptu r I hernia diafragmatika

lGrakteristik
. Berasal dari trauma tumpul atau trauma penetrasi ke dada/perut.
. Sulit didiagnosis. Komplikasi seringkalitimbul akibat herniasi isi abdomen
ke rongga torak. Hemiasi viseral dapat menyebabkan iskemia, obstruki
dan perforasi. Kompresi/kolaps paru dapat signifikan.
. Lebih sering melibatkan sisi kiri karena hati diduga melindungi diafragma
kanan.
. Robekan posteroJateral radialmerupakan yang paling umum ditemukan
pada trauma tumpul.

Gambaran klinis
. Pada keadaan akut, gambaran cenderung tertutup oleh cedera lain.
. Pemeriksaan dapat memperlihatkan takipnea, hipotensi, hilangnya
suara pemafasan yang diganti dengan bising usus di rongga toraks.
o Dengan berjalannya waktu (bulan sampai tahun), gejala seringkali
samar-samar dengan rasa tidak enak di perut.
. Geiala dapat menyerupai ulkus peptikum, penyakit kandung empedu,
sindrom usus disfungsional dan bahkan penyakit iantung iskemik.
. Pada keadaan yang jarang, pasien dapat datang dengan tension
viscero-thorax yang menyerupai tension pneumothorax.
. Curiga pada pasien dengan obstruksi akut atau tanda-tanda yang tidak
biasa di torak dengan riwayat trauma torako-abdominal sebelumnya.

Gambaran radiologi
. Pada fase akut, kecuali jika terdapat hemiasi viseral, sensitivitas kurang
baik untuk semua jenis modalitas pencitraan.
. Foto polos toraks:
0 Organ abdomen yang terisi udara atau yang terlihat solid,
tampak di atas diafragma. Hal ini mungkin hanya dikenali setelah
pemasangan selang nasogastrik
0 Gambaran lain meliputi Pergeseran mediastinum meniauh dari
sisi yang terkena, elevasi diafragma, penebalan pleura unilateral
atau atelektasis.
. Pada keadaan tidak akut pemeriksaan dengan kontras dapat membantu.
a\ ..,
. .-.1

Presentasi tanjut dari suatu ruptur diafiagmatika. Panah menunjukkan


usus yang herniasi melalui defek di diafragma kiri.
Radiologi Emergensi 95

Flail chest

lGrakteristik
a Teriadi ketika terdapat hilangnya kontinuitas suatu segmen dinding dada.
a Biasanya akibat trauma dengan dua atau lebih fraktur costa pada
dua atau lebih tempat.
Mengakibatkan disrupsipergerakan dinding dada dan gerakan paradokal
dapat terlihat.
a Selalu pikirkan adanya cedera paru di bawahnya (kontusio paru).
a Kombinasi nyeri, gemkan dinding dada yang menurun atau paradokal,
dan kontusio paru berkontribusi pada hipokia yang dialami pasien.

@mbaran klinis
. Dispnea
o Takikardia
. Sianosis
. Takipnea
. Hipotensi
o Memar pada dinding dada t gerakan abnormal yang terpalpasi atau
krepitasi
. Derajat hipoksia seringkali bergantung pada keparahan kontusio paru
yang menyertai.

Gambaran radiologi
. Fraktur costa multipel.
o Pemisahan costokondral mungkin tidak terlihat.
. Perbercakan opak dapat terlihat dengan adanya kontusio paru (seringkali
tidak ada pada foto awal).
Toraks

I Floil chest kanan.

Flail chest kiri.


Radiologi Emergensi 97

lnhatasi benda asing

KanKeristik
. Biasanya pada anak-anak.
. Merupakan keadaan emergensi karena benda tersebut dapat menyebabkan
obstruki jalan nafas total.

Gambaran klinis
Spektrum luas mulai dari yang berat jika terdapat obstruksi total
(distress, agitasi dan tersedak yang mengarah ke penurunan kesadaran
sampai kematian) atau yang ringan (asimptomatis atau batuk-batuk
ringan saja).
Auskultasi rongga dada bisa normal. Mengi monofonik karakteristik
untuk obstruki saluran pernafasan besar. Waspada terhadap hilangnya
suara pemafasan yang lokal.

Gambaran radiologi
. Benda asing yang radio-opak dapat terlihat atau tidak terlihat.
. Cari tanda-tanda sekunder seperti penurunan volume, kolaps segmental,
konsolidasi atau hiperinflasi jika benda asing berperan seperti katup.
Be

Kar
a

Cal
a

Ga
a

Efek batl valve akibat inhatasi benda asing. Air tropping tampak lebih a
jetas pada Pemeriksaan ekPirasi.
Radiologi Emergensi 99

Benda asing Yang tertetan

Karakteristik
.Bendaasingyangtertelancenderunguntuktersangkutpadalokasi
krikofaringeus,
penyempitan anafomis. lni adalah pada lokasi setinggi
setinggi.arkusaortadanbronkusutamakiri,sertapadaperbatasan
gastroesofageal.
. pada anak-anak, krikofaringeus merupakan tempat yang paling sering
cenderung
untuk teriadi impaksi. setJah melewati bagian ini, benda
turuntanPahalangan'lmpaksidistaldarilokasiiniharusdicurigai
adanya penyempitan yang Patologis seperti striktur'
. Pada orang dewasa, penelanan benda asing bisa
teiadi sengaia,
-secara
kecelakaan- (tulang ikan atau ayam) atau sebagai
akibat Penurunan
refleks tersedak.
. asing, nekrosis
Komplikasi berasal dari trauma langsung oleh benda
akibat penekanan atau saat pengangkatan'

Gambamn ktinis
r Perasaan adanya benda asing.
. Manifestasi yang sesuai dengan komplikasi, e.g. perforasi
esofagus.

Gambann radiologi
. Radiografi jaringan lunak leher proyeksi lateral dapat memperlihatkan
benda asing Yang radio-oPak'
. Bengkak jaringan lunak dapat merupakan satu-satunya
indikator adanya
benda asing Yang radiolusen.
.Kontrasyanglarutairdapatmemperlihatkanbendaasingintralumen
atau menggambarkan komPlikasi'
a
Tulang ikan (panah) yang
tersangkut di hipofaring a
anterior dari C6.

T,' AP ERer
G
F*fiTEEl F
a

G
a

Koin metal yang tertelan


terdapat di mediastinum
supenor.
Radiologi Emergensi 101

Hemotoraks

KaraKeristik
. Akumulasi darah dalam rongga pleura setelah trauma tumpul atau
penetrasi.
o Biasanya berasosiasi dengan pneumotorak dan cedera ekstratorakal lain.
. Perdarahan biasanya lebih sering berasal dari parenkima paru, dan
seringkali sembuh sendiri.
. Pembuluh darah interkosta dan mamaria intema lebih sering terkena
daripada pembuluh darah hilus atau pembuluh darah besar.

Gambaran klinis
. Bergantung pada jumlah kehilangan dar,ah.
. Berbagai derajat syok hipovolemik.
. Suara pemafasan - berkurang atau hilang dan/atau redup pada perkusi.

Gambaran radiologi
a Foto torak tegak lebih sensitif dibandingkan foto berbaring.
a Penumpulan sudut kostofrenikus-terlihat pada volume darah tz5occ.
a Opasifikasi yang menyeluruh pada hemitoraks terlihat pada foto
berbaring.
102 Toraks

G
a

A
Opasifikasi hemitoraks kiri akibat hemotoraks.

tllc
a
Radiologi Emergensi I lOl

Perforasi / ruptur esofagus


Karakteristik
o Secara klasi( kasus ditemukan setelah muntah-muntah hebat (Boerhoave
syndrome).
. Penyebab yang lebih umum meliputi - trauma iatrogenik, trauma
tumpul/penetrasi, cedera kimiawi, per.forasi akibat benda asing, ruptur
spontan dan kerusakan pasca-operasi.
. Esofagus tidak memiliki penutup serosa, maka perforasi langsung
menembus ke mediastinum.
. Perforasi esofagus bagian atas/servikal berhubungan dengan retrofaring.
. Perforasi esofagus bagian bawah/tengah cenderung masuk langsung
ke mediastinum.
0 Reaki peradangan menyebabkan kontaminasi rongga pleura. Hal
ini difasilitasi oleh tekanan negatif pleura.
Gambaran klinis
. Nyeri retrosternal umum. Hal ini diperparah dengan menelan atau
gerakan menunduk. Radiasi ke regio inter-skapula. Nyeri biasanya
progresif dan dapat terlokalisir seiring waktu.
. Tanda-tanda jarang, biasanya lambat muncul, dan berhubungan
dengan udara di mediastinum dan kontaminasi pleura. Tanda-tanda ini
mencakup emfisema subkutan dan suara gemerisik pada auskulatasi
jantung yang dikenal dengan Homman,s.crunch.
o Tanda lain yang sekunder akibat hidrotoraks atau empiema dapat

o Pneumomediastinum spontan dapat menyerupai rupturesofagus, namun


ini cenderung terjadi pada kelompok usia yang muda dan seringkali
setelah manuver valsalva yang ekstrim.
. Seiring dengan proses inflamasi yang terus berlangsung, kondisi
pasien akan terus menurun dengan tanda-tanda sepsis dan kolaps
kardiopulmonal.

Gambaran radiologi
r Foto polos toraks: Tanda-tanda klasik adalah emfisema subkutan,
pneumomediastinum, efusi pleura kiri, hidropneumotoraks dan pelebaran
mediastinum.
. Tulang servikal: Proyeksi lateral dapat memperlihatkan udara retrofaring.
r Efusi pleura, infiltrat pulmonal dan true mediostinal air-fluid level
biasanya tidak terlihat pada pneumomediastinum spontan.
. Pemeriksaan dengan kontras yang larut air bermanfaat untuk
menggambarkan perforasi. Jika tidak terdapat perforasi, borium meol
akan memperlihatkan detil mukosa yang lebih baik. pemeriksaan ini
dapat diulang.
104 Toraks

G
a

Ruptur esofagus. Udara tertihat membatasi sisi kanan mediastinum


(mata panah).

Ga
Dap
a

lni merupakan gambaran inversi dari kontras tarut air yang diminum. a
Gambar ini memperlihatkan kebocoran kontras (panah) dari .l/3 distat a
esofagus.
a

a
Radiologi Emergensi 105

Pneumonia
Karakteristik
. lnsidensi sedang meningkat - akibat populasi yang semakin tua dan
peningkatan prevalensi imunosupresi.
. Tipe:
0 Community acquired: Streptococcus (>6o%), Haemophilus, Mycoplasmo,
- Legionello dan Chlamydio. Secara umum mortalitas rendah kecuali
pada pasien yang memerlukan perawatan.
0 Hospital acquired: lnfeksi bakteri gram negatif. Mortalitas lebih
tinggi dibandingkan dengan community acquired pneumonia. Faktor
ko-morbid juga penting.
. Virulensi dan jumlah organisme, faktor host, dan pemberian terapi
dini berkontribusi pada hasil akhir.
e Pneumonia harus selalu dipikirkan pada orang tua, orang dengan
imunodefisiensi dan orang demam dengan penyebab yang tidak diketahui.

Gambaran klinis
. Batuk produktif, dispnea, nyeri pleuritik, mialgia dan hemoptisis dapat
terjadi.
. Pada pasien dengan imunosupresi, Pneumocystis bisa terjadi dengan
hipoksia berat.
. Pasien muda biasanya datang dengan gejala yang samar-samar seperti
nyeri kepala, nyeri abdomen, atau bahkan diare. Konfusi mungkin
merupakan satu-satunya gejala pada orang tua.
. Pada pemerikaan dapat ditemukan krepitasi inspirasi yang kasar. Nafas
bronkial dengan perkusi yang redup terdapat pada <25%.
. Peftanda prognosis yang buruk mencakup - usia >6o tahun, respirasi
>3o x/menit, hipotensi, konfusi akut, urea'>7mmol/L dan jumlah lekosit
yang rendah atau tinggi.

Gambaran radiologi
Dapat tertinggal dari onset klinis dan dapat menetap setelah sembuh!
r Pneumonia lobaris: Opasifikasi dari sebuah lobus, biasanyaStreptococcus.
Gambaran air bronchogram dapat terlihat.
. TB primer: Adenopati paratrakea kanan (4o%) dan hilus kanan (6o%)
dengan konsolidasi di lapang paru bawah atau tengah.
. TB pasca-primer: Bercak lunak di apek yang dapat disertai kavitasi.
. Pneumonia lobus media kanan: Batas jantung kanan menghilang.
. Pneumonia lobus inferior kanan: Batas diafragma yang menghilang.
r Pneumonia segmen lingula: Batas jantung kiri menghilang.
o Pneumonia lobus inferior kiri: Batas diafragma kiri menghilang.
106 Toraks

Pneumoniatobusmediakanan.Bataskananjantungtidakjetas.Padaproyeksi
fisura horisontal dan fisura
laterat, opasifikasi tobus media kanan tertihai antara
obtik.

dan retrosterna[ pada


Pneumonia lobus inferior kanan. Rongga retrokardiak
normat, harus memitiki densitas yang sama. Namun, terdaPat
t
"aauun p"d;;;;h k;nan yang tertihat juga di rongga retrokardiak
perbercakan di tapang
akibat konsotidasi.
Radiologi Emergensi

Pneumonia lobaris lobus


superior kiri: perhatikan
bahwa diafragma kiri
tertihat yang menunjukkan
bahwa [okasi bukan di tobus
inferior. Pada proyeksi
Iaterat, opasitas Yang
ekstensif tertihat di anterior
dari fisura obtik di [obus
supenor.
PneumotoraK

KaraKeristik
. Akumulasi udara dalam rongga pleura.
. Merupakan komplikasi umum dari trauma torak (t5-4o%)'
. Dibagi menjadi tiga kdtegori:
0 sederhana: Tidak terdapat hubungan dengan udara luar atau
mediastinum. Tidak terdapat Pergeseran garis tengah'
0Komunikans:Berhubungandengandefekpadadindingdada.
0 rension: Akumulasi udara progresif dengan tekanan dalam rongga
,)
pleural yang menyebabkan pergeseran mediastinum dengan
kompresi paru kontralateral dan pembuluh darah besar'.

Gambaran klinis
. Nyeri dada dan sesak.
. Spektrum bervariasi dari yang sangat berat dengan sianosis dan
takipnea sampai yang relatif asimptomatik'
. Tanda dan gejala tidak selalu harus berkorelasi dengan derajat
kolaps
paru. Tanda-tanda tension pneumothorax"
0 Takikardia d
0 Distensi v. iugularis
0 Tidak terdenganr suara pernafasan
0 Hiperresonan Pada Perkusi
0 Pergeseran trakea dan iantung meniauhi sisi yang terkena
0 Kondisi pasien dapat sangat buruk dengan tanda-tanda gangguan
iantung Paru.

Gambaran radiologi
. Batas pleura viseral terlihat.
. Kehilangan volume pada sisiyang terkena (e.g. hemidiafragma meninggi)'
. Pleural viseral memiliki kurva konveks yang membedakannya dari bula
atau kista di Paru.
. corakan bronkovaskular tidak terlihat di distal dari pleura viseral.
. pneumotoraks minimal dapat tidak terlihat pada pemeriksaan inspirasi
standar. Pemeriksaan saat ekpirasi dapat bermanfaat'
. Tension: lni merupakan diagnosis klinis dan bukan diagnosis radiologi'
Pergeseran mediastinum ke sisi yang berlawanan dapat terlihat. Deep
sulcls sign merupakan sutkus kostofrenikus yang tertekan ke bawah
dengan gambaran lusensi pada sulkus tersebut. Deep sulcus sign terlihat
pada proyeksi suPine.
Radiologi Emergensi 109

Pneumotorak ringan: batas


jantung kanan tertihat jetas
(panah) tanpa corakan paru
perifer. Tidak terdapat
pergeseran mediastinum.

Iotrogenic tension
pneumotordx.
Pneumotorak ini sekunder
akibat tekanan tinggi
intratorakal yang terbentuk
selama ventilasi dan
mengakibatkan ruptur
dari bleb pleura. Terdapat
pergeseran mediastinum
yang progresif ke kanan

Traumotic tension
pneumothorax. Fraktur
costa sebetah kanan dan
pneumotoraks dengan
pergeseran mediastinum ke
kiri.
I

Pneumotoraks minimal harus diperhatikan secara tetiti seperti yang


tampak pada gambar ini. Pneumotoraks terdapat di hemitoraks kanan
Radiologi Emergensi 111

Deep sulcus sign (panah


kosong hitam). Sutkus
sebetah kanan jauh lebih
rendah dari sulkus sebelah
kiri (panah putih). Garis
pteura viseraI ter[ihat
(panah kosong putih). Trakea
dan jantung tergeser ke
kanan (panah hitam).

Butta dapat dikelirukan


dengan pneumotoraks.
Dinding butta berbentuk
konkaf (panah kosong putih).
Dinding bu[[a yang lain juga
terlihat (panah putih).
Fraktur costa/sternum

Karakteristik
. Biasanya setelah trauma langsung. Dapat bersifat patologis'
. Curiga pada nyeri yang terlokalisir dan nyeri tekan yang semakin nyeri
jika inspirasi dalam atau batuk.
. Pikirkan cedera yang dapat menyertai:
0 Fraktur klavikula, costa ke-t dan ke-z mengindikasikan akibat
kekuatanyangbesar,seringkalidisertaicederapembuluhdarah
besar, trakeo-bronkial atau medulla spinalis'
0 Dislokasi sterno-klavikula, posterior (lebih iarang) berhubungan
dengan peningkatan risiko kerusakan organ dalam'
0 cedera stemum dapat berhubungan dengan kontusio miokardium.
0 Dengan fraktur costa bagian bawah, cedera organ dalam abdomen,
seperti hati, limpa atau ginial dapat terjadi'

Gambamn klinis

. Seringkali berhubungan dengan komplikasi dari cedera yang menyertai,


e.g. disritmia kordis atau ruptur limpa.

Gambaran radiologi
Foto polos toraks atau lateral sternal view dilakukan untuk menilai
komplikasi maupun mengidentifikasi fraktur yang mendasari'
Tanda-tanda komplikasi sekunder dapat terlihat - pneumotoraks,
hemotorak, kontusio Paru, dll.
Radiologi Emergensi 113

Fraktur sternum.

+
f

Fraktur costa pertama kiri. Cedera ini memerlukan gaya yang besar dan
berhubungan dengan insidensi cedera neurovaskular yang tinggi, terutama
vena subktavia.
1'

Abdomen

I
Radiologi Emergensi 115

Aneurisma aorta aMominatis 116


Appendisitis 119
lntussusepsi 122
Kotitis iskemik 125
lteus 128
" lteus [oka[ 136
lleus paratitik 138
Iteus obstiuki tetak rendah 14
lteus obstruki [etak tinggi 143
Felforasi 14
Acites 155
Nef rolitiasis / u reterotitiasis 158
Votwtus sigmoid 160
lvlegakoton tokik (kotitis fulminan) 162
Trauma tumpul abdomen 1U
Trauma penetrasi abdomen 168
- r:3men

Aneurisma aorta abdominatis

Karakteristik
' Didefinisikan sebagai dilatasi lokal yang permanen dari suatu arteri
yang mengenai semua lapisan dinding pembuluh darah.
' Dapat terjadi pada aorta bagian apapun tetapi paling sering terjadi
pada aorta di bawah a. renalis.
o Aorta berukuran lebih besar pada pria dan membesar seiring pertambahan
usia. Diameter aorta >jcm merupakan suatu abnormalitas.
o Dapat diakibatkan oleh penyebab yang spesifik seperti trauma, infeki
atau inflamasi. Penyebab yang paling sering adalah aterosklerosis.
' Jarang terjadi sebelum usia 5o tahun. Biasanya terdapat pada pria
usia lanjut.
. Membesar rata-rata o,2-or5cm per tahun
' Risiko ruptur meningkat sesuai peningkatan ukuran aneurisma.

Gambaran klinis
. Kebanyakan aneurisma ditemukan secara tidak sengaja.
e Dapat timbul secara sekunder akibat fenomena emboli, simptomatik
dari penekanan struktur yang berdekatan atau secara klasik timbul
dengan ruptur.
Ruptur klasik muncul dengan trias gejala: nyeri (seringkali nyeri
punggung), massa yang pulsatil dan hipotensi. Hati_hati
,kdrlna pasien
bisa saja tidak memiliki salah satu gejala tersebut! :
Durasi terjadinya gejala seringkali bervariasi dengan beberapa telah
memiliki gejala berminggu-minggu.
Kebanyakan ruptur terjadi ke dalam retroperitoneum, namun terkadang
timbul sebagai fistula ke dalam usus yang berdekatan atau ke v. cava.

Gambaran radiologi

ultrasonografi dapat menentukan ukuran dengan tepat. Dalam menilai


ruptur, kemampuannya terbatas.
Cf akurat dalam menilai ruptur aneurisma dan juga struktur yang
berdekatan.
Cf juga diperlukan dalam perencanaan operasi elektif.
Radiologi Emergensi 117


.f

Aneurisma aorta abdoririnatis (panah)


118

Katsifi kasi pada dinding


lateral kiri dari aneurisma
aorta (mata panah).

