Anda di halaman 1dari 6

Polypedates leucomystax mitochondrial

cytb gene for cytochrome b, partial cds,


specimen_voucher: KUZ R62683
(Department of Zoology, Graduate School
of Science, Kyoto University)
GenBank: AB451714.1

FASTA Graphics

Go to:
LOCUS AB451714 1027 bp DNA linear VRT 24-JUL-
2016
DEFINITION Polypedates leucomystax mitochondrial cytb gene for cytochrome
b,
partial cds, specimen_voucher: KUZ R62683 (Department of
Zoology,
Graduate School of Science, Kyoto University).
ACCESSION AB451714
VERSION AB451714.1
KEYWORDS .
SOURCE mitochondrion Polypedates leucomystax (Java whipping frog)
ORGANISM Polypedates leucomystax
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea;
Rhacophoridae;
Rhacophorinae; Polypedates.
REFERENCE 1
AUTHORS Kuraishi,N., Matsui,M. and Ota,H.
TITLE Estimation of the Origin of Polypedates leucomystax (Amphibia:
Anura: Rhacophoridae) Introduced to the Ryukyu Archipelago,
Japan
JOURNAL Pac. Sci. 63, 317-325 (2009)
REFERENCE 2 (bases 1 to 1027)
AUTHORS Kuraishi,N., Matsui,M. and Ota,H.
TITLE Direct Submission
JOURNAL Submitted (03-AUG-2008) Contact:Norihiro Kuraishi Kyoto
University,
Graduate School of Human and Environmental Studies;
Yoshida-Nihonmatsu, Sakyo, Kyoto, Kyoto 606-8501, Japan
FEATURES Location/Qualifiers
source 1..1027
/organism="Polypedates leucomystax"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/specimen_voucher="KUZ R62683 (Department of Zoology,
Graduate School of Science, Kyoto University)"
/db_xref="taxon:68444"
/country="Japan: Okinawa, Ishigakijima"
gene 1..>1027
/gene="cytb"
CDS 1..>1027
/gene="cytb"
/codon_start=1
/transl_table=2
/product="cytochrome b"
/protein_id="BAI45167.1"

/translation="MTPAMRKAHPAIKIINNSFIDLPTPANLSAWWNFGSLLGVCLIA

QVATGLFLAMHYTADTSLAFSSVAHMCRDVNYGWLLRNLHANGASFFFICVYLHIGRG

LYYGSFNFKETWNIGVMLLFLLMATAFVGYVLPWGQMSFWGATVITNLMSAAPYIGNT

LVQWIWGGFSVDNATLTRFFTFHFILPFAIMGASMMHLLFLHQTGSSNPTGLNSNLDK

IPFHPYFSYKDVLGFTIMLTSLALLSTFNPNLLGDPDNFTPANPLVTPPHIKPEWYFL

FAYAILRSIPNKLGGVLALLFSIIILIFVPLTNMSKQRTMTFRPLTKILFWTLIANTI
ILTWIGGQ"
ORIGIN
1 atgacccccg caatacgaaa agctcacccc gccatcaaaa ttattaataa ttcatttatt
61 gatcttccaa ctcctgccaa cttatctgcc tgatgaaatt tcggatcctt actaggggta
121 tgcctcatcg ctcaagttgc aacgggttta tttctagcaa tacattatac tgcagacaca
181 tcgcttgcat tttcttctgt tgcccacatg tgtcgagacg taaattatgg ttgactgctc
241 cgcaatctcc acgccaacgg cgcatcattc ttctttatct gtgtttattt acacattggc
301 cgaggcctat actacggatc attcaacttt aaagagacat gaaacattgg tgtgatgctc
361 ctatttttac taatggctac cgcctttgta gggtatgttc tcccatgagg acaaatatcg
421 ttctgagggg ccacagtaat cacaaaccta atatcagcgg ccccatatat cggcaacacc
481 ctagtccaat gaatctgggg cggcttctca gttgacaatg ctacattaac acgatttttc
541 accttccact tcattttacc attcgcaatt ataggtgcta gcataataca tctcctcttc
601 ctccaccaaa caggctcatc aaacccaaca ggacttaatt caaatctaga caaaattcca
661 tttcatcctt acttttccta taaagatgtc ctaggcttca ccattatact aacctccctg
721 gccttattat ccacctttaa ccccaatctt cttggcgacc cagacaactt taccccagcc
781 aacccactag ttacgcctcc ccacatcaaa cctgaatgat acttcctctt tgcctatgca
841 atcctacgct caattcccaa taaactgggg ggggtattag cacttttatt ttctattatc
901 attctcatct ttgtacccct aaccaacatg tcaaaacaac gaactatgac cttccgtcca
961 ctaacaaaaa ttctattctg gaccttaatc gctaatacaa ttattctaac atgaatcggg
1021 ggccaac
//
Polypedates megacephalus Tyr gene for
tyrosinase, partial cds, specimen_voucher:
KUHE:16589
GenBank: AB728312.1

FASTA Graphics

LOCUS AB728312 445 bp DNA linear VRT 10-JAN-


2013
DEFINITION Polypedates megacephalus Tyr gene for tyrosinase, partial cds,
specimen_voucher: KUHE:16589.
ACCESSION AB728312
VERSION AB728312.1
KEYWORDS .
SOURCE Polypedates megacephalus (Hong Kong whipping frog)
ORGANISM Polypedates megacephalus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea;
Rhacophoridae;
Rhacophorinae; Polypedates.
REFERENCE 1
AUTHORS Kuraishi,N., Matsui,M., Hamidy,A., Belabut,D.M., Ahmad,N.,
Panha,S., Sudin,A., Yong,H.S., Jiang,J.-P., Ota,H., Thong,H.T.
and
Nishikawa,K.
TITLE