)
Ruptur aneurisma
aorta. Mata panah
memperlihatkan
penembusan pada dinding
aneurisma (A), dengan
perdarahan retroperitoneaI
yang ekstensif (H).
Radiologi Emergensi 119

Appendisitis

Karakteristik
. Relatif sering terjadi pada kelompok usia 5-zo tahun.
o Etiologi masih tidak diketahui. Mungkin berhubungan dengan obstruki
Iuminal, baik oleh kelainan intraluminal maupun mural.
. Proses inflamasi biasanya mengakibatkan peritonitis lokal. Komplikasi
berupa pembentukan abses dan peritonitis difus.
. Hati-hati pada pasien lansia karena appendisitis dapat luput dari
diagnosis.

Gambaran klinis
. Keluhan klasik berupa riwayat nyeri di abdomen tengah yang kemudian
pindah ke fossa iliaka kanan (titik mcaurney).
. Demam, malaise, nausea dan anoreksia merupakan keluhan yang sering.
. Gejala atipikal seperti disuria, frekuensi, kembung dan diare dapat terjadi.
. Pada pemeriksaan, kebanyakan disertai nyeri tekan lokal pada titik
McBurney yang disertai defence muscular. Nyeri lepas pada titik McBurney
juga merupakan tanda adanya inflamasi lokal di peritoneum.
. Nyeri abdomen kanan bawah pada palpasi di daerah kuadran kiri
bawah yang disebut sebagai Rovsing's sign.
. Nyeri pada ekstensi pasif panggul kanan merupakan tanda yang
tidak spesifik.

Gambaran radiologi
Foto polos abdomen: Cari kalsifikasi appendikolit pada kuadran kanan
bawah. lndikator lain termasuk udara bebas, ileus usus kecil, udara
ektraluminal, penebalan dinding caecum; hilangnya pelvis fat plones
di sekitar vesika urinaria menunjukkan cairan bebas di dalam pelvis;
hilangnya preperitonealfat; distorsi garis psoas dan tanda cut-off pada
pola udara yang nornal di fleksura hepatika akibat spasme kolon.
Ultrasonogrofi: Gambaran yang menyokong mencakup appendikolit yang
menyumbat - ujung buntu yang non-peristalti( struktur tubular non-
compressible, dan vaskulatur yang jelas pada meso-appendik; ketebalan
dinding harus <2mm pada appendiks yang normal atau berdiameter
total <6mm.
CT: Pemeriksaan yang sensitif dan spesifik. Tidak rutin dilakukan
mengingat dosis radiasi yang ditimbulkan. Distensi luminal dengan
dinding yang makin menebal dengan atau tanpa appendikolit. lnflamasi
lokal terlihat sebagai goresan linear pada lemak yang berdekatan.
Abses juga dapat ditemukan.
120 Abdomen

Pemeriksaan dengan kontras: Terkadang terlihat secara kebetulan.


Dicurigai jika tidak terdapat pengisian atau terdapat edema mukosa
-
lokal pada ujung caecum.
Saat ini diagnosis appendisitis banyak ditunjang oleh USG atau CT scan.
Masing-masing memiliki kelebihan dan kekurangannya. USG merupakan
pemeriksaan yang bersifat operator dependent. CT merupakan altematif
yang hasilnya tidak terlalu bergantung pada operator, namun efek
samping radiasi membatasi penggunaannya terutama pada ibu hamil
dan anak-anak.

Appendikotit terkatsifikasi yang besar (mata panah).


Radiologi Emergensi 121

Gambaran appendisitis pada USG.

Appendisitis pada pemeriksaan CT scan.


122 Abdomen

lntussusepsi

KaraKeristik
. Tefadiketika segmen usus prolaps ke dalam lumen usus yang berdekatan.
Bagian usus yang prolaps dinamakan intussuseptum, sedangkan bagian
usus yang menerima intussusePtum dinamakan intussusipien.
. Dianggap sebagai penyakit pediatrik, tetapi dapat juga terjadi pada
orang dewasa.
. Penyebab tersering dari obstruksi usus pada anak-anak dan bayi (3
bulan-5 tahun). Jarang terjadi di bawah usia t bulan.
r . Terjadi pada t dari zooo kejadian pada usia di bawah t5 tahun.
. lnsidensi meningkat pada saudara penderita.
. KuranBdarito%anakyangmemilikilesiyangdapatmenjadiintussusePtum,
seperti divertikulum Meckel atau hiperplasia limfoid.
. Pada pasien dewasa, ujung yang menjadi intussuseptum lebih banyak
ditemukan (selang nasogastrik, benda asing, tumor, dll.).

Gambaran klinis
. Nyeri abdomen kolik yang berat dan disertai muntah.
. Anak-anak seringkali menarik lutut mereka ke atas sampai dada.
Keadaan mereka bisa sangat letargik. Di antara dua sgrangan, anak

. Pada kasus klasi( massa berbentuk sosis dapat teraba di abdomen dan
buang air besar pasien menyerupai kismis merah (red currd+t stool).

Gambaran radiologi:
Foto polos abdomen: pada foto polos dapat ditemukan massa iaringan
lunak, terkadang dengan bukti adanya obstruksi usus proksimal.
Pemeriksaan kontras akan memperlihatkan gambaran coiled-spring
(barium yang terperangkap antara intussuseptum dengan intussusipien.
Penyempitan yang menyerupai paruh burung (beaklike narrowing)
dapat terlihat pada pemeriksaan antegrade.
US adalah standar baku emas dan memiliki sensitivitas hampir too%.
Tanda-tanda meliputi gambaran target atau bull's eye pada sconning
transversal. Gambaran sa ndwich dapat terlihat pada scanning longitudinal.
Colour Doppler dapat digunakan untuk menilai suplai pembuluh darah.
CT: Adanya gambaran cincin konsentris yang multiple bersifat diagnostik.
Radiologi Emergensi 123

A
Dua contoh intussusepsi yang terlihat sebagai massa jaringan lunak.

Gambaran coiled spring pada pemeriksaan dengan kontras.


I
^_"*

1'
a

A
Gambaran intussusepsi Pada USG.
a

r o

G
a

Cra
a

Potongan aksiat dari intussusepsi jejunum. Perhatikan obstruksi pada


bagian Proksimal usus kecit'
Radiologi Emergensi 125

Kotitis iskemfk
Karakteristik
. Kolitis iskemik merupakan peradangan pada dinding kolon akibat
penurunan perfusi ke kolon.
. Lebih dan 9o% kasus timbul pada usia lanjut.
. Walaupun pembuluh darah mesenterikus mayor biasanya paten, penurunan
aliran darah pada daerah yang diperdarahi oleh a. mesenterikus inferior
menyebabkan iskemia pada mukosa dan submukosa.
. Dapat dicetuskan oleh bermacam-macam sebab termasuk obstruksi
usus, emboli atau trombosis. Syok dan penyakit jantung kongestif
dapat juga menyebabkan iskemia.
. Merupakan komplikasi yang dapat terjadi saat operasi perbaikan
aneurisma.
. Dapat juga teriadi akibat obat-obat vasokonstriktor, sepefti kokain.
. Cenderung terjadi pada kolon sebelah kiri, dengan flekura lienalis dan
sigmoid sebagai area yang paling sering terkena. Rektum biasanya
lebih jarang terlibat.

Gambaran klinis
. Gambaran klasik adalah nyeri abdomen bawah yang diikuti diare
berdarah.
. Ada tiga subgrup;
0 Congrenous: Suplai pembuluh darah terputus seluruhnya yang
menyebabkan infark transmural. Perforasi dan peritonitis dapat
terjadi.
0 Stricturing: Suplai pembuluh darah yang terganggu menyebabkan
iskemia mukosa dan submukosa. Ulserasi teriadi dengan penyembuh-
an melalui fibrosis yang mengakibatkan stenosis.
0 Transient: Gangguan pembuluh darah yang reversibel mengakibatkan
kerusakan mukosa yang diikuti dengan regenerasi.

Gambaran radiologi
Foto polos abdomen: Foto polos biasanya normal. Cambaran marginal
thumb printing pada sisimesenterik mungkin terlihat yang berhubungan
dengan peradangan lemak perikolon. Kolitis iskemik dapat memiliki
gambaran udara intramural atau dalam vena porta (portol venous gas).
Borium enemo akan memperlihatkan mucosal thumb printing yang
berhubungan dengan perdarahan submukosal dan edema. Lipatan
mukosa yang edema diperlihatkan sebagai lipatan transversal. Ulserasi
dangkal dapat terlihat tapi ulserasi dalam adalah petanda yang lanjut.
Cf dapat memperlihatkan penebalan dari segmen yang terkena. Bekuan
darah dalam pembuluh darah mesenterika kadang-kadang terlihat. Udara
dalam dinding usus atau dalam sistem vena merupakan petanda lanjut.
Ultrasonografi dapat memperlihatkan penebalan dinding, namun penilaian
pembuluh darah dengan pemeriksaan Doppler biasanya terbatas.
hlucosol thumb printing pada kotitis iskemik
Usus besar yang mengalami
perforasi nekrotik. Udara
tertihat dalam v. porta.

Udara terlihat datam dinding


usus: gambaran CT untuk
iskemia [anjut.
lteus

lleus dapat dibagi meniadi dua, yaitu ileus fungsional dan ileus
obstruksi (mekanik).
lleus fungsional merupakan keadaan di mana usus kehilangan
kemampuannyauntukperistaltissehinggamenyebabkanobstruksi
yang bersifat fungsional.
Pada ileus obstruksi, terdapat struktur yang secara fisik menyebabkan
obstruki baik intraluminal ataupun ekstraluminal'
lleus fungsional dibagi menjadi dua lagi, yaitu ileus lokal (sentinel loop)
dan ileus generalisata (ileus paralitik). Pada ileus lokal iuga terdapat
1 paralitik pa'da sebagian usus, namun istilah ileus paralitik lebih sering
digunakan untuk ileus fungsional yang bersifat generalisata.
lleus obstruksi dibagi dua meniadi ileus obstruksi letak tinggi
(usus
dari
halus) dan ileus obsiruksi letak rendah (kolon). Hal ini dibedakan
letak obstruksi apakah di distal atau proksimal dari valvula Bauhini
(valvula ileosekal).
ileus
Hal-hal yang perlu diperhatikan untuk membedakan lenis-ienis
radiologi
tersebui dan membedakannya dari gambaran normal secara
adalah:
0 Ada tidaknya udara di rektum atau kolon sigmoid'
o Rektum dan kolon sigmoid pada keadaan normal hampir selalu
mengandung udara.
o Pada ileus obstruksi, gerakan peristaltik tidak'terganggu pada
awalnya bahkan meningkat.
. Hal ini menyebabkan udara di distal dari obstruksi akan
terdorong keluar, sehingga gambaran udara di rektum dan
kolon sigmoid akan menghilang.
o Pada ileus paraliti( udara di rektum dan kolon sigmoid masih
tetap ada.
0 Ada tidaknya dilatasi usus halus.
. Usus halus normal berukuran kurang dari z,5cm'
. Usus halus yang dilatasi biasanya berukuran antara 3-5cm'
o pada keadaan normal, bisa terdapat sejumlah kecil udara
sekitar dua samPai tiga looP.
o Usus halus memiliki valvula conniventes yang melintasi usus
secara komPli .
Radiologi Emergensi 129

Ada tidaknya dilatasi kolon.


. Kolon noffnal berukuran kurang dari 6cm.
. Diameter sekum dapat lebih besar namun jika lebih dari 9cm
dianggap abnormal.
c Kolon memiliki gambaran haustra yang tidak melintas usus
secara komplit.
Seimbang tidaknya dilatasi pada usus halus dan kolon.
o lleus paralitik biasanya terdapat dilatasi yang seimbang pada
usus halus dan kolon.
. Ileus obstruki ditandai oleh dilatasi yang tidak seimbang. tleus
letak tinggi ditandai dengan dilatasi usus halus saja. tleus letak
rendah ditandai dengan dilatasi kolon dan usus halus
Ada tidaknya penebalan dinding usus.
o lleus ditandai dengan adanya penebalan dinding usus.
o Jika hanya terdapat distensi usus, tanpa ada penebalan dinding
usus, maka disebut meteorismus/aerofagia.
o Distensi usus pada meteorismus juga tidak melebihi diameter
normal.
I lstilah dilatasi digunakan jika usus membesar lebih dari ukuran
normal dan istilah distensi digunakan jika terdapat udara yang
berlebih dalam usus, namun ukurannya masih dalam batas
normal.
Ada tidaknya air fluid level pada foto tegak atau dekubitus lateral.
o Pada usus halus normal bisa terdapat air fluid level sebanyak
dua sampai tiga loop.
. Kolon biasanya tidak memiliki oir fluid level atau hanya sedikit
pada keadaan obstruksi, oleh.karena cairan diabsorbsi di kolon.
c Air fluid level pada ileus ob3truktif terlihat pendek-pendek,
sedangkan pada ileus paralitik akan terlihat memanjang. Hal ini
diakibatkan masih adanya kontraki usus pada ileus obstruki.
Lokasi usus yang dilatasi.
o Usus halus terdistribusi di bagian sentral.
. Kolon terdistribusi di bagian perifer.
Ada tidaknya feses.
. Adanya feses merupakan petunjuk bahwa usus yang
mengandungnya adalah kolon.
. Feses memiliki gambaran gelembung udara kecil dan multipel.
130 Abdomen

Terkadang terdapat kesulitan dalam membedakan gambaran-gambaran


tersebut, hal ini disebabkan karena:
Waktu merupakan faktor yang seringkali dilupakan saat menilai
suatu foto. Perlu waktu yang cukup untuk suatu ileus obstruksi
mengosongkan udara di bagian distal. Hal ini menyebabkan ileus
obstruksi dapat menyerupai ileus paralitik
Katup ileosekal yang tidak kompeten. Hal ini menyebabkan ileus
obstruksi letak rendah memiliki gambaran udara di usus halus
sehingga bisa menyerupai gambaran ileus paralitik.
0 lleus obstruksi yang bersifat parsial.
0 lleum bagian distal yang dilatasi dapat menyerupai gambaran
udara di rektum atau kolon sigmoid. Valvula conniventes pada
ileum bagian distal terletak lebih berjauhan dan pada keadaan
edema dapat menebal sehingga menyeruPai gambaran kolon.
Lokasi ileum bagian distal juga terletak di abdomen tengah bawah
yang merupakan lokasi rektum dan kolon sigmoid. Haustra iuga
terkadang memberikan gambaran lipatan yang memintas usus
secara komplit sehingga menyerupai gambaran valvula conniventes.
Radiologi Emergensi 131

Valvu[a conniventes.

A
Haustra
132 | Abdomen

'.4

,fl

^. juga'(panah).
Meteorismus atau aerofagia. Udara di rektum tertihat
Radiologi Emergensi 133

Air fluid level pada ileus obstruksi

Air fluid level pada ileus paralitik.


Lokasi koton yang terletak di perifer. Gambaran usus halus pada foto
normal ini tidak tertihat.
Radiologi Emergensi

Gambaran feses pada kolon.


136 Abdomen

l[eus [oka[

lGrakteristik
. Disebabkan oleh iritasi lokal seperti peradangan di sekitar usus
(biasanya usus halus).
. Sekum terkadang dapat juga mengalami ileus lokal seperti pada
appendisitis.
. lritasi ini menyebabkan usus kehilangan fungsi peristaltik dan berdilatasi'
. Oleh karena ileus lokal tidak mengakibatkan hambatan seperti obstruksi,
maka udara dapat tetap melewati lokasi ileus lokal.

Gambaran klinis
. Sesuai dengan penyakit yang mendasarinya.

Gambaran radiologi
. Terdapat satu atau dua loop usus yang secara persiSten berdilatasi.
. Persisten berarti loop usus yang sama tetap berdilaiasi pada berbagai
proyeksi (berbaring, tegak, telungkup) atau tetap'berdilatasi pada
pemerikaan serial.
. Dilatasi usus halus pada ileus fungsional biasanya tidak sebesar dilatasi
pada ileus obstruksi.
, Air fluid level dapat terlihat pada ileus lokal.
. Cambaran udara biasanya terlihat di rektum atau kolon sigmoid.

Ha[ yang dapat menyulitkan diagnosis


Ileus lokal dapat menyerupai ileus obstruksi dini (mengalami gejala
selama t-z hari), ketika terdapat beberapa loop usus yang berdilatasi,
namun udara belum dikeluarkan dari kolon.
Pasien yang telah mengalami geiala obstruki selama seminggu atau
lebih biasanya tidak lagi memperlihatkan gambaran ileus obstruksi dini.
Ceiala klinis dan pemeriksaan penuniang lain (laboratorium) akan
membantu membedakan kedua kelainan ini.
Radiologi Emergensi

lteus [oka[ atau sentinel loop.

Iteus tokat akibat pankreatitis akut. Gamiaran ileus


tokat tertihat secara persisten
pada posisi berbaring (kiri) dan posisi tetungkup (kanan).
138 Abdomen

lteus paralitik

Karakteristik
. Pada ileus paralitik, seluruh usus menjadi aperistaltik atau hipoperistaltik.
. lleus paralitik biasanya teriadi setelah pembedahan di rongga abdomen
atau pelvis.
. cangguan elektrolit khususnya hipokalemia juga sering menyebabkan
ileus paralitik.
. Penyebab ileus paralitik lain adalah peritonitis, iskemia mesenterika,
kolik ureter, perdarahan retroperitoneal, infark miokardium akut, cedera
medulla spinalis, hipotiroid, hiperkalsemia, diabetes, dan obat-obatan
seperti atropin, glukagon, morfin, barbiturat, dan phenothiazine.

Gambaran klinis
o Kembung.
. Nyeri perut.
. Mual dan muntah.
. Konstipasi.
. BisinB usus menurun atau menghilang.

Gambaran radiologi
o Gambaran udara tampak pada seluruh usus baik usus halus maupun
kolon.
o Lambung seringkali ikut distensi.
. Air fluid level sedikit daripada ileus obstruksi. Bila ada, biasanya
berbentuk memanjang.
. Cambaran udara di rektum atau kolon sigmoid tetap ada, karena
obstruksi bersifat fungsional.
Radiologi Emergensi 1)9

Air fluid tevel yang panjang pada ileus paralitik yang tampak pada foto
tegak abdomen.
't40 Abdomen

lteus obstruki letak rendah

KaraKeristik
.Lebihjarangditemukandibandingkanobstruksiususkecil.
.Penyebabpalingseringdariobstruksimekanikadalahkeganasan.
Biasanya terdapat di distal dari kolon desenden'
. Penyebab lain meliputi hernia, volvulus, intussusepsi, divertikulitis,
iskemia atau kolitis yang diinduki radiasi'
. Obstruksi lebih sering terjadi pada orang lanjut usia'
. Jika katup ileosekal berfungsi bai( teriadi obstruksi Putaran tertutup
yangmenyebabkangrngg,,nperfusidaniskemia'Perforasiteriadi
jika obstruksi tidak membaik'

Gambaran ktinis
.NyerikramabdominalbawahbiasanyaberkembangSecaradiam-diam
dan disertai gejala konstiPasi'
.Distensiabdomentampaklebihnyatadibandingkandenganobstruki
usushalus.Muntah-muntahmerupakangejalalanjutandariobstruksi
usus besar dan teriadi bila katup ileosekal inkompeten'
. adanya iskemia
Nyeri lokal dengan tanda-tanda peritonitis mengesankan
aiau per{o.asi. Sekum merupakan daerah paling sering untuk
teriadi
perforasi.
I

Gambaran radiologi
. Foto polos abdomen: Foto polos abdomen seringkali diagnostik.
Usus
picture frame). Perlu
besar akan terlihat berdilatasi di perifer (gambaran
dicatatbahwapolahaustratidakmelintasiseluruhpenampangkolon.
Hal ini berbeda dengan valvula conniventes di usus halus'
. katup
Lengkungan usus halus yang berdilatasi terlihat pada keadaan
ileosekal Yang inkomPeten.
. Distensi sekum >8cm meningkatkan kemungkinan teriadinya
perforasi

sekum.
. cambaran air fluid level biasanya sedikit, karena kolon berfungsi
untuk
mereabsorbsi cairan.
.Tidakterdapatgambaranudaradirektumjikaobstruksisudah
berlangsung cukuP lama.
. Foto toraks tegak atau foto loterol dekubitus harus dilakukan bila
dicurigai terdaPat Perforasi.
. pemeriksaan kontras akan membantu menggambarkan lokasi obstruki'
Radiologi Emergensi 141

Ha[ yang dapat menyulitkan diagnosis


. Jika tekanan intrakolon meningkat cukup tinggi, maka katup ileosekal
akan terbuka (inkompeten) sehingga udara darikolon akan terdekompresi
ke usus halus.
. Hal ini menyebabkan gambaran dilatasi kolon yang dominan yang
biasanya menyertai ileus letak rendah menjadi tidak ielas.

lteus obstruksi letak rendah. Udara di sekum masih tampak sedikit.


Obstruksi usus besar' Titik
transisi tertihat di daerah
kolon sigmoid.

Barium enema paaa Pasien


yang sama mempertihatkan
lesi obstruksi.

Obstruksi massa jaringan


lunak annutar pada koton
mid-descenden.
Radiologi Emergensi 143

lteus obstruki Letal< tinggt

Karakteristik
. Disebut juga obstruksi dinamik karena usus berusaha untuk melewati
sumbatan fisik. Penyebabnya dibagi menjadi intraluminal (neoplasma,
intussusepsi, dan benda asing); mural (neoplasma dan striktur) atau
ekstrinsik (adhesi, hernia, volvulus dan neoplasma).
. Seiring waktu, mulai dari titik obstruki ke proksimal, usus halus akan
berdilatasi akibat udara yang tertelan dan cairan yang secara terus
menerus diproduksi oleh lambung, pankreas, sistem bilier dan usus
halus itu sendiri.
o Peristaltik akan tetap berlanjut dan bahkan meningkat sebagai usaha
untuk mengatasi obstruksi. Hal ini menyebabkan mulai dari titik
obstruki ke distal, gelombang peristaltik akan mengosongkan udara
dan isi usus lainnya.
. Jika obstruksi sudah berlangsung cukup lama, maka udara di rektum
dan kolon sigmoid akan menghilang.
. Penyebab ileus obstruksi letak tinggi antara lain adhesi pasca
pembedahan, keganasan, hernia, ileus akibat sumbatan oleh batu
empedu, intussusepsi, dan inflammatory bowel disease.
. Pseudo-obstruksi biasanya memiliki gejala dan tanda obstruki tanpa
ditemukan penyebab apa pun. Berhubungan dengan berbagai kondisi
medis.

Gambaran klinis (dinamik)


. Nyeri kram abdomen, distensi dari. muntah sering terdapat. Nyeri
sering kali terlokalisir di daerah epigastrium dan periumbilikal. Pada
obstruksi usus halus, flatus dan pasase feses biasanya tetap ada
kecuali pada tahap lanjut.
. Secara umum, semakin proksimal obstruksi yang terjadi, semakin cepat
gambaran klinis muncul.
. Cari tanda-tanda distensi, jaringan parut, dan hemia. Pada pemeriksaan
perkusi, abdomen bersifat timpanik. Pada auskultasi dapat ditemukan
peningkatan bising usus dan metallic sound.
. Nyeri tekan yang nyata mengarah pada adanya komplikasi obstruki.
Tanda-tanda iskemia usus harus dicari. Strangulasi usus sulit didiagnosis
hanya dengan pemerikaan fisik saja.

Gambaran radiologi
. Foto polos abdomen: Usus halus dibedakan dari usus besar dari
valvula conniventes yang melintasi usus secara komplit. Petunjuk lain
adalah lokasinya (sentral atau marginal). Terdapat juga lengkungan
144 Abdomen

yang berdilatasi pada usus yang terletak di sentral yang saling


menempel satu sama lain (step ladder appeorance) pada obstruksi
usus halus distal. Bandingkan dengan diameter lekukan usus yang
didekatnya (normal <3cm). Udara dalam kolon biasanya jarang atau
tidak ada sama sekali. Pada foto tegak, terdapat gambaran oir fluid
level multipel (>3). Berhati-hati pada pasien dengan usus yang terisi
penuh cairan karena kasus seperti ini bisa tidak terdiagnosis. lngat
pada ileus obstruksi, terdapat ketidakseimbangan distribusi udara dan
pada ileus obstruksi letak tinggi, maka terdapat dilatasi usus halus
yang dominan. Gambaran string of beadslpearls juga menjadi petanda
adanya ileus obstruksi letak tinggi.
Pemeriksaan kontras: Enema usus halus lebih sensitif dibandingkan
pemeriksaan follow through.
. cr: untuk menilai tingkat obstruksi dan ada tidaknya kelainan ekstra-
luminal.

Hal yang dapat menyulitkan diagnosis


. lleus obstruksi letak tinggi yang dini dapat menyerupai ileus lokal.
. lleus parsial (inkomplit atau intermiten) menyebabkan sebagian udara
melewati titik obstruksi sehingga memberikan gambaran udara pada
kolon. lleus obstruksi parsial didiagnosis dengan CT scan atau barium
follow-through.

Iteus tetak tinggi. Pada foto berbaring (kiri), terdapat gambaran usus hatus yang
berditatasi (panah hitam) dan tidak terdapat gambaran udara di rektum (panah
putus-putus hitam). Surgicol clips dapat terlihat juga (panah putih). Pada foto
tegak (kanan), dapat ditihat adanya air fluid Ievel (panah kosong hitam).
Radiologi Emergensi 145

Fffi

Obstruksi usus halus ktasik: yolyuloe conniventes tertihat jetas.


146 Abdomen

Gambaran usus hatus pada ileus obstruksi tetak tinggi sering juga disebut sebagai
stack of coins appearance atau coil spring appeoronce.
Radiologi Emergensi 147

A
String of beads/ peorls merupakan udara yang terperangkap di antara volvulo
conniventes dan cairan. Terjadi jika cairan terdapat datam jumtah tebih banyak
dibandingkan udara.

nffi

Hernia femoratis: matapanah menunjukkan lekukan yang kotaps dari usus hatus di
kanatis femoralis dengan obstruki usus hatus bagian proksimal.
148 Abdomen

Perforasi

Karakteristik
. Perforasi hollow viscus yang mengandung udara, seperti duodenum
atau divertikulum kolon sigmoid, akan menimbulkan adanya udara
bebas intraperitoneal.
. Lokasi lain yang sering terjadi perforasi adalah appendiks pada
appendisitis akut dan kolon sebagai akibat obstruksi mekanik atau
megakolon toksik.
. Perforasi usus halus terlihat pada trauma, benda asing yang tertelan
dan kelainan infiltratif seperti limfoma.
. Usia pasien dan anamnesis yang lengkap dapat mengarahkan lokasi
perforasi.

Gambamn klinis
. Nyeri biasanya terjadi pada semua perforasi. Awalnya terlokalisir lalu
dapat menjadi menyeluruh saat terjadi peritonitis.
. Lokasi nyeri dapat menunjukkan organ yang terlibat. Nyeri abdomen
atas menunjukkan gaster atau duodenum, sementara nyeri abdomen
bawah menunjukkan kolon.
. Nyeri tekan dan defons muskulor akan mengikuti pola yang sama,
awalnya terlokalisir lalu menjadi menyeluruh.
. Pekak hati akan berkurang bila terdapat udara bebas antara hati
dengan dinding abdominal anterior.
a Bising usus akan berkurang atau tidak ada pada peritonitis difus.
o Hati-hati pada pasien lanjut usia dengan gejala dan tanda yang samar-
samar.

Gambaran radiologi
Foto polos toraks: Foto tegak merupakan metode yang sensitif untuk
memperlihatkan udara bebas sub-diafragma. Volume udara bebas sekecil
t-z ml dapat terlihat. Hati-hati pada pasien berbaring yang diberdirikan
hanya sesaat sebelum difoto tegak karena udara dapat tidak terlihat.
Foto polos abdomen: Foto lateral dekubitus (biasanya sebelah kanan
di atas) dapat dilakukan bila foto tegak tidak dapat dilakukan. Udara
akan berada di tepi lateral dari hati. Ketika terdapat udara bebas
dalam abdomen, usus menjadi lebih jelas terlihat dengan adanya
udara pada kedua sisi dinding usus. Ini disebut sebagai Riggler's signl
double wall sign.
Radiologi Emergensi 149

Volume udara yang besar akan terkumpul di tengah abdomen pada


posisi pasien berbaring. Hal ini akan memberikan gambaran football sign.
Cari adanya penampakan struktur lain di intra-abdominal yang biasanya
tidak terlihat. lni antara lain slip otot diafragma, ligamentum umbilikalis
Iateral dan medial, ligamentum falsiformis dan hati.
Kesalahan yang sering teriadi adalah gas di dalam usus yang dianggap
udara bebas. Sindroma Chiloiditi memperlihatkan gas kolon diantara hati
dan diafragma akibat interposisi usus (biasanya flekura hepatika dari
kolon). Lipatan haustra merupakan tanda yang dapat membedakannya.
Lakukan foto dengan posisi dekubitus lateral kiri jika masih ragu.
Pada pasien dengan sindroma Chiloiditi yang dicurigai terdapat
pneumoperitoneum, pemeriksaan CT akan membantu menegakkan
diagnosis.
Divertikula, hemia, abses sub-diafragma dan kelainan di toraks dapat
disalahartikan sebagai udara bebas.

Pneumoperitoneum: udara bebas dibawah kedua hemidiafragma

Pneumoperitoneum minimaI harus di[ihat secara cermat agar tidak terabaikan.


Laparoskopi juga dapat mengakibatkan pneumoperitoneum minimat.
Gambar skematis perbandingan antara usus
normal dengan Rigler's sign'

Yl,4
.fi:

PneumoPeritoneum:
mempertihatkan Rigglerb
sign (mataPanah)
Radiologi Emergensi

Rigler's sign dan footboll


sign.
,r, I ooo",."."

}}isq

)
Udara datam tambung tidak
boleh diketirukan sebagai
pneumoperitoneum. Udara
datam [ambung dapat
dibedakan dari bentuknya
yang tebih butat, adanya
air fluid level, dan
dindingnya yang tebih
teba[.

Fenomena Chilaiditi yang


sering dikelirukan sebagai
pneumoperitoneum.

L-.
Radiologi Emergensi 153

l.
Lipatan usus yang dapat diketirukan sebagai Rigler's sign.

Rigler's sign setain ditandai dengan double wall sign juga memitiki karakteristik
membentuk gambaran segitiga dan sudut-sudut tajam di antara segmen-segmen
usus (panah hitam). Hat ini tidak ditemukan pada lipatan usus y,ang menyerupai
Rigler's sign.
154 Abdomen

Ka
a

Gar
a

.l
i

3l

i
(

Ligamentum falsiform (panah hitam) yang tertihat pada


pneumoperitoneum. Gam
c)
it
p
.P
k
.C
al
'Qt
d.
o 7A\s

dc
.He
iut
.Ta
da
pin
ucli
Radiologi Emergensi 155

Ascites

Karakteristik
. fucites merupakan akumulasi cairan di rongga abdomen.
. Penyebab ascites terbanyak adalah sirosis (8o%).
. Penyebab lain adalah gagal jantung, bekuan darah di sistem vena
porta, kanker (kolon, pankreas, lambung, payudara, limfoma, paru
atau ovarium).
. Mekanisme terbentuknya ascites dapat disebabkan oleh hipertensi
portal, penurunan tekanan onkotik (hipoalbuminemia), atau kombinasi
keduanya.

Gambaran klinis
. Dapat asimptomatik, terutama jika kurang dari too-4ooccm pada
orang dewasa.
. Penambahan ukuran lingkar perut.
. Nyeri perut, perasaan tidak nyaman dan kembung muncul ketika
ascites bertambah besar.
. Sesak dapat terjadi jika ascites yang besar menekan diafragma atau
jika terdapat perpindahan cairan melintasi diafragma dan menyebabkan
efusi pleura.

Gambaran radiologi ),
. Jika terdapat sejumlah kecil cairan bebhs di rongga peritoneum, cairan
itu akan jatuh sesuai gravitasi ke daerah pQling bawah yang mana
pada posisi berbaring adalah rongga pelvis.
. Pada foto polos abdomen, cairan dalam jumlah kecil dapat tidak teramati
karena densitas kandung kemih yang terisi penuh di rongga pelvis.
. Cairan dalam jumlah kecil dapat dideteksi dengan mudah oleh CT
atau USG.
. Cairan dalam jumlah besar akan memasuki rongga abdomen mulai
dari sisi lateral dan menggeser kolon ke medial
. Ascites yang masuk ke rongga pelvis dapat memberikan gambaran
dog's ear sign atau Mickey Mouse sign.
, Hellmer's srgn yaitu pergeseran permukaan lateral dari hati ke medial,
juga dapat terlihat pada ascites.
. Tanda lain adalah lemak preperitoneal terdorong ke lateral, sekum
dan kolon ascenden yang tergeser ke medial, elevasi diafragma,
pinggang yang mencembung, garis psoas yang tidak jelas, sentralisasi
udara dalam usus.
156

Gambaran skematis dari ascites yang mengisi rongga petvis.

Dog's eor sign alau llickey I'Aouse sign


Radiologi Emergensi

Gambar sebetah kiri merupakan ascites dengan gambaran udara pada usus yang
terdorong ke bagian sentrat. Gambar sebetah kanan merupakan gambaran mioma
uteri yang menyerupai ascites, namun dengan gambaran udara pada usus yang
terdorong ke perifer.

Gambar sebetah kiri mempertihatkan Hellmert sign (panah hitam). Gambar


sebelah kanan merupakan pemeriksaan tomografi konvensionaI yang
memperlihatkan Hellmer's sign dengan tebih jetas.
158 Abdomen

N efro litiasi s / u rete roti ti asi s

Karakteristik
. Gangguan traktus urinarius yang paling sering.
o Lima sampai sepuluh persen dari populasi menderita batu traktus
urinarius.
. Kebanyakan teriadi pada pria, biasanya pada usia 2o-5o tahun.
. Pembentukan batu bersifat familial. Kejadian berulang lebih sering
teriadi dibandingkan episode tunggal.
. Komposisi batu kebanyakan terdiri dari kalsium oksalat (merupakan
yang paling radio-opak).

Gambaran ktinis
. Kolik renal secara klasik berupa nyeri kolik berat dari pinggang sampai
pangkal paha yang semakin lama semakin berat (kresendo).
. Pasien akan merasa gelisah dan teragitasi dengan nyeri yang dialami.
o Biasanya disertai mual dan muntah.

Gambaran radiologi
Foto ginjal, ureter, kandung kemih: 7o% batu akan terlihat dan 3o%
tidak terlihat. Hati-hati saat memeriksa opasitas di ujung Processus
transversus, sendi ,sacroiliaka dan rongga pelvis yang dicurigai batu
(bentuk ireguler). Flebolit biasanya cenderung sferis dengan daerah
sentral yang lusen. Kalsifikasi nodus limfatikus juga dapat dianggap
batu ginjal.
a lntravenous pyelogram (lVP): penting sekali untuk menilai batu.
a CT: pemerikaan yang sensitif dan spesifik.
Radiologi Emergensi 159

obstruksi traktus urinarius kiri yang disebabkan batu vesiko-ureter-ili kiri


(matapanah ).

cr traktus urinarius yang tidak menimbutkan penyangatan. Mempertihatkan


batu
yang menyumbat di .l /3 atas ureter kiri.
160 Abdomen

Votvutus sigmoid

]Grakteristik
. Terjadi bila kolon sigmoid terputar yang menyebabkan obstruksi closed
loop. Vaskular dapat terganggu. Faktor predisposisi pada pasien dengan
kolon sigmoid yang redundan dan mesenterium yang sempit'
. Berhubungan dengan kejadian konstipasi kronis yang berat'
. Terjadi pada orang lanjut usia dan pada pasien dengan penyakit
psikiatri dan neurologis yang berat.

Gambaran klinis
. Pasien biasanya datang terlambat dengan riwayat penyakit yang tidak
jelas. Dicurigai pada pasien lanjut usia dengan keluhan obstruksi.
. Nyeri kram abdomen bawah yang disertai distensi sering ditemukan'
r Konstipasi total dan tenesmus (akibat traki rektal)'
. Adanya riwayat kejadian serupa sebelumnya dan sering kali gejala
sembuh dengan sendirinya seiring dengan pergerakan usus'
. Waspada akan tanda-tanda sepsis yang mengindikasikar.l adanya gangren.
-:
Perforasi iarang teriadi.

Gambaran radiologi
. Pada foto polos abdomen, adanya lekukan usus besar yang memanjang
dari pelvis. Memberi gambaran biii kopi (coffee bean sign).
. Pemeriksaan barium dapat dilakukan selama tidak dicurigai adanya
gangren. Barium akan memberikan gambaran meruncing seperti paruh
burung.
. Pola pusaran (whirled pattern) terlihat pada CT. lni dibentuk dari
Iengkungan aferen dan eferen usus yang berputar.
Radiologi Emergensi 161

Votvulus sigmoid ktasik:


coffee beon sign. LIF:. Left
ilioc fossa.
Abdomen

Megakoton tokik { [tt{s


fulminan]

KaraKeristik
. Biasanya terjadi akibat dari kolitis fulminan (biasanya kolitis ulseratif).
. Kolitis fulminan terjadi pada 'to% pasien dengan kolitis ulseratif. Dari
sebagian kecil ini, hanya sebagian yang berkembang menjadi megakolon
toksik.
. Biasanya terjadi saat awal kedatangan pasien kolitis fulminan akut.
. Dapat dicetuskan oleh penggunaan enema, penggunaan obat antidiare
yang berlebihan atau setelah pemeriksaan dengan barium enema'

Gambaran klinis
. Nyeri abdomen dengan distensi yang progresif.
. Pada pemeriksaan, terdapat nyeri tekan abdomen. Tanda-tanda sepsis
seperti demam, kaku/rigor, dan takikardia sering ditemui.
. Riwayat kolitis ulseratif yang tidak terkontrol dengan baik.
. sekitar 25% pasien dengan megakolon toksik berkembang ke arah
perforasi. lni ditandai secara klinis dengan adanya nyeri lokal yang
berkembang menjadi peritonitis difus disertai penuruhan keadaan pasien.

Gambaran radiologi -

. Paling baik dilihat dengan foto polos abdomen. Kolon transversum


paling sering terkena. Tanda-tanda radiografik yang sugestif adalah:
0 Kolon >8cm. Batas normal yang paling besar adalah 6cm.
0 Pseudopotip memperlihatkan pulau-pulau mukosa yang dikelilingi
daerah tanpa mukosa.
0 Pneumotosis kolon - udara dalam dinding usus akibat nekrosis.
0 Udara bebas yang disebabkan oleh perforasi. Foto lateral dekubitus
dapat membantu.
0 Hilangnya pola haustra yang normal.
. CT: Kolon yang distensi dengan dinding tipis yang nodular. Udara
intramural dan koleksi cairan.
. Kontraindikasi untuk dilakukan pemeriksaan barium enema.
Radiologi Emergensi 163

Megakoton tokik: pulau-pulau mukosa yang edema (matapanah) pada


inflamasi kolon tranversum.
154 Abdomen

Trauma tumPul abdomen

KaraKeristik
. Biasanya terjadi setelah kecelakaan lalu
lintas'

.Biasanyasulitdinilaikarenacederayangmelibatkanmulti-sistem'
. Cedera biasanya disebabkan oleh tiga mekanisme berikut:
organ
(i) tekanan intra'abdominal: mengarah ke cedera
Peningkatan
tubular.
(ii) Kompresi: organ visera tertekanantara men

dengan koluirna vertebralis' Limpa dan luka'

(iii) Shear force: Mengakibatkan cedera O i'g'


terlihai pada bagian-bagian yang terfiksasi'
bawah'. sep.efti yang
. Waspada pada cede.a rongga toraks bagian
ditimbulkanolehsabukpengamanyangkonvensional;iniberhubungan
dengan cedera Pada hati dan limPa'
.Lapbeltsdapatmenyebabkanrobekanmesenterium/ususdankontusio.
yang tiba-tiba dari tekanan
Perforasi a.p.t t"l,ai akibat peningkatan

Gambaran Klinis
. ringan sampai yang berat
cejala klinis bervariasi mulai dari yang relatif
dengan sYok dan hiPotensi'
.Pasienseringmengeluhkannyeriyangterlokalisirmaupuntidakterlokalisir.
,Defensmuskuloryanginvoluntermenandakanadanyairitasiperitoneum.
lepas ,"nrnl,Ikfun iritasi peritoneum yang
lebih pasti' Penilaian
Nyeri
berkalaolehpemeriksayangsamadirekomendasikanuntukmenilai
Perubahan Yang terjadi'
. Perhatikan adanya memar karakteristik
yang mengesankan adanya
pemeriksaan tambahan
cedera org"n uir"'a' Jika memungkinkan'
[ateter urin' dapat memberikan
seperti intubasi nasogastrik dan
informasi tambahan'
Radiologi Emergensi

Trauma tumput ginjat tertutup. Tampak^


Kontur ginjal kiri dan opasifikasi sisiem
terdapat skotiosis di daerah torakotumbat
ke sisi jejas. lteus tokat terdapat pada fle
tampak norma[.
I

166 Abdomen

Gambaran radiologi
. FOto polOs: Adanya fraktur costa, Prosesus transversum, korpus
vertebra dan fraktur pelvis menandakan adanya cedera pada struktur
lain yang berdekatan. cairan datam rongga abdomen dapat terlihat
,"ngg"i"r struktur berongga, seperti kolon ascendens/descendens
te aiah medial. pada posisi berbaring, usus halus akan tergeser ke
sentral pada abdomen yang terisi penuh cairan. Udara bebas akan
naik dan terlihat di bawah diafragma pada foto tegak. Pada foto
berbaring, akan ditemukan udara sepanjang bagian yang menempel
dengan peritoneum, seperti ligamentum falsiform. Udara retroperitoneal
akan memperielas struktur di sekitamya seperti ginial dan duodenum.
Foto lateral dekubitus dapat membantu.
. USC: pemeriksaan yang cePat, non-invasif dan dapat diulang yang
sangat sensitif terhadap koleksi cairan (>too ml) dalam abdomen.
penreriksaan difokuskan pada lekukan splenorenal, Morrison's pouch
dan kavum Douglas tdaerah parakolik sangat sensitif terhadap cairan
bebas. USG juga bermanfaat untuk menilai diafragma'
. CT: Sangat berguna dalam kasus trauma tumpul abdomen. Dapat
."ngg-rbrrkan cedera viscera dan iuga perdarahan. Dapat diperluas
untuk pemerikaan di atas dan di bawah diafragma. Lebih bermanfaat
dibandingkan USG dan DiagnosticPeritoneal Lavage (DPL) dalam menilai
cedera retroperitoneal. Dapat diulang untuk pemantauan cedera. Kurang
I
sensitif untuk cedera usus halus, pankreas, dan trauma pada diafragma'
, Pemeriksaan kontras: Berguna bila diduga ada perforasi esofagus,
gaster atau duodenum.
, Angiografi: Digunakan pada kasus-kasus tertentu'
Radiologi Emergensi 167

A
Trauma tumpul ginja[. Hematoma peri-renal yang besar (H) dan perdarahan ke
peritoneum (matapanah). K:kidney.
Trauma penetrasi abdomen

Karakteristik
. lnsidensinya terus meningkat.
. Luka tusuk dan luka tembak merupakan penyebab terbanyak. Walaupun
luka tusuk merupakan 8o% dari keseluruhan cedera, kematian paling
banyak diakibatkan oleh senjata api.
a Hati, limpa, usus halus, usus besar, dan gaster seringkali terlibat.
a Mortalitas berhubungan dengan tingkat keparahan hipovolemia dan
jumlah organ yang mengalami cedera.

Gambaran klinis
. Gambaran klinis berhubungan dengan tipe, karakter, dan jumlah dari
cedera penetrasi.
. Dapatkan anamnesis dari saki, paramedi( pasien, dll.
. Seperti pada trauma tumpul, pemerikaan serial perlu dilakukan oleh
orang yang sama (terutama ahli bedah)
. Waspada pada pasien dengan cedera torak bagian bawah, punggung
dan pinggang karena cedera retroperitoneal bisa tidak jelas.

Gambaran radiologi
. Pemeriksaan tidak boleh menghambat keputusan ti,ndakan. Hanya
dapat dilakukan bila laparatomi darurat tidak diindikasikan.
, Foto polos: Dapat memperlihatkan udara bebas intra-peritoneum atau
membantu menentukan lokasi benda asing yang radio-opak.
. USC: Lihat pada trauma tumpul. Pada trauma penetrasi USG dapat
digunakan untuk menilai koleksi cairan dalam rongga perikardial. Juga
dapat digunakan untuk menilai arah dan kedalaman jalur penetrasi.
. CT: Lihat pada trauma tumpul. Biasanya tidak dilakukan pada kasus-
kasus trauma penetrasi karena indikasi untuk laparatomi sudah jelas.
lndikator dari hipovolemi dapat dilihat di CT; ini sesuai dengan tanda
klinis tetapi tidak dapat menggantikan pemerikaan biofisik yang berulang:
0 Kolaps v. cava inferior.
0 Limpa yang berukuran kecil dan kurang menyangat.
0 Konstriksi vaskular yang kuat diperlihatkan dari diameter aorta
dan a. mesenterika yang mengecil.
Radiologi Emergensi I t69

Laserasi hati yang besar.

Hematoma peri-nefrik
dengan kantung-kantung
keci[ yang berisi udara
(matapanah).

Herniasi usus (matapanah)


yang terjadi setetah luka
tusuk.
lr
n

Gera
Radiologi Emergensi

Cedera sendi akomio-ktavikuta 172


Distokasi karyat
(temiasuk distokasi lunatum dan peritunatum) 174
Fraktur ktavikuta 178
FraKur Colles' 180
Fraktur pergetangan tangan yang tain 181
Fraktur distokasi Galeui 186
Fraktur humerus-Fraktur permukaan artikular 188
Fraktur epikondilar/epifisis 1X)
Fraktur olekanon 191
Fraktur cap.ut radius 193
Fraktur humenrs-Fraktur prokima[ 195
Fraktur humerus-Fraktur pada batang 197
Fraktur humerus-Fraktur suprakondilar 199
Fraktur distokasi lvlonteggia 201
Fraktur skaputa 203
Dislokasi sendi bahu 205
Fraktur skapoid 208
Fraktur metakarpat ibu jari 210
172 Anggota Gerak Atas

Cedera sendi akromio-ktavikuta

Karakteristik
. Mekanisme cedera umumnya melibatkan benturan pada suatu titik di
bahu dengan posisi lengan dalam keadaan abduksi. Cedera ini sering
terdapat pada olahraga yang banyak melibatkan kontak fisik.
. Ruptur ligamentum akromio-klavikula (AK) pada awalnya diikuti oleh
ruptur ligamentum korako-klavikular dan perlekatan otot deltoideus
dan trapezius.-
o Pada kejadian lituh dengan tangan teriulur ke depan, hanya ligamentum
AK yang terkena.
,t . t<laiifikasi adaldh sebagai berikut:
t) 0 ' Sprain of ligaments: Hubungan anatomis masih dipertahankan.
0 ' Subluksasi: Ruptur ligamentum AK. Klavikula distal naik ke atas,
, biasanya kurang dari setengah lebarnya. Ligamentum korako-
klavikula masih utuh.
O . Dislokasi: Ruptur ligamentum AK dan ligamentum korako-klavikula.
lnsersi otot trapezius dan dettoideus mengalami avulsi. Jarak korako
:klavikula sangat meningkat karena klavikula terdorong ke atas.
. Klasifikasi lain juga digunakan, seperti klasifikasi Rockwood ke dalam
6 tingkat.

Cambaran klinis
. Kecurigaan berasal dari anamnesis dan tanyakan kepada pasien untuk
menuniukkan titik lokasi nyeri.
. Periksa pasien dalam keadaan berdiri, karena hal ini akan membuat
keadaan asimetris menjadi terlihat.
. Deirgan adanya sproin minor, pasien seringkali mengeluh nyeri yang
terlokalisir dan nyeri tekan, namun rentang pergerakan masih dalam
batas nomtal.
r Seiring dengan peningkatan keparahan sprain, kehilangan fungsi menjadi
lebih nyata dengan deformitas yang tampak ielas.
Radiologi Emergensi 173

Gambamn radiologi
Proyeki yang dianjurkan mencakup Ap, proyeki dengan kemiringan
ke arah sefalik sebesar 15 derajat, dan proyeksi akiai
Proyeki sendi AK yang spesffik harus dijeLskan secaru rinci karena
pajanan berbeda dad' shoulder view.
Pada pasien yang normal, permukaan inferior dari akromion dan
klavikula berada pada satu garis.
Grade I secara radiologis normal. Grode il memperlihatkan pelebaran
celah sendi dengan displacement klavikula ke arah atas. Grade ill
memperlihatkan celah korako-klavikula yang melebar (>r3mm atau
perbedaan >5mm antara kedua sisi) dan disrupsi total dari
sendi AK
(seharusnya <8mm).
Stress view umumnya diminta, namun tidak dapat direkomendasi oleh
karena ketidaknyamanan yang diakibatkan dan tingginya kejadian
folse
negative pada spasme otot.

.
Distokasi sendi akromio-klavikuta
Distokasi karPal
(termasuk distokasi lunatum dan
peritunatum)
KaraKeristik
.Umumnyateriadisetelahjatuhpadapergelangantanganatautangan.
pergelangan, deviasi
o Gambaran cedera dihasilkan oleh hiperekstensidari
ulna dan suPinasi interkarPal'
. Diklasifikasi ke dqlam emPat kategor!
' 1. Dislokasi skaPolunatum
2. Dislokasi Perilunatum
3.Dislokasiperilunatumdengandislokasitriquetrum(mid.karpal)
4. Dislokasi luhatum

Cambaran klinis
i'
,. I
. Pasien seringkali mengeluh nyeri dan
bengkak'

. terbatas'
o:iil Pergerakan pada pergelangan tangan
. Nyeri tekan lokal terutama pada area
skapolunatum'

Gambaran radiologi
.ProyeksiPostero,anterior(PA)danlateralsangatlahpenting.
.Pembandingandengansisiyangberlawananiugaseringkaliberguna.
.Padaproyeksilateral,lihathubunganantarabagiandistaldaritulang
radius,lunatumdancapitatum(seringkalidisebutsebagaisoucer'cup
and aPPle)-
peningkatan (>3mm) celah
o Dengan dislokasi skapolunatum, terdapat
pada proyeksi AP' Gambaran ini
antara tulang skappid dan lunatum
dinamakan seperti komedian
disebut sebagai Teyry Thomos sign yang
yang terken"I d"ng"n celah pada gigi depannya'
.Dengandislokasiperilunatum,tulangcapitatummengalamidislokasike
antara tulang lunatum
dorsal terhadaf iulang.lunatum. Klsegarisan
and cup) masih normal'
dan bagian aiti.ii'r'ig radius (saucei
. Pada l, gambaran menyerupai gambaran di atas
kecua t't"ng triquetrum' Hal ini paling baik dilihat
pada triquelrum bertumpang tindih dengan tulang
lunatum atau hamatum'
Radiologi Emergensi

Dengan dislokasi lunatum, tulang lunatum mengalami dislokasi ke


anterior seperti 'gelas yang miring ke depan dan menumpahkan isinya'
pada proyeksi lateral. Tulang capitatum tetap berada dalam satu garis
dengan radius. Pada proyekiAP, lunatum memilikigambaran triangular
yang karakteristik akibat kemiringan ke arah volar.

A
Tutang-tulang pergelangan tangan yang norma[.
Anggota Gerak Atas

nr
t Distokasi Iunatum
)

Dislokasi perilunatum
Terry Thomas sign
-i-
r78 | nnggota Gerak Atas

Fraktur ktavikuta

lGrakteristik
. Kebanyakan diakibatkan oleh benturan langsung ke bahu seperti saat
jatuh. Fraktur lebih jarang diakibatkan oleh gaya yang tidak langsung
(sekunder) akibat iatuh pada tangan yang terentang ke depan'
. Lokasi yang paling sering terkena adalah perbatasan antara t/3 bagian
tengah dengan r/3 bagian distal (8oZf.
. Fraktur dapat berhubungan dengan dislokasi stemo-klavikula atau AK'

Gambamn klinis
. pasien akan mengeluh nyeri pada lokasi fraktur dan enggan untuk
menggerakkan bahu maupun lengannya.
. Terdapat displacement ke anterior, inferior dan medial dari bahu pada
fraktur mid-klavikula akibat tarikan otot-otot yang melekat'
. Lekukan yang terpalpasi dan krepitasi seringkali dapat diraba.
. Nekrosis akibat penekanan pada kulit di atasnya jarang -teriadi namun
-r.rl merupakan keadaan Yang gawat
. Pneumotoraks atau cedera neurovaskular dapat teriadi walaupun
jarang.

Gambaran radiologi
. Proyeksi AP tunggal biasanya cukup'
. Seringkali garis fraktur terlihat jelas, walaupun pada anak-anak fraktur
greeistick dapat sulit dilihat. Pada anak-ana( seringkali penting untuk
membandingkan kedua sisi.
. Waspada terhadap adanya Pneumotoraks minimal akibatfragmen tulang'
. Pada pasien dengan riwayat kanker payudara, fraktur patologis dapat
terjadi. Hal ini dapat sekunder akibat penyakit yang rekuren, namun
selalu tanyakan riwayat radioterapi karena nekrosis akibat radiasi dapat
menyerupai fraktur.
Radiologi Emergensi 179

A
Fraktur pada 1 /3 tengah tulang ktavikula kanan.
18o Anggota Gerak Atas

Fraktur Cof{es'
)

F
a

KaraKeristik a

. Awalnya dideskripsikan pada tahun t8t4 dan merupakan fraktur a

pergelangan tangan pada orang dewasa yang paling sering.


. Jatuh dengan tangan yang terentang merupakan penyebab tersering.
. Biasanya ditemukan pada wanita usia paruh baya dan usia lanjut
dengan osteoporosis.
. Secara klasik didefinisikan sebagai fraktur transversal dalam jarak
zcm dari permukaan artikular; dengan angulasi dan displacement ke
dorsoradial. Fraktur bersifat impaki dan seringkali berasosiasi dengan
fraktur processus stiloideus ulna.

Gambaran klinis
. Pasien akan mengeluh nyeri pada pergelangan tangan.
. Secara klasik deformitas dinner fork dapat terlihat.
. Pembengkakan yang nyata disertai memar'umumnya ditemukan.
. Waspada akan adanya cedera pada pembuluh darah dan:n. medianus.

Gambaran radiologi
a Proyeki AP dan lateral merupakan hal yang penting. t
a Lima deformitas yang paling umum ditemukan adalah: I

t. Angulasi ke dorsal dengan hilangnya kemiringan normal (5-to I

derajat) ke arah volar pada permukaan artikular dari radius.


2. Displacement fragmen distal fraktur ke arah dorsal.
3. lmpaksi pada lokasi fraktur.
4. Displacement fragmen distal fraktur ke arah radial.
5. Kemiringan fragmen distal ke arah radial.
Pronator quodratus fat pad cenderung terangkat sekunder akibat efusi.
Radiologi Emergensi r8r

Fraktur pergetangan tangam


yang lain
Fraktur Smith's
. Jatuh pada punggung tangan atau akibat benturan langsung.
o Pasien datang dengan nyeri dan bengkak pada pergelangan tangan
disertai dengan deformitas.
. Seringkali disebut sebagai fraktur reverse Colles'.
. ProyeksiAP dan lateral direkomendasi karena gambarannya menyerupai
fraktur Colles' jika hanya proyeksi AP yang diperika.
. Fraktur transversal melalui bagian distal dari metafisis radius yang
disertai angulasi ke arah volar dan pergeseran ke volar.
. Cari tanda-tanda cedera pada n. medianus.

Fraktur Barton's
. Garis fraktur terdapat intra-artikular dan berjalan oblik jika dibandingkan
dengan fiaktur transversal seperti yang terlihat pada tipe Colles'.
o Awalnya terbagi dalam dua tipe, pertama dengan fragmen yang
mengalami displacement ke arah dorsal sementara yang kedua dengan
fragmen yang mengalami displocement ke arah volar.
. Fraktur yang saat ini diasosiasikan dengan nama tersebut dideskripsikan
sebagai fragmen dari pinggir anterior radius dengan sublukasi baik
sendi pergelangan tangan maupun sendi "radioulnar distal.
. Cenderung terjadi setelah cedera pada kecepatan tinggi.
. Proyeki AP dan lateral diperlukan. Displocement tulang karpal paling
baik dilihat pada proyeksi lateral.

Fraktur Chauffeur's (Hutchinson)


. lni merupakan fraktur intra-artikular pada processus styloideus radius.
. Biasanya sekunder akibat benturan langsung pada aspek ulnar dari
pergelangan tangan.
. Paling baik dilihat pada proyeksi AP.

FraKur Greenstick
. Fraktur inkomplit pada metafisis yang terlihat sebagai disrupsi pada
salah satu sisi korteks dengan angulasi atau pembengkokan pada sisi
yang berlawanan.
. Jika angulasi >to derajat mungkin diperlukan reduksi dan imobilisasi
tergantung pada usia anak, karena remodellingyang terjadi ada batasnya.
Anggota Gerak Atas

Fraktur Smithb

rl

-rl

A
Fraktur Colles'
Radiologi Emergensi 183

Cedera epifisis

=g

Paling umum adalah tipe ll, dengan fragmen metafisis triangular


terlihat di dorsal.

A.
Cedera Salter Harris tipe ll pada tulang radius bagian distal.
184 Anggota cerak Atas

A
Cedera Salter Horris tipe I pada tutang tibia bagian distat.

-,J

Tilloux frocture atau cedera Solter Harris tipe lll pada tutang tibia bagian
distat.
Radiologi Emergensi

Cedera Solter Horris tipe


lV pada tutang tibia bagian
distat.

Cedera Salter Horris tipe


V pada tutang tibia bagian
distat.
186 Anggota Gerak Atas

Fraktur distokasi #{ r

KaraKeristik
. Didefinisikan sebagai fraktur radius dengan dislokasi sendi radio-ulna
distal.
. Merupakan fraktur yang jarang dengan kejadian sekitar t dari 't4

fraktur lengan bawah.


Terjadi pada iatuh dengan tangan yang terentang dimana lengan
bawah mengalami pronasi secara paksa.
Seperti juga fraktur Monteggid, fraktur ini dapat terjadi sekunder
terhadap benturan langsung.

Gambaran klinis
. Pasien akan mengeluh nyeri dan enggan menggerakkan lengan bawah
atau pergelangan tangannya.
. Deformitas yang nyata pada lokasi fraktur radius dapat terlihat.
. Nyeri tekan dengan atau tanpa krepitasi sepanjang radius distal dapat
ditemukan.
. Pada pembandingan dengan sisi yang berlawanan, caput ulnaris akan
. menonjol dengan pembengkakan iaringan lunak.
-, il

Gambaran radiologi r.

. Dapatkan proyeksi AP dan lateral dari lengan bawah termasuk


pergelangan tangan.
. Fraktur pada radius umumnya terjadi pada perbatasan t/3 tengah
dengan t/3 distal.
. Radius seringkali akan tampak memendek.
. Nilai secara hati-hati sendi radio-ulna distal akan adanya pelebaran.
. Pada proyeki lateral, caput ulna biasanya terdorong ke dorsal.
. Seringkali terdapat angulasi ke dorsal pada fraktur radius.
. Fraktur processus styloideus ulna merupakan hal yang umum dan
merupakan pertanda adanya disrupsi sendi radio-ulna distal.
. Cara yang berguna untuk mengingat fraktur tipe ini adalah dengan
akronim 'GFR' - Galeazzi Fractured Radius-
Radiologi Emergensi 187

!$
n
I

l.
Fraktur Goleozzi.
Anggota Gerak Atas

Fraktur humerus- Fraktur


permukaan artikutar

Termasuk ke dalam kelompok ini adalah fraktur capitullum, troklea,


,{i

, epikondilus, olekranon dan caput radius.


I

Fraktur capitullum
Karakteristik
. Jatuh dengan tangan yang terentang.
. Seringkali berasosiasi dengan fraktur caput radius'

Gombaran klinis
_Jil . Bisa datang dalam keadaan terlambat'
. Fleksi yang terbatas dan nyeri tekan yang terlokalisir'

Gamboran radiolqi
. Fraktur dapat tampak nyata dengan displocement dari capitullum.
. Fraktur undisplaced minimal biasanya berasosiasi dengan efusi yang
menyebabkan elevasi dan fat Pad.
. Waspada terhadap fraktur caput radius yang menyertai'

Fraktur troklea
Fraktur ini iarang teriadi.
Radiologi Emergensi 189

Cedera tutang yang


mendasari harus setalu
dicari secara seksama ketika
efusi yang signifikan pada
sendi ditemukan datam
konteks trauma. Perhatikan
etevasi /at pod anterior dan
posterior.
I

r9o I nnggota cerak Atas

Fraktur epikondi [arlePtftsis

Karakteristik
o Biasanya pada epikondilus medial.
. Fraktur pada anak-anak seringkali melibatkan epifisis dari epikondilus
medial.
. Biasanya berasosiasi dengan dislokasi posterior, repetitive volgus strain
atau benturan langsung.

Gambaran klinis
. Nyeri pada pergerakan dan nyeri tekan terlokalisir pada epikondilus
medial.
. Kontraksi fleksi lengan bawah akan meningkatkan rasa nyeri. Nilai
I
fungsi n. ulna.

-r/ Gambaran radiologi


o Penilaian radiologi dapat sulit dilakukan karena- seringkali terdaPat
kebingungan dengan pola normal dari epifisis. Pengenalan dengan
prinsip 'CRITOL' (lihat di bawah) akan mengurangi risiko kesalahan.
Bandingkan dengan sisi yang berlawanan jika gambaran mencurigakan'
Secara tipikal, epifisis tampak sebagai berikut - Capitellum: 1 tahun,
Radial head:3 tahun, medial (lnternal) epicondyle: 5 tahun, Trochlea: 7
tahun, Olecranon:g tahun, Loteral epicondyle: tt tahun (CRITOL: 1, 3,
5, 7, 9, dan tt tahun). Sementara prinsip CRITOL tidak secara tegas
dapat diaplikasikan pada semua pasien, troklea selalu mengalami osifikasi
setelah epikondilus medial. Maka, iika pusat penulangan troklea sudah
tampa( pusat penulangan epikondilus medial iuga harus sudah teriadi.
Waspada akan terlewatnya epifisis epikondilus medial yang avulsi!
. pemerikaanyangsekama diperlukan untukmengidentifikasi kemungkinan
adanya fragmen intra-artikular yang lepas.
Radiologi Emergensi 191

Fraktur otekran*$'l

Karakteristik
. Biasanya sekunder akibat fatuh dengan tangan terentang atau akibat
benturan langsung.
. Lebih jarang akibat kontraksi otot trisep dengan siku yang fleksi

Gambaran klinis
. Nyeri yang terlokalisir di atas olekranon. Separasi yang terpalpasi
dapat ditemukan.
. Ketidakmampuan untuk ektensi siku terhadap tahanan mengindikasikan
disrupsi yang komplit.
. Nilai fungsi n. ulna karena cedera dapat terladi.

Gambaran radiologi
AP dan lateral. Displacement paling baik dievaluasi pada posisi fleksi
dengan proyeksi lateral. ;,

Waspada terhadap gambaran epifisis. Epifisis yang bifid adalah normal,


walaupun fusi seharusnya sudah terjadi,pada usia t4 tahun. Kalsifikasi
yang bulat dalam tendon otot trisep juga dapat menyesatkan.
192 Anggota Gerak Atas

I
)
(
)

Avutsi parsia[ dari


epikonditus mediat.
Radiologi Emergensi 193

Fraktur caput radius

Karakteristik
. Secara tipikal akibat gaya yang ditransmisikan sepanjang tulang radius
dengan jatuh pada tangan yang terentang.
. Cedera ligamentum capitullum dan ligamentum kolateral yang
berhubungan merupakan hal yang umum terjadi.

Gambaran klinis
. Nyeri siku dengan nyeri tekan terlokalisir pada caput radius. Lakukan
pronasi dan supinasi ketika menekan caput radius.
. Ekstensi siku dapat terbatas.

. Seringkali garis fraktur sulit diidentifikasi


. Curiga jika anamnesis mendukung dan efusi sendi (posterior fat pad
yang terlihat atau terdorong) terdapat.
. Fraktur caput radius yang disploced atau kominutif yang mudah terlihat
merupakan keadaan yang jarang terjadi.
194 Anggota Gerak Atas

{[
),,
(it
A
Fraktur caput radius
Radiologi Emergensi 195

Fraktur humerus- Fraktur


prokimaI

Karakteristik
. Umum pada populasi orang tua dengan osteoporosis yang jatuh
dengan tangan yang terentang.
. Tergantung pada gaya yang menyebabkan, dislokasi dapat terjadi
secara bersamaan.
. Klasifikasi menurut Neer bergantung pada jumlah dan displacement dari
segmen. Empat segmen yang dideskripsikan adalah: caput, tuberkulum
mayor, tuberkulum minor, dan batang. Displacement didefinisikan
sebagai separasi >1cm atau angulasi >45 derajat.

Crambaran klinis
. Pasien akan mengeluh nyeri dan enggan untuk menggerakan lengannya.
Pasien datang dengan menyokong s_iku dengan tangan kontralateral.
. Deformitas dapat terjadi dengan fnemar disertai atau tanpa disertai
krepitasi. i
. Cek dan dokumentasikan fungsi h. aksilaris.

Gambaran radiologi
. Proyeksi AP yang dikombinasikan dengan oblik apikal atau trans{ateral
diperlukan untuk mengidentifikasi fraktur serta untuk menilai angulasi.
. Garis fraktur harus dinilai sesuai dengan klasifikasi Neer.
. Lipohemartrosis dapat terlihat sebagai fatlfluid level di bawah processus
akromion.
r Hemartrosis yang signifikan dapat mendorong caput humeri ke bawah
dan mengakibatkan pseudo-subluksasi.
. Cari adanya dislokasi yang menyertai (anterior atau posterior).
196 Anggota Gerak Atas

llt
Surgical
nock

tv
Greator
tuboroEity

v
Lossor
tuborosity

K[asifikasi Neer untuk vt


fraktur dan dislokasi Fracture
t humerus bagian proksimal. dislocation
rtl

),,
tt
I

il[

_/'

Fraktur metatui kotum chirurgicum dari humerus (proyeksi AP dan Y)


Radiologi Emergensi 197

Fraktur humerus-Fraktur pada


batang

Karakteristik
o Biasanya diakibatkan benturan langsung
. Terkadang akibat jatuh, atau gerakan memuntir pada tangan yang
terentang.
. Pada keadaan yang jarang, pemah dilaporkan terjadi setelah olahraga
berat akibat kontraksi otot yang hebat.
. Pola fraktur cenderung berhubungan dengan perlekatan otot.

Gambaran klinis
. Lengan biasanya ditopang oleh lengan yang lain.
. Pasien akan mengeluh nyeri. Memar dan angulasi seringkali terdapat.
. Lengan dapat memendek dan mengalami rotasi bergantung pada
displacement tulang.
. Krepitasi sering ditemukan pada fraktur komplit.
. Curiga terhadap kerusakan n. radial jika terdapat wrist-drop atau
gangguan sensorik pada aspek doi.sal dari ft web space.

Gambaran radiotogi
Proyeksi AP dan lateral sangatlah penting karena fraktur disploced
dapat tidak terlihat jika hanya menggunakan satu proyeksi.
o Fraktur cenderung pada r/3 tengah dan bersifat transversal.
a Fraktur inkomplit dapat sangat halus. Cari adanya patahan pada korteks
di tempat nyeri tekan yang paling maksimal.
Jika fraktur terjadi di atas insersi otot pectoralis major, fragmen
proksimal akan mengalami abduksi. Jika antara insersi otot pectoralis
mayor dengan otot deltoideus, fragmen proksimal akan mengalami
adduksi. Jika distal terhadap insersi deltoid, fragmen proksimal akan
mengalami abduksi.
t98 I nnggota Gerak Atas

batang humerus'
Fraktur komptit pada 1 /3 tf,ngah aari
Radiologi Emergensi 199

Fraktur humerus- Fra[qtun


suprakondilar

Karakteristik
. Terjadipada humerus bagian distal, disebelah proksimal dariepikondilus.
. Umum terjadi pada anak-anak berusia antara 5 sampai to tahun.
. Biasanya sekunder terhadap jatuh dengan tangan yang terentang.
. Fraktur diklasifikasi sebagai fraktur ekstensi dan fraktur fleksi tergantung
pada angulasildisplacement dari fragmen fraktur bagian distal.
. Kebanyakan adalah tipe ektensi.

Crambaran klinis
. Curiga dari anamnesis.
. Anak akan mengeluh nyeri dan enggan untuk menggerakkan lengan.
. Deformitas yang nyata dan memar dapat terlihat.
. Tidak seperti dislokasi, hubungan antara olekranon, epikondilus medial
dan epikondilus lateral tetap dipeftahankan.
. Waspada adanya cedera vaskular ke a. brakialis oleh fragmen proksimal.
Selalu nilai sirkulasi dan rujuk: ke ortopedi.

Gambaran radiologi
a Dapatkan proyeksi AP dan lateral dari siku.
a Spektrum abnormalitas dapat ditemukan mulai dari iregularitas kortikal
yang ringan sampai displacement komplit dari fragmen distal humerus
dengan hilangnya kontinuitas.
a Seringkali hanya garis fraktur halus yang dapat terlihat.
a Cari adanya posterior fat pad, anterior fat pad yang menonjol, atau
disrupsi garis humerus anterior. Garis humerus anterior secara normal
melewati t/3 tengah dari capitullum pada proyeksi lateral dari siku.
lngat untuk menerapkan prinsip CRITOL untuk menghindari terlewatinya
cedera epifisis yang konkuren. (lihat permukaan artikular humerus:
fraktur epikondilus/epifisis).
20

A
Fraktur suprakonditar (proyeksi tateral) r metewati
1 /3 anterior dari capitutium akibat di
ke dorsal
sekunder terhadap fraktur. Perhatikan fikan yang
menyertai.

Fraktur suprakondilar Of f - e nd ed f raktur suprakonditar.


yang undisplaced.
Radiologi Emergensi

Fraktur distokasi lvlonteggi a

Karakteristik
. Awalnya dideskripsikan pada tahun r8r4 oleh Monteggia.
. Didefinisikan sebagai fraktur ulna dengan dislokasi caput radius.
Diklasifikasikan lebih lanjut berdasarkan tingkat fraktur dan arah
dislokasi caput radius.
. Merupakan fraktur yang jarang dengan kejadian sekitar t dari t4
fraktur lengan bawah.
o Biasanya setelah jatuh dengan tangan terentang disertai sedikit gaya
pronasi. Dapat juga diakibatkan benturan langsung.

Gambaran klinis
. Terdapat nyeri tekan pada lokasi fraktur yang disertai keterbatasan
pergerakan siku.
. Lengan bawah dapat tampak memendek dan deformitas dari caput
radius yang mengalami dislokasi dapat terlihat.

Gambaran radiologi
Proyeksi AP dan lateral dari lengan bawah yang mencakup siku
diperlukan.
Selalu curiga adanya dislokasi caput radius pada fraktur ulna yang
terisolir.
Periksa dengan seksama elbow view untuk kesegarisan yang normal.
Sebuah garis yang digambar sepanjang sumbu radius harus melewati
pertengahan capitullum baik pada proyeksi AP maupun lateral. lni
dikenal sebagai radiocapitellar line.
Waspada pada anak-anak karena fraktur Creenstick yang halus dapat
terlewati. Selalu periksa posisi caput radius pada semua proyeki dan
nilai deformitas yang kecil pada ulna.
Sebuah cara yang bermanfaat untu mengingat tipe fraktur lengan
bawah ini adalah dengan akronim 'BUM'-Broken Ulna Monteggia.
Fraktur Monteggia. Rodiocapitellar line tidak melewati capituttum akibat
dislokasi caput radius.

A
Fraktur Monteggia
Radiologi Emergensi 203

Fraktur skaputa

KaraKeristik
. Merupakan cedera yang jarang karena skapula bersifat mobil dan
tertutup oleh otot.
o Biasanya akibat jatuh dari ketinggian atau gaya dengan kecepatan
tinggi, seperti kecelakaan lalu lintas.
. Klasifikasi berdasarkan tempat:
0 Melibatkan badan atau spina dari skapula.
0 Fraktur akromion atau processus korakoid.
0 Melibatkan leher skapula atau fossa glenoidalis.
. Akibat sifat dari cedera, fraktur skapula biasanya berhubungan dengan
cedera intratorakal.

Gambaran klinis
. Pasien yang sadar akan mengeluh nyeri dan memegang lengan dalam
keadaan adduksi.
. Krepitasi fraktur dan nyeri tekan terdapat pada lokasi fraktur.
. Cedera dapat menyerupai robelian rotator cuff.
. Waspada akan terlewatnya fraktur skapqla pada pasien dengan trauma
multipel.

Gambaran radiologi
Foto toraks AP seringkali akan memperlihatkan fraktur. Proyeksi lebih
lanjut termasuk proyeki akila lateral akan bermanfaat.
a CT bermanfaat pada fraktur leher skapula dan fossa glenoidalis.
a Pada 3% populasi, epifisis akromion yang tidak bersatu (os acromiale)
dapat terlihat dan bisa disalahartikan sebagai fraktur akromion.
Pembandingan dengan sisi yang sehat berguna karena keadaan ini
bersifat bilateral pada 6o% pasien.
I
a

d
x
4
7

Fraktur melalui tutang skaputa G

G
AT
t

Fraktur skapula kompleks


dengan glenoid yang
tertepas dan fraktur
processus korakoid.
Radiologi Emergensi 205

Distokasi sendf bahu

Karakteristik
. Sendi glenohumeral merupakan sendi yang paling sering mengalami
dislokasi.
. Berhubungan dengan stabilitas tulang yang kurang.
. Distribusi umur bimodal - umur pria zo-3o tahun dan wanita 5o-8o
tahun.
. Angka kejadian dislokasi ke anterior, posterior, dan inferior terjadi
dalam frekuensi yang secara berurutan semakin menurun.
. Dislokasi ke anterior biasanya sekunder akibat jatuh. Labrum yang
terlepas menyebabkan caput humeri mengalami dislokasi ke anterior.
. Pada dislokasi ke posterior, caput humeri mengalami displaced secara
langsung ke belakang dan biasanya sekunder akibat benturan langsung
atau jatuh dengan tangan yang rotasi internal. Keadaan ini dapat
terjadi pada bayi yang persalinannya yang sulit.

Gambaran klinis
. Nyeri, deformitas, dan keengganan untuk menggerakan lengan. Lengan
seringkali distabilisasi pada siku oleh pasien.
. Pada keadaan yang jarang, pada .dislokasi ke anterior, bisa terdapat
kerusakan pada a. aksilaris, Palsi n. aksilaris merupakan cedera
neurologis yang paling umum dan oleh karena itu penilaian area
regimental badge dan kontraki deltoid.sejauh rasa nyeri masih dapat
ditahan, adalah penting.

Gambaran radiologi
Anterior
. Kebanyakan terlihat dengan baik pada proyeksi standar AP. Proyeksi
akial atau apikal dapat dilakukan jika terdapat keraguan. Tuberositas
mayor bisa fraktur.
. Lesi Hill-Sachs: Depresi pada aspek postero-lateral dari caput humeri;
sering pada dislokasi yang rekuren karena caput humeri membentur
glenoid.
, Bankart lesion: Defek pada labrum anterior glenoid yang terlihat paling
baik dengan pemeriksaan MRl.
. Distorsi bulbosa pada arkus skapulo-humeral.
zo6 I nnggota Gerak Atas

Posterior
. paling baik terlihat dengan prol:ktl aksilaris'
p'al-pi"V"ksi AP dan pelebaran celah gleno-humeral
o Tanda light-bulb
(>6mm).
. sudut taiam yang abnormal'
Arkus skapulo-humeral dapat memiliki
. Tanda trough ril;ilakan fraktur kompresi dari permukaan
sebagai garis sklerotik yang
paralel
antero_medial hrinzrus, terlihat
dengan Permukaan sendi'

<l
I
I

Distokasi ke anterior dari sendi


bahu eroyeki {:ll,tktn*"ngkonfirmasi
glenoid'
A:Processus acromion' G:Fossa
oosisi anterior dari caput l'tumeri'
C:Processus korakoid'
Radiologi Emergensi

Dislokasi ke posterior dari


sendi bahu. Sutit untuk
melakukan proyeksi aksia[
pada pasien-pasien ini
karena mereka seringka[i
sutit melakukan abduksi
lengan untuk pemeriksaan
radiotogi ini.
Fraktur skapoid

Kamkteristik
. Fraktur karpal yang paling sering, bertanggung jawab untuk sekitar
6o% dan seluruh fraktur karPal.
. Ditemukan pada dewasa muda setelah jatuh dengan tangan yang
terentang.
. Diklasifikasi berdasarkan lokasi:
0 Tuberositas dan Polus Proksimal
0 Pinggang
0 Polus distal
. Fraktur melalui pinggang skapoid merupakan yang paling sering.
. Suplai darah ke skapoid seringkali masuk melalui polus distal dan
4t
x berjalan ke proksimal. Maka pada fraktur pinggang skapoid, aliran
darah dapat terganggu yang menyebabkan nekrosis avaskular pada
I fragmen proksimal.
,

Gambaran klinis
. Pasien akan mengeluh nyeri pada pergelangan tangan atau tangan
dengan keterbatasan pada pergerakan pergelangan tangan'
. pemeriksaan adanya nyeri tekan di anatomical snuff box (ASB), di
atas tuberkulum skapoid (volar-basis dari eminentia thenar), nyeri pada
kompresi akial pada ibu jari dan pada supinasi yang tertahan pada
pergelangan tangan. i
. Nyeri tekan dapat diakibatkan fraktur pada strulftur yang berdekatan,
seperti pada basis ibu jari atau pr ocessus styloideus rbdius'

Gambaran radiologi
. Scophoid view masih direkomendasi jika ada kecurigaan.
. Fraktur seringkali sulit untuk dilihat dan elongoted magnified view
dapat bermanfaat.
. Pada proyeksi PA, hilangnya navicular fat stripe sugestif ke arah
fraktur skapoid.
. Waspada terhadap tulang sesamoid, karena gambaran ini dapat
disalahartikan sebagai fraktur. Os centrale dapat terlihat dekat dengan
polus distal dan dapat berukuran kecil, besar atau ganda'
. Skapoid bi-portite mungkin disebabkan cedera lama yang tidak menyatu.
Cambaran ini paling baik dibedakan dengan fraktur akut dari permukaan
halus dan bundar pada fragmen-fragmen yang berdekatan'
Radiologi Emergensi

A
Fraktur metatui pinggang skapoid'

Nekrosis avaskular Pada


bagian proksimal dari skaPoid
zto I nnggota Gerak Atas

Fraktur metakarpa[ ibu iari

Karakteristik
. Relatif iarang.
.Kebanyakanfrakturmelibatkanbasisibujaridandiklasifikasisebagai
fraktur intra atau ekstra ariikular'
oTipeyangUmumdarifrakturintra.artikulartelahdideskripsikanoleh
.d Bennett dan Rolando'
terhadap gaya abduksi pada
ibu iari
'l . Umumnya sekunder

Gambaran klinis
tampak' Deformitas atau
. Nyeri, bengkak dan memar seringkali
'^ototign^"it
Ir dapat tampak pada ibu iari'
ibu jari dan terdapat nyeri di
o Pasien enggan untuk menggerakkan
sekitar Uasis iuu ;aii khusui-ya
di sebelah distal dari ASB'

Gambaran radiologi I

.ProyeksiAPdanlateralbermanfaatdenganpr6yeksiobliksebagai
Pilihan alternatif'
sterlihatmasih mempertahankan
. FrakturBennet:
kesegarisan
ke dorsal dan
de Ir1JHlT"ilrur,'"',J;jl:'"*"'
meluas ke sendi
o Fraktur Fraktur pada basis ibu jari yang
Rolandoz
memiliki gambaran V atau T dan
trapezio-metafJrpal' Garis fraktur lebih mencolok'
cenderung *o*inltit oleh karena itu secara visr'Llterlihat
.FraktureKtra.artikular:FrakturinimudahterlihatdankurangPenting
secara umum'
Radiologi Emergensi 211

Fraktur Bennet.
{
),t
4
I
Radiologi Emergensi 213

I
I
Tulang-tulang akesoris di kaki 214
Fraktur pergelangan kaki 216
Fraktur katkaneus 219
Distokasi panggut - Traumatik 222
Fraktur kolum femoris 224
Fraktur korpus femoris 227
Fraktur basis metatarsal ketima 230
lritasi panggul 232
'. Cedera Lisfranc 234
' Fraktur patetla 236
Fraktur petvis 239
Penyakit Perthes 242
Slipped upryr femoral epiphysis 24
Fraktur ptat tibia 24
Fraktur korpus tibia 74
2'14 Anggota Gerak Bawah

Tutang-tutang aksesoris di kaki

Biasanya terlihat di pada proyeki pedis dan ankle view. Tulang-tulang


ini diidentifikasi dari posisi dan gambaran korteks yang membundar'
Diagram di bawah ini menggambarkan secara detil tulang-tulang
aksesoris di kaki.

(1) Os tibiale externum (9) Os suPratalare


(2) Processus uncinatus (10) Tatus accessorius
(3) Os intercuneiforme (11) Os sustentaculum
(4) Pars peronea metatarsatia (121 Os trigonum
(5) Cuboides secundarium (13) Catcaneussecundarius
(6) Os peroneum (14) Os subcatcis
(7) Os vesalianum (15) Os supranavicutare
(8) Os intermetatarseum (16) Os talotibiate
Radiologi Emergensi
zt6 I nnggota Gerak Bawah

Fraktur Pergelangan kaki

Karakteristik
. yang dapat mengakibatkan
Frakturteriadi secara sekunder akibat kekuatan
deformasi atau cedera traksi'
. ketinggian fraktur fibula'
Danis-weber membuat klasifikasi berdasarkan
0WeberA:Frakturpadadistaldarisindesmosis(senditibio-fibular
distal)
0WeberB:Padalevelsindesmosis(frakturspiralbermuladariplafon
tibia dan meluas ke bagian proksimal'
0WeberC:Diataslevelsindesmosisdandisertairobekanmembran
interossea.
0 Perhatikan bahwa tipe B dan C bersifat tidakcedera stabil'
pada struktur
Kl,asi pi tidak memperhitungkan
'Penjetasan matteotus yang tertibat (taterat'
Lain tokasi
med penjetasan ada tidaknya disrupsi sendi mortis
informasi yang bermanfaat' tatus
atau pergeseran tatus, merupakan .Ketika
kaki mengatami
tidak berada ai o"*ln ptafon tibia, berarti pergetengan
distokasi.

Gambaran klinis r"

.Pasienakandatangdengannyeridisekitarsendipergelangankaki
dan tidak dapat bertumpu pada kakinya'
. pemeriksaan akan memperlihatkan bengkak, deformitas yang nyata,
memar, dan nyeri tekan tulang yang terlokalisir'
harus
. Adanya deformitas yang nyata atau gangguan neurovaskular
ditatalaksana sebagai keadaan emergensi'

@mbaran radiologi
. Proyeksi AP dan lateral merupakan proyeksi yang
penting'

.Waspada:janganmengirimkanpasiendengandeformitasyangnyata
ke departemen
(curiga dislot<a'si) atau Jengan gangguan neurovaskular
iebelum diperiksa secara radiologi.
iaOijogi. Reduksi terleUih-dah rlu
Radiologi Emergensi 217

Jika terdapat fraktur fibula, maka nilai ketinggian, displacement dan


polanya.
a Pikirkan kemungkinan fraktur fibula proksimal dan foto jika nyeri.
a Nilai sendi mortis apakah uniform. Celah antara malleolus medial dan
talus harus berukuran sama dengan jarak antara permukaan distal
tibia dengan talus.
Nilai jarak tibio-fibular distal sebagai panduan terhadap adanya disrupsi
sindesmosis/ligamentum tibio-fibular.

$!ri
U'

Fraktur-dislokasi pada pergelangan kaki kanan. lni merupakan foto x-ray


yang seharusnya tidak boteh didapatkan karena pasien dengan distokasi
sendi ini harus sudah direduksi sebelum difoto.
Anggota Gerak Bawah

t(

Fraktur pergelangan kaki


tiPe Weber C
Radiologi Emergensi 219

Fraktur kalkaneus
Karakteristik
. Fraktur tulang tarsal yang paling sering dan merupakan tulang tarsal
terbesar.
. Sembilan puluh lima persen teriadi pada orang dewasa dan biasanya
bilateral.
. Mekanisme cedera yang paling umum adalah akibat beban aksial
seperti jatuh dari ketinggian.
. Akibat mekanisme cedera tersebut, seringkali terdapat cedera multipel
yang berhubungan sepefti fraktur kalkaneus di kaki yang lain, fraktur
femur dan asetabulum, sefta fraktur kompresi pada tulang belakang.
. Seringkali diklasifikasi sebagai fraktur intra-ekstra artikular.

Gambaran klinis
. Curiladari riwayat seperti jatuh dari ketinggian.
. Nyeri dan bengkak berhubungan dengan ketidakmampuan menahan
beban.
. Tumit akan tampak memendek dan melebar ketika dilihat dari belakang.
o Memar yang meluas sepanjang alas kaki cenderung membedakannya
dari fraktur pergelangan kaki.
. Waspada akan sindroma komparter.nen.

Gambaran radiotogi
Proyeksi AP dan lateral pergelangan kaki harus diambil. Proyeki AP
memungkinkan visualisasi sendi kalkaneo-kuboid dan permukaan antero-
superior dari kalkaneus. Proyeksi lateral paling baik dalam memperlihatkan
permukaan posterior dan berguna untuk memperlihatkan kompresi.
Fraktur kompresi minimal dapat dicurigai melalui penilaian sudut
Boehler (lihat diagram). Jika sudut menurun di bawah 2oo, fraktur
harus dicurigai. Pembandingan dengan sisi yang sehat (jikat tidak
fraktur) dapat bermanfaat.
Proyeksi akial dari kalkaneus, jika dapat ditolerir, maka akan membantu
visualisasi fraktur.
Akibat sifat fraktur kalkaneus yang kompleks, radiografi polos seringkali
mengesankan kerusakan yang lebih ringan darisebenamya. Pemeriksaan
CT berguna baik untuk menilai cedera maupun untuk merencanakan
rekonstruksi.
zzo I nnggota Gerak Bawah

Diagram Yang
mempertihatkan sudut
Boehler

-n,

:
I

tl

lil
Proyeksi taterat dari fraktr-ir
kalkaneus

Proyeksi katkaneus.
Radiologi Emergensi

^l-
Sudut Boehter < 200 yang mempertihatkan adanya fraktur depresi pada
tulang katkaneus.
Distokasi panggul - Traumatik

tGrakteristik
. Mekanismecederabiasanyamelibatkankekuatanmasifyangditransmisikan
sepanjang batang femur, seperti cedera dashboard pada kecelakaan
lalu lintas atau cedera punggung pada seseorang yang sedang berlutut.
. Dislokasi ke posterior (merupakan yang paling sering) cenderung teriadi
ketika panggul dalam keadaan fleki dan adduksi saat teriadi benturan.
- it . Seringkali diasosiasikan dengan cedera lain seperti fraktur patella atau
fraktur asetabulum Posterior.

a Gambaran klinis
)a
o Secara klasik pada dislokasi ke posterior, panggul dalam keadaan
fleksi, memendek, adduksi dan rotasi ke dalam (bandingkan dengan
fraktur leher femur).
. Nyeri cenderung sangat menyakitkan. Dapat tereduki secara spontan
jika disertai dengan fraktur asetabulum-
. Cedera n. skiatik merupakan temuan yang umum (traksi dan kompresi).

Crambaran radiologi
. Abnormalitas biasanya tampak jelas pada proyqki AP. Proyeksi lateral
direkomendasikan pada semua kasus untuk rnembantu menentukan
arah dislokasi ke posterior atau anterior dan untuk memperlihatkan
dislokasi yang sulit terlihat.
. Pada dislokasi ke posterior, caPut femoris tampak lebih kecil jika
dibandingkan dengan sisi yang sehat pada proyeksi AP. sebaliknya pada
distokasi ke anterior, caput femoris tampak lebih besar (berhubungan
dengan magnifikasi, dengan alasan yang sama di mana iantung tampak
lebih besar pada proyeki AP)'
. Lihat trokanter minor - bertumpang tindih dengan batang femur pada
dislokasi ke posterior sementara terlihat in profile pada dislokasi ke
anterior (berhubungan dengan rotasi ke intemal/eksternal).
. Cari keterlibatan asetabulum karena hal ini mempengaruhi kemungkinan
kerusakan n. skiatik, stabilitas dan akibat fungsional iangka panjang'
. Selalu nilai cincin pelvis secara utuh karena fraktur/disrupsi sering
ditemukan.
Radiologi Emergensi 223

Distokasi panggu[ kiri ke posterosuperior. Tampak caput femoris kiri yang


tebih kecit daripada caput femoris kanan.

Proyeksi latera[ mempertihatkan dislokasi ke posterior. Asetabutum,


H:caput femoris.
224 Anggota Gerak Bawah

Fraktur kolum femoris

Karakteristik
. PeninElkatan insidensi dengan usia diduga
akibat penurunan densitas
tulang.
. Umum pada wanita tua; di bawah usia 6o
tahun' pria terkena lebih
sering (biasanya fraktur ekstrakapsular)'
. berbagai macam
Terlihat lebih sering pada pasien yang mendapat
dan turosemto'
obat, seperti kortikosteroid, tiroksin' fenitoin
. Kebanyakan berhubungan dengan trauma
mi or'
. femoris terganggu)
Diba'i menjadi fraktur intra- (suplai darah ke caput
Fraktur diklasifikasi lebih
dan ekstra-kapsular (suplai dirah tetap baik).
dibagi lagi meniadi
Ianjut berdasart<an teiinggian anatomis. lntra-kapsular
I subkapital,transervikal"d"anbasiservikal.Ekstra-kapsularberhubungan
dengan fraktur pertrokanterik (atau intertrokanterik)'
.FrakturintrakapsulardiklasifikasimenurutGardenmenjadi4tingkat:
0 lncomplete Kofteks inferior tidak patah secara komplit'
terganggu namun
0 Complete Korteks inferior patah' Pola trabekula
tidak terdaPat angulasi'
0 Stightly disploced: Pola trabekula yang angulasi'
0Fullydisploced:Tingkatpalingparah'seringkalitidakterdapat
kontinuitas tulang'

Gambaran ktinis i
.Ketidakmampuanmenahanbeban.Waspadakarenaterkadangpasien
dapat bergerak.
o Secara klasi( tungkai memendek dan rotasi ke eksterna'
. Nyeri pada rotasi dan nyeri tekan di atas kolum femoris'

Gambaran radiologi
.ProyeksiAPdanlateralbiasanyaakanmemperlihatkangarisfraktur.
.Carikeadaanasimetris.BandingkanShenton,slinepadaproyeksiAP.
pada proyeksi lateral, periksalngulasi caput dibandingkan dengan
kolum femoris.
. dari disrupsi pola
Fraktur yang kecil mungkin hanya dapat dikenali
trabekula.
.Jikamencurigakan'namuntidakterlihatfraktur,makabonescandalam
48 iam atau lebih dapat bermanfaat'
Radiologi Emergensi 225

|Ga.d""-l--tifi."tion-l

Grade lll
Complete Fracture Complete Fracture Complete Fracture
Undisplaced Partially disptaced Fully disptaced
Trabeculae aligned Trabeculae unaligned Trabeculae disrupted
Vascutarity preserved Blood suppty damaged but lschaemic
fragment still connected by
posterior retinacular
attachment

Tipe dan ktasifikasi fraktur femur bagian proksimat. Perhatikan: pada


ktasifikasi Gorden grade lll dan lV, suptai darah terganggu.

Fraktur kolum femoris


kanan.
Anggota Gerak Bawah

A
Fraktur kotum femoris kiri. Perhatikan disrupsi dari Shenton's
|ine'
Radiologi Emergensi 227

Fraktur korpus femoris

lGrakteristik
. Dibagi menjadi fraktur t/3 proksimal, tengah, dan distal.
' Kekuatan dalam jumlah besar diperlukan, seperti kecerakaan lalu lintas,
crush injury atau jatuh dari ketinggian.
o Fraktur patologis terlihat berkaitan dengan fikasi internal, osteoporosis
dan keganasan.
' Komplikasi yang harus diwaspadai adalah syok perdarahah (pasien
dapat kehilangan antara r sampai z liter darah bergantung pada
apakah fraktur terbuka atau tertutup), emboli lemak, kegagalan
menyatu dan infeki.

Gambaran klinis
o Nyeri, bengkak, nyeri tekan, deformitas dan kehilangan fungsi
mengindikasikan adanya fraktur.
' Deformitas bervariasi bergantung pada tingkat fraktur dalam kaitannya
dengan perlekatan otot dan aksinya.
r Femur yang membesar secara cepat mengesankan adanya perdarahan
yang besar dan sedang berlangsung.,,.
' waspada akan adanya cedera lain 'yang terlibat, seperti cedera
ligamentum lutut fraktur/dislokasi panggul dan fraktur suprakondilar,
yang mana semuanya dapat sulit dinilai.
. Kerusakan vaskular/neurologis dapat terjadi dan harus dicari.

Gambaran radiologi
. Dua proyeki diperlukan untuk menilai displacement.
' Kebanyakan terlihat sebagai fraktur transversal sederhana. Fraktur
oblik dan spiral lebih jarang.
228 Anggota Gerak Bawah

Fraktur kominutif Pada


sepertiga distaI korPus
femoris.
Emergensi

(a) Fraktur korpus femoris kominutif, (b) Fraktur korpus femoris pasca
fiksasi interna.
230 I Gerak Bawah
^**."

Fraktur basis metatarsal kelima

Karakteristik
. Fraktur paling sering dari anggota gerak bawah'
. Harus dianggap sebagai dua kesatuan yang berbeda, karena berbeda
dalam mekanisme, terapi, dan prognosis.
0 Froktur tuberositas: Bentuk yang paling umum. Sekunder akibat
cedera inversi pada kaki yang plantar fleksi. Awalnya dianggap
sebagai fraktur avutsi pada temPat insersi Peroneus brevis,
walaupun akhir-akhir ini lateral bond dari aponeurosis plantar iuga
dianggap terlibat. Tipe cedera berkisar dari avulsi kecil sampai
fraktur seluruh tuberositas.
0 Fraktur )ones: Fraktur diafisis yang terjadi sekitar t,5cm dari
basis (perbatasan metafisis dan diafisis). Lebih serius dari fraktur
tuberositas. Biasanya disebabkan kombinasi kekuatan yang dihasilkan
saat berlari atau berlomPat.

Gambaran klinis
. Nyeri dan nyeri tekan pada lokasi fraktur walaupun terkadang dirasakan
difus dan kurang ielas.
. Hati-hati agar tidak melewati cedera ini pada pasien dengan pergelangan
kaki yang terkilir. i
o lnversi pasif akan terasa sakit.

Gambaran radiologi
a Selalu perhatikan basis metatarsal kelima pada ankle view'
a Garis fraktur transversal pada sudut yang tepat terhadap aksis metatarsal.
a Jika fragmen berukuran kecil, fraktur seringkali melibatkan persendian
dengan tulang kuboid.
a Separasi fragmen daPat terlihat.
a Fraktur Jones secara klasik meluas ke persendian inter-metatarsal.
a Jangan keliru dengan garis epifisis pada anak-anak. Kelainan ini paralel
dengan batang, oleh karena itu fraktur yang melalui epifisis dapat teriadi.
Radiologi Emergensi 231

Fraktur basis metatarsaI ketima Avutsi parsial dari aPofisis Pada


basis metatarsal ketima

Fraktur spiraI metatarsal Setatu ingat untuk memeriksa basis


ketima metatarsa[ ketima pada ankle X-ray.
lritasi panggul

Kamkteristik
. Sinovitis sementara
. Penyebab paling sering dari nyeri panggul non-traumatik'
o Biasanya unilateral dengan penyebab yang tidak diketahui'
. Usia berkisar dari 9 bulan sampai t8 tahun dengan puncak 5 tahun.
. Banyak pasien yang memiliki riwayat penyakit sebelum seperti infeksi
traktus respiratorius.
o Penting untuk mengeksklusi artritis septik.
o Pertimbangkan adanya tuberkulosis tulang panggul!

Gambaran klinis
. Datang dengan berbagai macam cara termasuk ketidakmampuan
mengangkat beban atau nyeri panggul/paha/lutut.
. Onset dapat mendadak atau bertahap dalam bebergpa hari.
. Geiala cenderung untuk sembuh secara spontan setelah beberapa hari'
. Pada pemeriksaan, gerakan pasif biasanya normal.

Gambaran radiologi
. Radiografi dari lutut, femur, dan panggul biasanya normal.
. Terkadang efusi panggul dapat terlihat pada radiografi polos.
. USG merupakan modalitas pencitraan terpilih (sensitivitas >95%).
Perbedaan >3mm antara sisi yang normal dan sisi yang terlibat
dianggap patologis.
. USG kurang baik dalam membedakan antara efusi, darah dan pus.
Radiologi Emergensi 233

Waspada, radiografi potos


dapat tampak normat.

,.^.
Namun pemeriksaan USG mempeflihatkan efusi panggut kiri yang signifikan
(E)

HasiI akhir dari artritis


septik yang tertewati.
Bawah
234 Anggota Gerak

Cedera Lisfranc

Karakteristi ' t"ldi t"'?l-lt."a


-^^Ai+1rc'o-metatarsal'
maka dislokasi
atau

. Sendi Lisfroncterdiri dari Lisfronc.

.
'
g*H*'i::*' ::ilJ[ '1HTT'I"J|, i$,T[#:3:*1lf
;";;""tuk sendi dan liga ,uu'a"n ying amat besar'
'i)i", ,ia", di area ini
'--
i,i rotasionat dengan
o Mekanism I itau crush .in1ury'
kecelakaan olahraga
'rr tungkai b t;;"
-a"ri
b
."a"tu yang sepele'
. Kebanyak
walauPun

{
: metatarsal iHL';
$J-1",',lg,i"i:rr::"':-1i'E[ii':*
0 Tulang
ke arah vans sama'

" Homolateroi: sampai lima


;;n; ke lateral' -rtuk metatarsal dua
o ii"'gn: Dislokasi tt: lut"t3''''ul
untuk metatarsal
satu'
a'n ai'rortlii'"l<e*
'"J'"t
Gambamn ktinis --u^,ran nasien vang
mengeluh
wasp-a11fi'J
.' curiga oari anamnesis' namun di::';;;;; i:::"1"1?l-a"i"io'r:
terkilir "*
letidakmampuan
untuk
;";J'"gan t<.at''i
''$"*:*{*#,'l'iil:1|ilr"T,},il-.#Hr*gan,unakvang
o Parestesia bisa terdaPat-d* i:ij
kompartemen'
berat, curigai'inator.n'

radiotogi lunak dan kontur


tis'dari atignment'iaringan
:Hf"
turan yang pentins. proyeks:lr_T;Iff:Ui:ill,
o proye
aat.

kese *'::Ilj*"[ilffi
'':'*::;:i, untuk menilai Pergest iuii'i"v-,-]leran ke dorsar
I berguna ;"Gecek kesegarisan
kedui untuk mengec
"[:['r;i;k
oititt berguna
atau "tt'i
tarso-metatarsal' ---isan tampakyl*,1t1:fi'i:ffi1
fraktur dan kesegar
Jika terdapat dan stress vrew
' u-; umum)
redurci
'p##;: '*"riadi pemeriksaan sugestif'
(seringkaliiro* "&esi amnesis serta
. iika'"*'iJio;|31"[Hffi fi: ffi;;;;- tgo^"n'ou' comptex'
mungkin 1
Radiologi Emergensi

Fraktur Li sf ranc homolateral

Fraktur Li sf ronc divergen


Fraktur patetl"a
Karakteristik
' Tulang sesamoid terbesar di tubuh. Membentuk
sebagian dari
mekanisme ekstensor rutut dan posisinya dipertahankan
oreh tendon
patella, quadriceps serta retinakula yang
di sekitamya.
' Diklasifikasi menurut tempat dan tampirannya
- fraktur vertikar,
transversal, stelat (kominutif),,olar atau osteokondral.
' semua kecuari avursi kecir di pinggir, dianggap
sebagai intrakapsurar.
' Biasanya akibat kekuatan langsung seperti
rutut yang membentur
dashboard pada kecerakaan raru linias atau
benda berlt yang jatuh
pada lutut.
' Juga dapat diakibatkan kekuatan tidak langsung
seperti kontraksi otot
yang hebat. Har ini juga dapat mengakibaikan"ruptur
a"naon patera,
robekan quadriceps atau avulsi tuberositas tibia.
' Fraktur yang paring umum adarah tipe transversar
yang berasar dari
kontraksi otot hebat yang dihantarkan ke patera.
displaced.
ripl ini biasanya

Gambalan klinis I
. Curiga dari mekanisme cedera.
' Kebanyakan kasus memperrihatkan ketidakmampuan
ekstensi.rutut
walaupun bisa saja tidak disertai hal tersebut.
' Pemeriksaan krinis dapat memperrihatkan
memar dan abrasi; rekukan
yang terpalpasi di tempat nyeri tekan
atau displacement p;teila ke
proksimal.

' waspada terhadap. cedera yang menyertai, seperti


fraktur korum/korpus
femoris atau dislokasi caput femoris.

Gambaran radiologi
' Proyeksi Ap dan laterar bermanfaat. pada
beberapa kasus skyrine
view berguna namun seringkari surit untuk
didapatkan pada fase akut
karena diperlukan fleksi luiut.
' Fraktur biasanya nyata. cari adanya lipohemartrosis
pada horizontar
beam lateral.
waspada terhadap p |;biasanya
terjadi pada aspek ::^;
+agmen ."nJ"i*g ;t"Ij#
batas non-sklerotik
Pemeriksaan MRI berguna pada kasus_kasus
fraktur yang minimal.
Radiologi Emergensi 237

Fraktur transversaI pada patetla


:.-=_-:: Cerak Bawah

Fraktur steIat

Fraktur vertikaI
Radiologi Emergensi 239

Fraktur pelvis
lGrakteristik
o Biasanya sekunder akibat kekuatan yang masif, seperti kecelakaan lalu
lintas atau jatuh dari ketinggian.
. Dapat disertai dengan cedera vaskular, iaringan lunak dan viseral.
. Jika cincin pelvis patah menjadi dua bagian, fraktur kemungkinan besar
tidak stabil - jangan lupa sendi sakroiliaka sebagai lokasi disrupsi.
. Fralcur cincin pelvis yang tunggal biasanya stabil.
Klasifikasi Tile:
A- Stabil: Tidak melibatkan cincin pelvis (e.g. fraktur avulsi) atau
melibatkan cincin pelvis tetapi displacement minimal (fraktur ramus
pubis).
B- Stabil secara vertikal, tidak stabil secara rotasional: Kompresi AP
(open book) dan kompresi lateral (e.g. fraktur ramus dengan
crushing injury dari sendi sakroiliaka).
C- Tidak stabil: Disrupsi cincin pelvis pada dua atau lebih lokasi (e.g.
fraktur rami bilateral atau disrupsi simfisis pubis).

Gambaran klinis
. Curiga dari anamnesis.
. Syok perdarahan umumnya terlihat akibat sifat vaskular dari tulang
pelvis, berdekatan dengan pembuluh darah besar dan kelompok
otot-otot besar.
. Syok seringkali disebabkan juga oleh perdarahan dari cedera yang
menyertai di rongga torak, abdomen dan ektremitas.
. Waspada akan disrupsi traktus urogenital dan rektal - cari tanda
memar di perineum, prostat letak tinggi atau tidak teraba, dan darah
pada meatus uretra.
. Pemeriksaan pelvis yang cermat dapat memperlihatkan instabilitas.
Hindari pemerikaan yang berulang.
. Pada orang tua, dapat datang dengan keluhan yang serupa dengan
fraktur kolum femoris.

Gambaran radiologi
Dapatkan pelvic view pada pasien dengan trauma multipel dan pasien
dengan syok yang tak terielaskan setelah trauma.
Nilai cincin pe.lvis untuk melihat ada tidaknya step atau keadaaan
asimetris.
Bandingkan bagian per bagian, sambil diingat adanya perbedaan
akibat rotasi.
Selalu periksa dengan seksama ramus pubis dan asetabulum pada
pasien tua dengan kecurigaan fraktur kolum femoris.
CT merupakan modalitas yang berguna untuk menilai tingkat
keparahan, memperlihatkan cedera yang menyertai dan membantu
dalam perencanaan pembedahan.
Anggota Gerak Bawah

lngat nitai cincin pelvis untuk ada tidaknya step dan keadaan asimetris.

Fraktur ramus pubis superior dan inferior


Radiologi Emergensi 241

Diastasis simfisis

Fraktur pelvis setetah kecetakaan latu lintas

IJ
:-:gota Cerak Bawah

Penyakit perthes

lGrakteristik
. suatu bentuk nekrosis aseptik dari caput femoris, kemungkinan akibat
disrupsi suplai darah ke epifisis femur.
. Paling sering antara usia 4 dan g tahun.
. Didominasi oleh pria dengan rasio 5:r.
. Terjadi pada r dari ro.ooo dan bilateral pada ro% kasus.

Gambaran klinis
' Pasien datang dengan keadaan pincang atau jika bilateral dengan
painful gait.
. Nyeri alih bisa ke lutut dan paha sebelah dalim.
' Pada pemeriksaan, abduki panggul dan rotasi intema terbatas.
o onset dapat tidak jelas sehingga anak dapat datang terlambat dengan
pemendekan pada sisi yang terkena dan atrofi karena otot tidak
digunakan.

Gambaran radiologi
' Gambaran radiologi biasanya terrihat baik saat kedatangan.
. Epifisis femur tampak lebih kecil pada sisi yang teikena.
o sklerosis caput femoris dengan deminerarisasi turang di dekatnya.
o Sedikit pelebaran celah sendi.
. Area lusen di metafisis.
. Fraktur subkondral paling baik dilihat dengan
frog view.
o Fragmentasi sklerotik dari caput femoris.
' coxa magna - pelebamn caput dan korum femoris akibat remodeiling.
o cr dapat memperlihatkan kehirangan pora trabekura yang normar.
o Bone scan akan memperrihatkan penurunan ambiran yang diikuti
dengan peningkatan ambiran ketika proses perbaikan dan perubahan
degenerasi sekunder mendominasi.
' Pemerikaan MRr sensitif dengan tampilan yang bervariasi bergantung
fase.
Radiologi Emergensi 243

Nekrosis aseptik pada epifisis femur kanan

,^
Penyakit Perthes tahap lanjut. Perhatikan remodelling caput femoris
kanan yang disertai coxo magno.
Anggota Gerak Bawah

Slipped upper d pip fs

Karakteristik
. Penyakit panggul yang paling sering pada remaja (pria:r3-r6 tahun,
wanita:rr-r4 tahun).
. Lebih banyak pada pria dengan rasio 3 : r.
. Terjadi pada kurang lebih z dari roo.ooo.
. Tampak lebih sering pada pasien dengan obesitas.
o Etiologi tidak diketahui, walaupun teori genetik dan traumatik telah
diusulkan.

' Biasanya terlihit selama fase peftumbuhan yang cepat ketika epifisis
lebih rentan terhadap shear forces.
. Riwayat trauma terdapat pada 5o% kasus.
' Enam puluh persen terjadi secara bilateral dan oleh karena itu
pemantauan penting.

Gambaran klinis
' Datang dengan nyeri dan kepincangan, tidak selalu harus terlokalisasi
di panggul.

' Bergantung pada kronisitas, pemendekan tungkai dengan sedikit rotasi


ekterna dapat terjadi. Atrofi otot terjadi pada kasus'yang lanjut.
. Nyeri dan rotasi interna yang terbatas pada pemqrikaan.
. Pikirkan ke arah kronis jika gejala lebih dari 3 mirflgu.

Gambaran radiotogi
. Proyeki PA dan frog view merupakan standar.
. Pelebaran epifisis dengan iregularitas metafisis.
' Displacement caput femoris ke postero-medial; hal ini terlihat sebagai
kegagalan garis yang digambar sepanjang kolum femoris untuk
memotong caput femoris. Garis ini disebut sebagai Line of Ktein
. Epifisis tampak lebih kecil akibat posterior slippage.
. Slippage dapat hanya terlihat pada frog leg view.
. Pembentukan tulang baru (buttressing) telat terjadi.
' Temuan lanjut meliputi sklerosis subkondral, pembentukan kista,
pembentukan osteofit dan penyempitan celah sendi.

' USG dapat bermanfaat untuk memperlihatkan efusi pada slippage dini.
Radiologi Emergensi

Slipped femorol capitol epiphysis kanan. perhatikan line of Ktein tidak


memotong epifisis caput femoris kanan.

Frog leg laterol: slipped femorar capital epiphysis postero-mediat kanan.


246 Anggota Gerak Bawah

Fraktur ptat tibia

lGrakteristik
. Meningkat pada orang tua (sekitar to% fraktur terlihat pada orang tua).
. Cedera intra-artikular yang menyebabkan hilangnya kongruitas sendi.
. Terdapat spektrum yang luas. Kekuatan yang paling sering adalah
valgus strain dengan abduki maka fraktur plat tibia lateral merupakan
yang paling sering.
. Waspada akan fraktur avulsi pada plat tibia lateral (fraktur Segond)
karena ini seringkali berhubungan dengan cedera ligamentum cruciatum
anterior.
. Fraktur plat tibia media jarang terjadi dan diasosiasikan dengan ruptur
ligamentum lateralis dan palsi n. peroneus.
. Diklasifikasi menurut Schatzker.

Gambaran klinis
Curiga pada pasien yang tidak menahan beban dengan anamnesis
yang sesuai.
Pemeriksaan dapat memperlihatkan memar, efusi Sendi dan deformitas
dari lutut (valgus dengan fraktur plat lateral). -
Efusi klinis adalah akibat lipohemartrosis dan seringkali tegang dan
membatasi gerakan.
Selalu periksa dan dokumentasikan status neurovaskular karena
vaskularisasi poplitea yang relatif imobil dan n. peroneus dapat rusak,
terutama pada fraktur bikondilar dan plat media.
Pemerikaan lebih lanjut (seringkali dalam anestesi umum dan setelah
rekonstruki) dapat memperlihatkan instabilitas lutut jika berhubungan
dengan kerusakan ligamentum.

Gambann radiologi
, Proyeksi AP dan loterol horisontal biasanya cukup, walaupun fraktur
minimal mungkin baru terlihat dengan proyeki oblik.
. Cari adanya lipohemartrosis pada horizontal beam lateral, yang sugestif
ke arah adanya hubungan sendi dengan ke sumsum tulang.
Radiologi Emergensi

Perhatikan dengan seksama adanya fragmen turang avursi dan pelebaran


celah sendi pada'kompartemen yang tidak terkena, karena hal ini
mengesankan adanya cedera ligamentum.
a Cf dan MRI bermanfaat dalam perencanaan pembedahan.
a sidik tulang dapat membantu memperlihatkan fraktur minimal jika
MRI tidak tersedia.

Foto [ateral fraktur plat tibia yang mempertihatkan lipohemartrosis dan


depresi plat tibia. Foto anteroposterior mengkonfirmasi adanya depresi
ptat tibia.
248 Anggota Cerak Bawah

Fraktur korpus tibia

KaraKeristik
. Fraktur tulang panjang yang paling sering. Seringkali berhubungan
dengan fraktur fibula.
o Biasanya sekunder terhadap trauma direk; seringkali benturan keras
dan mengakibatkan fraktur transversal.
o Kekuatan indirek (rotasi dan kompresi) cenderung menyebabkan
fraktur spiral atau oblik.
. Fraktur toddler terjadi pada anak berusia di bawah 3 tahun yang
sudah bisa berjalan. secara klasik merupakan fraktur distal. Fraktur
mid-shoft harus dicurigai cedera bukan akibat kecelakaan.
. Cedera vaskular yang menyertai jarang. Waspada terhadap sindroma
kompartemen dalam z4 jam peftama.

Gambaran klinis
. Nyeri, bengkak dan deformitas umum ditemukan..D-eformitas dan
angulasi dapat terlihat. Kaki dapat rotasi secara abnbrmal.
o walaupun cedera vaskular jarang penting untuk menilaipulsasj didistal.
o Foot drop terjadi pada kerusakan n. peroneus. Nilai sensasi di first
dorsal web space (n. peroneus profunda).
. Disrupsi ligamentum lutut tidaklah jarang dan dapat terlewat.
Radiologi Emergensi 249

Fraktur spira[ pada 1 /3


dista[ tibia kiri, pra dan
pasca fiksasi interna.
Perhatikan fraktur kolum
tibia (berhubungan dengan

H cedera n. peroneus
komunis).

*,il

Fraktur stress yang


menyembuh (mata panah).

II
Radiologi Emergensi I z5t

1a
I
llyaline membrane disease (HMD) 252
Transient tachypnea of the newborn [nN) 256
lAeconium aspiration slndrome (MAS) 258
Pneumonia neonatus 260
Ringkasan gangguan pemafasan pada neonatus 263
llypertrophic ptllwic stenosis (HPS) 2U
Atresia atau'stenosis duodenum 767
: Atresia jejunoiteat 269
Necrotizing enterocolitis (NEC) 271
lAeconium plug syndrome (MpS) 2n
Meconium ileus 280
Hirschprung diseare 282
Midgut votvutus 285
Matformasi anorektal 288
Atresia esofagus dan fistula trakeoesofagus
252 Kegawatdaruratan pada Pediatri

Hyaline membrone s {h{Mm}

lGrakteristik
. HMD disebut juga sebagai surfactant deficient disease.
. Akibat gangguan produksi surfaktan. Surfaktan yang diproduki oleh
pneumosit tipe z, berguna untuk menurunkan tegangan permukaan
di alveoli sehinga alveoli tersebut dapat mengembang.
. Faktor predisposisi antara lain bayi prematur (umumnya <36 minggu),
bayi dengan berat badan lahir rendah (<z5oogr), riwayat sekio sesarea,
dan ibu yang memiliki penyakit diabetes mellitus.
. Pada masa lalu, hampir semua bayi dengan HMD meninggal dalam 7z
jam. Saat ini dengan pemberian alat bantu nafas, tingkat kesembuhan
terjadi pada >9o%.

Gambaran klinis
. Cejala muncul pada z jam pertama sejak lahir.
. Gejala yang muncul >8jam bukan disebabkan oleh HMD.
. Dengan penanganan yang baik, perbaikan yang bertahap terjadi
setelah 48-72 iam.

Gambaran radiologi
. Penurunan volume paru akibat kolaps alveoli. Gambaran hiperinflasi
mengekklusi diagnosis HMD.
. Gambaran retikulogranular yang diakibatkan alveoli yang kolaps diselingi
oleh alveoli yang terbuka.
. Gambaran air bronchogram menunjukkan , bronki yang masih paten
yang dikelilingi alveoli yang kolaps
. Gambaran efusi pleura sangatlah jarang
. Bomsel membagi HMD ke dalam 4 tingkat:
0 Crade t: Cambaran retikulogranular yang sangat halus dan sulit
dilihat dengan sedikit gambaran air bronchogram.
0 Crade z: Gambaran retikulogranular yang secara homogen terdistribusi
di kedua lapang paru. Gambaran air bronchogram jelas, luas, dan
bertumpang tindih dengan bayangan jantung. Ada penurunan
aerasi paru.
0 Grade 3: Pengelompokan alveoli yang kolaps membentuk gambaran
nodul-nodul berdensitas tinggi yang cenderung menyatu. pada
keadaan yang sangat ektensif, gambaran air bronchogrom terlihat
di bawah diafragma. Radiolusensi paru sangat menurun sehingga
bayangan jantung sulit dilihat.
0 Crade 4: Opasitas yang komplit pada kedua lapang paru dengan
gambaran air bronchogram yang ekstensif. Bayangan jantung tidak
dapat dilihat lagi
Radiologi Emergensi

A
Gambaran paru normal pada bayi baru lahir

l.
HMD grade I
254 Kegawatdaruratan pada Pediatri

A
HMD grade ll

HMD grade lll


Radiologi Emergensi I 2!!

HMDgradel-lV
256 Kegawatdaruratan Pada Pediatri

Transient tachYPnea of
the newborn (TTN)

lGraKeristik
. TTN terjadi ketika cairan dalam paru-paru bayi dikeluarkan secara
tidak semPuma.
. Hal ini dapat disebabkan karena ketiadaan kompresi toraks normal
yang terjadi saat persalinan melalui seksio sesarea atau ketiadaan
p"t*tutrn normal yang terjadi pada bayi yang disedasi'
r Biasanya terjadi pada bayi yang aterm atau sedikit prematur.
. Menyebabkan gangguan pemafasan yang ringan, segera setelah lahir'
. Membaik dalam hitungan jam. Cejala respirasi biasanya menghilang
jam.
setelah hari ketiga, sementara resolusi radiologis teriadi dalam z4-48

Gambaran klinis
. Gangguan pemafasan ringan atau moderat
. Riwayat sekio sesarea.
. Takipnea terjadi pada 6 jam pertama setelah kelahiran'
. Pada pemeriksaan fisik ditemukan grunting ekspirasi, retraksi dada,
p"-rirrrn cuping hidung, terkadang garhbaran sianosis yang membaik
dengan pemberian oksigen yang minimal'
o Biasanya terdapat pada bayi aterm yang berat badan lahimya normal

Gambaran radiologi
. Foto polos torak
0 Ukuran Paru yang normal atau hiperinflasi
0 Gambaran menyeruPai edema Paru
0 Terdapat corakan interstitial yang nyata dengan ukuran jantung
yang normal
0 Peningkatan corakan bronkovaskular yang difus, bilateral dan
simetris.
0 Bisa disertai efusi pleura serta cairan dalam fisura'
Radiologi Emergensi 257

Bayi dengan TTN pada hari pertama

Bayi yang sama dengan foto diambil 3 hari kemudian yang menunjukkan
tanda-tanda perbaikan.
Meconium aspiration sYndrome
(MAS)

Karakteristik
r MAS merupakan pneumonia kimiawi yang terjadi akibat aspirasi
mekoneum intrauterin atau intrapartum
. cairan mekoneum terdapat di intra-amnion pada zo% kehamilan.
. Mekoneum dapat mengakibatkan obstruksi bronkial dan air trapping'
. Gangguan pemafasan lebih berat daripada TTN'
. cedera akibat mekonium menyebabkan resistensi pembuluh darah
paru yang meningkat. Hal ini dapat menyebabkan pintas aliran darah
kanan ke kiri melalui duktus afteriosus persisten'
. Hambatan saluran pernafasan juga dapat menyebabkan komplikasi
pneumotoraks atau pneumomediastinum'

Gambaran klinis
. Teriadi pada bayi aterrn yang mengalami hipoksia atau stres intrauterin
/intrapartum
. Mekoneum jarang ditemukan pada cairan amnion sebelum kehamilan
34 minggu. i,
. Terdapal meconium stdin di cairan amnion'
. GanglrJiln pemafasan hampir langsung teriadi setelah lahir.
. Gangguan pemafasan djtandai oleh sianosis, pemafasan cuping hidung,
dan retraksi intercosta.

Gambaran radiologi
. Foto polos toraks:
0 Hiperinflasi paru, biasanya asimetris.
0 Area-area perbercakan hiperinflasi dan atelektasis yang asimetris
0 Densitas perihilar yang menyerupai tali (rope-like)'
0 Jarang disertai efusi Pleura.
0 Komplikasi MAS seperti pneumotorak, pneumomediastinum, dan
emfisema pulmonal interstitial juga dapat ditemukan'
Radiologi Emergensi 259

Foto polos torak menggambarkan densitas seperti untaian tati yang besar
pada kasus lMS.

A
Foto potos toraks pada bayi aterm dengan perbercakan interstitial yang
kasar pada kasus MAS.

II
260 Kegawatdaruratan pada Pediatri

Pneumonia lreonatus

Karakteristik
a Pneumonia yang terjadi pada neonatus pada z8 hari pertama kehidupan.
a lnfeksi paru terjadi in-utero, selama persalinan, atau selama z8 hari
pertama tersebut.
Etiologi dari pneumonia neonatus dibagi berdasarkan cara terjadinya
infeki.
0 In-utero
. TORCH (Toxoplasmosis, Other infection, Rubella, Cytomegolovirus,
Herpes simplex virus)
I Penyebab lain yang lebih jarang: Varicella zoster, Adenovirus,
Enter ovir uses, My cob a cteri um tub er culo si s, dan T r ep o nema p allidum.
Selama persalinan
I Etiologi adalah mikroorganisme yang berkoloni di saluran lahir.
o Streptococcus hemolytic group B merupakan yang paling sering.
o Penyebab lain: E. Coli, Klebsiella, Proteus, Chlamydia, Candido,
Bacteroides, HSV, Enteroviruses.
Setelah persalinan
I Virus: Respiratory syncytial virus influenza merupakan yang
paling sering
o Bakteri: S. pneumoniae dan H.'influenzae juga cukup sering
ditemukan. Bakteri lainnya adalah Kleb siella,Serrotia, Enterobacter,
Stophylococcus oureus.
I Fungal: Postnatal Candido pneumonia.
. Faktor risiko
0 Bayi yang sakit berat
0 Bayi prematur
0 Fistula trakeoesofagus
0 Palatoskisis
0 Bayi dengan sistem imun yang tidak baik

Gambaran klinis
. Cangguan pernafasan: pernafasan cuping hidung, retraksi, grunting,
sianosis
. Takikardia, hipotermia, Ietargi, nafsu makan menurun
Radiologi Emergensi 261

Pneumonia akibat Chlamydia: masa inkubasi yang lama- didapat saat


persalinan, namun manifestasi z-rz minggu kemudian. Dapat disertai
konjungtivitis.
a Pneumonia akibat Candida: sering disertai ruam makulopapula.
a Pneumonia akibat Herpes simplex: bersifat progresif, cepat dan fatal.
a Staphylococcusaureus dapat menyebabkan pneumonia nekrotikans
berat dengan pembentukan pneumatokel.

Gambaran radiologi
. Perbercakan dengan pola garis di perihilar yang dapat menyerupai TTN
. Efusi pleura pada z5% kasus.
. Perbercakan pada pneumonia akibat S. pneumoniae group B dapat
menyerupai HMD dengan penurunan volume paru. Bayi aterm dengan
gambaran HMD harus dianggap sebagai pneumonia sampai terbukti
sebaliknya.

Pada kebanyakan kasus pneumonia, perbercakan asimetris dan hiperaerasi


dapat tertihat.
Kegawatdaruratan Pada Pediatri

pada HMD dapat terlihat, terutama


Perbercakan retiku[ogranular seperti group B'
pada pneumonia uttiUat S'pneumonioe

A
Konsotidasi pada tobus superior
kiri paru akibat 5' Pneumontoe'
Radiologi Emergensi 263

Ringkasan gangguan pernafasan


pada n@natus

Aerasi
Penyakit
HMD Berkurang
TTN Bertambah
MAS Bertambah
Pneumonia pada neonatus Bertambah

Fola
Penyakit
Ground glass, frnely
HMD granulor
TTN Fissural ffuids, fuzzy vessels
MAS Coorse, -ropey density
Pneumonia pada neonatus peiihflar streaking

Efusi
Efusi
HMD Tidak ada
TTN lya
MAS Mungkin
Pneumonia pada neonatus Mungkin
264 Kegawatdaruratan pada Pediatri

Hypertrophic pyloric sfenosis


(HPs)

Karakteristik
. Hps merupakan penebalan idiopatik dari otot pilorik pada neonatus
yang menyebabkan obstruksi lambung yang progresif.
. Biasanya teriadi pada bayi yang berusia z-tz minggu.
. Laki-laki : perempuan - 4-5 : 1

o Etiologi masih belum jelas (idiopatik).

Gambaran klinis
. Muntah-muntah pada bayi yang sebelumnya dapat makan.
. Penurunan berat badan.
. Pada pemeriksaan fisik dapat ditemukan palpable olive sign yang
spesifitasnya 97% di tangan orang yang berpengalaman.

Gambaran radiotogi
. Pada foto polos abdomen, terdapat gambaran lambung yang distensi
berlebihan serta distribusi udara dalam usus yang berkurang' Gambaran
lambung yang distensi iuga disebutsingle bubble sign, walaupun terkadang
dapat memberikan gambaran double bubbld. Lambung dapat terlihat
kolaps tanpa gambaran udara iika bayi baru saia muntah-muntah.
. Pada fluoroskopi, HPS memberikan gambaran
0 caterpillar stomach: motilitas lambung yang berlebihan.
0 tram track atau string sign yang berasal dari barium di dalam
saluran yang sempit.
O tedt alau beak dari gambaran barium yang memasuki saluran
pilorus.
USG merupakan pemerikaan terpilih, ketika gambaran klinis mengarah
pada diagnosis HPS. Gambaran USG yang menyokong HPS:
0 Ketebalan otot pilorik >3mm.
0 Panjang saluran pilorus >16mm.
0 Diameter pilorus >15mm.
0 Hiperperistaltik lambung yang disertai lumen yang terobliterasi.
Radiologi Emergensi

Gambaran single bubble pada foto potos abdomen.


266 Kegawatdaruratan Pada Pediatri

Gambaran USG dari HPS. Gambar sebetah kiri merupakan potongan


tongitudinat, sedangkan gambar sebetah kanan merupakan potongan
transversa[.

String sign
^.'
Double trock sign.
Radiologi Emergensi 267

Atresia atau mf,mrtmsis duodenum

KaraKeristik
. Merupakan atresia atau stenosis duodenum yangteriadisecara kongenital.
. Obstruksi saluran pencernaan bagian atas yang paling sering.
. Kegagalan pembentukan duodenum memiliki dua teori:
0 Kegagalan vakuolisasi (rekanalisasi).
0 Proliferasi endodermal yang tidak adekuat.
. Sebanyak 5o% penderita kelainan ini memiliki malformasi lain.
. Lokasi atresia atau stenosis biasanya pada duodenum bagian kedua
dan ketiga.
. Pada atresia sama sekali tidak terdapat udara di distal dari kelainan,
sedangkan pada stenosis masih bisa terlihat sedikit udara di bagian
distal dari kelainan.

Gambaran klinis
. Muntah dalam jam-jam pertama sejak lahir.
o Muntah bilosa terdapat pada 85%, dan sisanya 15% berupa muntah
non-bilosa (obstruksi di proksimal dari ampulla Vdter).
. Abdomen yang berbentuk skapoid. r

o lntoleransi terhadap makanan.


. Cejala dan tanda lain: dehidrasi, penurunan berat badan, ketidakeimbangan
elektrolit.
. Jika tidak diterapi akan menyebabkan kematian.
. Pembedahan membuat tingkat keselamatan >9o%.

Gambaran radiotogi
Gambaran khas pada foto polos abdomen adalah double bubble yaitu
gambaran udara di lambung dan di dalam ujung buntu dari duodenum.
Jika terdapat gambaran do uble bubble,maka tidak diperlukan pemeriksaan
lebih lanjut, karena gambaran tersebut sudah diagnostik.
Jika terdapat udara di sebelah distal dari duodenum, maka lakukan
pemeriksaan prosedur kontras pada saluran pencernaan atas.
Kegawatdaruratan pada Pediatri

A
Gambaran doubte bubble pada atresia duodenum.
Radiologi Emergensi 269

Atresia jejunoiteal

Karakteristik
. Oklusi komplit atau tidak adanya lumen pada suatu segmen jejunum
atau ileum yang terjadi secara kongenital.
. Stenosis jejunoileal merupakan forme fruste dari atresia. (Forme fruste
adalah istilah kedokteran untuk suatu bentuk yang atipikal atau bentuk
yang tidak lengkap)

Gambaran klinis
. Kegagalan pengeluaran mekoneum.
. Distensi abdomen.
. Muntah bilosa.

Gambaran radiotogi
a Bayangan multipel dari untaian usus yang dilatasi.
a Sulit membedakan usus halus dengan kolon pada neonatus.
a Jumlah untaian usus yang dilatasi menentukan tingkat obstruki:
0 Banyak untaian: obstruki distal (ileum distal atau kolon)
0 Sedikit untaian: obstruksi proksimal (ejunum atau ileum proksimal)
a Stenosis lebih sulit didiagnosis
a Cambaran mikrokolon pada atresia ileum distal.
270 Kegawatdaruratan pada Pediatri

Klasifi kasi atresia jejunoiteat.

Gambaran udara pada


atresia jejunum.
Radiologi Emergensi 27'l

Necrotizing srTf# dr*, {ruffit}


Karakteristik
. NEC merupakan enterokolitis idiopatik yang paling sering terjadi akibat
kombinasi infeki dengan iskemia.
. NEC merupakan kegawatdaruratan gastrointestinal yang paling sering
terjadi pada neonatus, terutama di unit perawatan intensif.
. Terjadi pada lo% bayi yang memiliki berat badan kurang dari t5oogr
dengan mortalitas 5o% atau lebih, bergantung pada tingkat keparahan.
. Walaupun lebih sering terjadi pada bayi yang prematur, NEC dapat
ditemukan juga pada bayi aterm.
o Etiologi dari NEC bersifat multifaktorial:
0 lskemia.
0 Mikroorganisme.
0 Mukosa intestinum yang belum matur.
0 Predisposisi genetik.

Gambaran klinis
r Terutama pada bayi dengan berat badan lahir < 2ooogr.
. paling sering terjadi selama minggu pertama atau kedua kehidupan.
. NEC lebih sering terjadi pada bayi yang diberi makanan daripada yang
tidak diberi makanan.
o Ditandai dengan distensi perut, intoleransitdrhadap makanan, peningkatan
aspirat dari selang nasogastri( penurunan bising usus, hematochezia,
eritema pada dinding abdomen (tahap lanjut).
. Dapat disertai manifestasi sistemik seperti apnea, Ietargi, penurunan
perfusi perifer, syok, kolaps kardiovaskular, diatesis hemoragik.

Gambaran radiologi
o Foto polos abdomen merupakan pemerikaan terpilih.
. Klasifikasi menurut Bell :

0 Stage l: NEC dini atau curiga NEC


I Tidak spesifik
. Untaian usus yang scallopinglseparatedlunfolding
I Distensi usus yang asimetris.
0 stage ll: NEC definitif
. Pneumdtosis intestinalis: mukosa atau seros; tidak selalu
berkorelasi dengan keadaan klinis.
0 Stage lll: NEC lanjut (perforasi atau ancaman per-forasi)
c portal venous gos (nVC).
o Udara bebas intraperitoneum.
o Ascites.
Pediatri
Kegawatdaruratan Pada

A
NEC stage I
Radiologi Emergensi 273

#
A
Pneumatosis intestinalis pada NEC stage ll
274 Kegawatdaruratan pada Pediatri

Modified Bell's Staging Criteria untuk NEC.

IA lnstabilitas Retensi gaster, Normal atau Puasa,


Suspected temperatur, distensiabdomen, dilatasi usus, antibiotik
aPnea, emesis, feses yang ileus ringan untuk 3 hari
bradikardia, heme-positive
letargis
IB Sama seperti di BAB darah yang Sama seperti Sama seperti
Suspected atas banyak di atas lA
lt A Sama seperti di Sama seperti di Dilatasi Puasa,
Definite, atas atas, ditambah usus, ileus, antibiotik
mildly ill bising usus yang pneumatosis untuk 7-ro
hilang dengan atau intestinalis hari
tanpa nyeri perut.
lt B Sama seperti di Sama seperti di Sama seperti Puasa,
Definite, atas, ditambah atas, ditambah IlA,ditambah antibiotik
moderately asidosis metabolik bising usus yang ascites untuk 14
'il ringan dan hilang, nyeri perut hari
trombositopenia yang jelas dengan
atau tanpa selulitis
abdomen atau
massa di kuadran
kanan bawah
l[A Sama sepefti Sama seperti di Sama seperti Puasa,
Advanced, llB, ditambah atas, ditambah llA, ditambah antibiotik
severely hipotensi, tanda-tanda ascites untuk
ill, intact bradikardia, peritonitis, nyeri 14 hari,
bowel apnea, kombinasi perut yang jelas, resusitasi
asidosis dan distensi cairan,
respiratorik dan abdomen inotropi(
metaboli( KlD, ventilator,
dan netropenia parasentesis
ilt B Sama seperti lllA Sama sepefti lllA Sama seperti Sama
Advanced, di atas, seperti llA,
severely ill, ditambah ditambah
perforated pneumoperit pembedahan
bowel oneum

KID: Koagulasi intravaskular diseminata


Radiologi Emergensi 275

Pneumotosis intestinalis (panah) pada NEC stage ll.


276 Kegawatdaruratan pada Pediatri

\a\r
**I

NEC stage lll dengan pneumoperitoneum. Terdapat udara bebas subdiafragma,


Rigler sign dengan gambaran udara pada kedua sisi dinding usus(panah a),
gambaran udara di luar usus yang berbentuk segitiga (panah b), dan ligamentum
falsiforme (panah c).
Radiologi Emergensi 277

Meconium plug syndrome (MPS)

KaraKeristik
. MPS merupakan obstruksi kolon fungsional sementara pada neonatus.
. MPS ditandai dengan keterlambatan pengeluaran mekonium (>24-
48jam) dan dilatasi intestinal.
. Penyebab obstruksi letak rendah yang sering pada neonatus.
o Etiologi diduga akibat imaturitas sel ganglion atau reseptor hormonal.
. Faktor predisposisi:
0 lbu yang menderita diabetes.
0 lbu yang mendapat terapi magnesium sulfat.

Gambaran klinis
. Distensi abdomen.
. Keterlambatan pengeluaran mekonium (>24-48jam).
. Muntah bilosa.
. Bersifat sementara, biasanya sembuh spontan.
. Komplikasi yang dapat terjadi adplah perforasi.

Gambaran radiologi
. Banyak untaian usus yang dilatasi.
. Pada foto polos abdomen neonatus, usus halus dan kolon sulit
dibedakan.
. Pada pemerikaan dengan enema kontras:
0 Rasio rektum-sigmoid >t.
0 Kolon descenden dan sigmoid yang kecil.
0 Bisa disertai luput isi (filling defect) yang menggambarkan sumbat
mekoneum.
0 Ukuran kolon asenden dan transversum melebar, tidak terdapat
mikrokolon seperti pada meconium ileus.
0 Sering disertai pengeluaran plug mekoneum saat enema diberikan.
278 Kegawatdaruratan Pada Pediatri

baring pada ilonutw dengan MPS mempertihaikan


udaradi dalam
distribusi udara datam ,t,t-i'ng d"'i"bih' namun tidak terdapat
rektum.
Radiologi Emergensi 279

I
Foto dengan enema kontras pada MPS.
28o Kegawatdaruratan pada Pediatri

Meconium ileus

Karakteristik
. Obstruksi ileum distal pada neonatus akibat mekonim yang secara
abnormal kental.
. Hampir semua pasien dengan meconium ileus memiliki fibrosis kistik.
o Etiologi disebabkan gangguan fungsi Pompa klorida pada membran
sel yang berakibat pada mekonium yang kental.
o Prognosis buruk jika obstruksi tidak diatasi.

Gambaran klinis
. Kegagalan pengeluaran mekonium'
. Distensi abdomen.
. Muntah bilosa.

Gambaran radiologi
. Penuniang diagnosis paling baik adalah pemerikaan dengan enema
kontras. Obstruksi usus halus dengan mikrokolon terlihat pada
pemeriksaan dengan enema kontras.
. Pada foto polos abdomen, terdapat dilatasi usus halus namun tanPa
oir fluid level karena sifat mekonium yang kental.
Radiologi rrn"rg.nri I z8t

Foto polos abdomen


memperlihatkan ditatasi dari
USUS.

Gambaran mikrokolon Yang


khas pada meconium ileus.
282 Kegawatdaruratan Pada Pediatri

Hirschprung disease

Karakteristik
.Disebutiugacolonicoganglionosis,congenitalmegacolon,totalintestinal
agangtionisis, atau totdl colonic agonglionosis'
.obstruksifungsionaldarikolonakibatkekuranganselganglionenterik
intrinsik.
. dan berlaniut ke proksimal'
Aganglionosis biasanya melibatkan anus
. mauPun pleksus submukosa'
Ketiadaan baik pleksus mienterikus

Gambaran ktinis
. Keterlambatan pengeluaran mekoneum
z4-48 lam.

. Distensi abdomen.
. Muntah bilosa.
. Konstipasi sejak lahir'

Gambaran radiologi
. Kolon yang denervasi tampak kecil dan
spasmodik'

. Kolon yang membesar adalah kolon


di sebelah proksimal dari kolon
yang denervasi.
. TamPak banyak untaian usus yang berdilatasi'
. Udara dalam rektum sedikit'
<t'
. Pada enema kontras, rasio rektum-sigmoid
Radiologi Emergensi 283

Gambaran skematis dari


Hirschprung diseose.

Foto potos abdomen pada


Hirschprung diseose.
pada Pediatri

Hirschprung disease pada pemerikaan dengan enema kohtras.


Radiologi Emergensi 285

Midgut volvulus

Karakteristik
. Usus yang terpuntir akibat terdapatnya malrotasi pada masa embrionik.
. Pada masa embrioni( terjadi rotasi yang berlawanan arah jarum jam
pada bagian duodenojejunal dan ileokolik.
. Perbatasan duodenojejunal akan terletak di kuadran kiri atas sedangkan
sekum terletak di kuadran kanan bawah yang menyebabkan basis
dari mesenterium usus halus panjang dari ligamentum Treitz sampai
ke sekum.
. Jika proses ini terganggu maka akan menyebabkan malrotasi sehingga
basis mesenterium usus halus menjadi pendek dan rentan terhadap
puntiran (volvulus)
. Sebesar 39% muncul pada to hari pertama kehidupan dan lebih dari
9o% terjadi pada tiga bulan pertama kehidupan, namun midgut volvulus
dapat terjadi pada usia berapapun.

Gambaran klinis
. Muntah bilosa.
. Nyeri abdomen akut.
. Pada anak yang lebih tua, malrotasi dapat bermanifestasi sebagai
kegagalan dalam tumbuh kembang, nyeri abdomen kronik yang
rekuren, malabsorbsi, dan gejala lain yang tidak khas, seperti muntah
non bilosa dan diare.
. Jika terdapat iskemia usus dan nekrosis, maka gejala syok dapat muncul.

Gambaran mdiologi
. Pemerikaan prosedur dengan kontras pada saluran cema bagian atas
merupakan pemerikaan terpilih.
o Foto polos abdomen tidak spesifik. Foto dapat memperlihatkan
gambaran normal jika volvulus bersifat intermittent atau jika puntiran
tidak terlalu ketat. Gambaran lambung dan duodenum proksimal
yang terdistensi (double bubble) seperti gambaran hypertrophic pyloric
stenosis, akan didapatkan jika puntiran ketat.
. Pada foto prosedur dengan kontras melalui mulut, dapat ditemukan
corkscrew srgn dan konfigurasi usus yang malrotasi.
pada masa embrionik'
Gambar pembentukan saluran cerna yang normal

Gambar skematis dari terjadinya midgut volvulus'


Radiologi Emergensi 287

Corkcrew sign.

Gambaran double bubble


yang juga dapat ditemukan
pada midgut volvulus.
288 Kegawatdaruratan Pada Pediatri

Matformasi an& aL

Karakteristik
.Malformasianorektal(MAR)memilikibanyakvariasiyang.mencakup
anorektal' anus ektopik dan
anus imper{orata, atresia atau stenosis
atresia rektal'
.Terdapatberbagaiklasifikasi,namunklasifikasimenurutGanstermasuk
yang cukuP sederhana dan berguna
yang
Anus ektoPik Hi"Crt be..khlt ,".ttt ektopik pada lokasi
kandung
uretra'
abnoimal (perineum, vestibulum'

embukaan atau fistula'


uka' namun terdaPat
;
Stenosis. anus Atresla yant t'ludr\ )Er I rPu'

atau rektum
yang hidup'
a lnsidensi MAR adalah t dari t5oo-5ooo kelahiran bayi
keadaan ini berasal dari kegagalan
a Etiologi belum diketahui, namun
genitourinaria selama
penurunan a"n pemis't'.ra n iirragu'dan traktus
trimester kedua' :

. lain seperti:
Sering disertai kelainan kongenital
0VACTERL(vertebrdtabnormolities,Analatresia,Cardiacabnormalities,
atresia' Renal agenesis
Tracheoesopno["i 1i'tuto andlor Esophageal
pada 45% pasien'
and dysplasiqind'Limb defects) teriadi
lmperforate anus and Socral
0 OEIS (Omphatocele, Bladder exslrophy'
anomalies) teriadi pada 5% pasien'
z'8% pasien'
0 Sindroma Down terdapat pada

.MARdiklasifikasimenjadiletaktinggiatauletakrendahbergantung
sling'
terhadap puborectalis
pada lokasi tempaf Lerat<himya '"[tutn
.PadaMARletaktinggi,kolonberakhirpadaataudi.ataspuborectalis
sling dan sfing uia'"#ya hipoplasia
atiu bahkan tidak ada' Hal ini
melyebabkan fungsinya tidak adekuat
akan melewati puborectalis sling
. Jika kolon berakhir rendah, kolon
dengan baik'
Vrng Ui.rrnya berkembang dan berfungsi
Radiologi Emergensi 289

Hal ini penting karena kondisi puborectalis sling dan yang akan
menentukan tatalakana yang akan dipilih. Otot spinkter anus pada
MAR biasanya tidak berkembang dan berfungsi baik, sehingga fungsinya
bergantung pada puborectalis sling.
Semakin tinggi lokasi hindgut berakhir, maka fungsi kontinensia rektum
yang baik akan semakin sulit diperoleh

Crambaran klinis
. Memiliki gejala dan tanda obstruki letak rendah.
. Dapat diseftai kelainan kongenital lain.
. MAR letak rendah
0 Biasanya terlihat perineal opening.
0 Pasien perempuan biasanya memiliki orifisium uretra dan vagina
yang terpisah.
. MAR letak tinggi
0 Tidak terlihat perineal opening.
0 Pasien laki-laki biasanya memiliki fistula antara anorektum yang
atresia dengan uretra posterior. Fistula ke kandung kemih atau
ke uretra anterior juga dapat terjadi walaupun jarang.
0 Pasien perempuan memiliki fistula dari anorektum yang atresia
dengan vagina atau vestibulum

Gambaran radiologi
Pemeriksaan biasanya dimulai dengan foto polos abdomen yang
memperlihatkan gambaran ileus obstruki letak rendah.
Pemeriksaan foto polos juga dapa( membantu dalam menentukan
lokasi MAR.
Gambaran udara di dalam kandung kemil'i menandakan MAR letak
tinggi dengan fistula rektovesika atau rektouretra pada laki-laki.
Foto polos yang memperlihatkan mekonium intraluminal yang terkalsifikasi
juga menandakan MAR letak tinggi karena mekonium akan mengalami
kalsifikasi jika berhubungan dengan urin
Pendekatan radiologi yang tradisional untuk menentukan lokasi MAR
adalah foto lateral dengan posisi bokong bayi menungging ke atas
(knee chest position).
Penanda diletakan pada anal dimple dan jarak dari udara dalam rektum
ke penanda diukur.
0 Jarak > 1cm : MAR letak tinggi
0 Jarak < 1cm : MAR letak rendah
290 Kegawatdaruratan Pada Pediatri

tidak
. kelemahan karena udara dapat
Metode tradisional ini memiliki
mencaPai rektum bila:
yang cukup lama pada posisi
0 Bayi tidak diletakan dalam waktu
telungkuP.
udara ke rektum'
0 Ada mekonium yang menyumbat
ke posisi
0 Jika bayi menangi' mengedan' rektum akan bergerak
'Iuu retak tinggi dapat diinterpretasi
yang lebih r."na,r', t"r"'i"i!""ivrnn
seUigai MAR letak rendah'
(ditarik dari
Metode lain adalah dengan penarikan Jika udara
perbatasan sakrokoksigEal ke
perten
k tinggi'
berakhir di atas garrs ini maka diseb
terlalu tinggi dan diganti oleh
Garis pubokoksigeal saat ini dianggap dan t/3 bagian
garis M (berialan ferUat#n z/3 bagian atas dengan otot
'n"flfu'
ir.r,ir;- caris ini lebih berkorelasi
bawah dari tulang
puborektalis.
maupun dengan garis M
Baik metode dengan garis pubokoksigeal
dengan metode tradisional'
memiliki kelemahan y'ig 'ut'
dari
USG transperineal iuga telah
digunakan untuk mengukur iarak
memiliki permasalahan yang
rektum ke perineum,?tun intJrpretasi
sama dengan metode tradisional'
0 <1omm: MAR letak rendah'
0 >1o-15mm: MAR letak tinggi'
dalam menentukan lokasi fistula'
a Penggunaan zat kontras Ue'guna
kan adalah p"f::'I.tt'n CT
a Pemeriksaan eh pemeriksaan MRI' Kedua
yang, mungki ra langsung' otot puborektalis
pencitraan ini
dan lokasi da
Radiologi Emergensi 291

Variasi IMR pada pria (dari


kiri atas searah jarum jam)
: fistula perineum, fistula
rektouretra buIbar, fistula
rektouretra prostatika,
fi stuta rektovesika urinaria.

Variasi /tMR pada wanita


(dari kiri atas searah jarum
jam) : fistuta perineum,
fi stula vestibutum, fi stuta
rektovagina rendah, fistula
rektovagina tinggi.
292 Kegawatdaruratan pada Pediatri

Metode tradisional dalam menentukan posisi MAR

llustrasi garis pubokoksigeal dan garis M.


Radiologi Emergensi 293

Atresia esofagus dan fistula


trakeoesofagus

Karakteristik
Atresia esofagus dan fistula trakeoesofagus memiliki beberapa variasi.
Klasifikasi menurut Gross merupakan yang paling sering dipakai.
Atresia esofagus dengan fistula trakeoesofagus distal merupakan tipe
yang paling banyak ditemukan.
a Etiologididuga akibat kegagalan pemisahan trakea dan esofagus primitif.
o Sering disertai kelainan lain. Kelainan ini termasuk dalam sindrom
VACTERL.
Pada z5% kasus, pasien memiliki i3 atau lebih korpus vertebra torakalis
beserta iganya, atau 6 atau lebih korpus vertebra lumbalis.

Gambaran klinis
r Biasanya gejala timbul secara dini.
. Sekresi air liur yang berlebihan.
. Sering tersedak.
. Sianosis.
. Tidak dapat makan atau minum.
. Pneumonia berulang.
. Pada fistula trakeoesofageal tipe E/H (tanpa fistula), jika fistula berukuran
kecil, maka gejala dapat muncul lambat'setelah anak besar.

Gambaran radiologi
Petunjuk terbaik adalah adanya kantung esofagus yang terdistensi
dengan ujung selang nasogastrik di dalamnya pada foto polos toraks.
Distensi kantung esofagus dapat disertai oir fluid level.
Foto lateral dapat mengkonfirmasi adanya kantung esofagus yang
terdistensi yang mendorong trakea ke anterior.
Jika atresia esofagus disertai fistula trakeoesofagus, maka terdapat
gambaran udara di saluran pencernaan.
Jika atresia esofagus tidak disertai fistula trakeoesofagus, maka tidak
terdapat gambaran udara di saluran pencemaan;
Kelainan organ Iain harus diperhatikan seperti, kelainan jantung
kongenital, anomali vertebra, atau obstruki saluran pencernaan.
Pneumonia aspirasi dapat ditemukan dan biasanya mengenai lobus
superior kanan
294 Kegawatdaruratan Pada Pediatri

Tipe A (5-10%) Tipe B (1%) TlPe C (80-90%)


Atresia esofagus Atresia esofagus denqan Atresja esofagus dengan
tanPa fistula fistuta tetak tjnggj fistuta tetak rendah

Tipe D (1-3%) Tipe E


Atresia esofagus dengan Fistuta
fistuta tetak tinggi dan rendah atresia ,

Ktasifikasi atresia esofagus dan fistuta trakeoesofagus berdasarkan


Gross'

ah) Yang
Atresia esofagus Perliha
distensi. Perha cernaa udara'
Ketainan ini dik B Yang sofagus
yang mendorong trakea ke anterior'
Radiologi Emergensi 295

Foto potos toraks memperlihatkan ujungfetang nasogastrik yang tertahan pada


kantung esofagus. Foto ini merupakan atresia esofagus tipe C yang merupakan
tipe yang paling sering ditemukan.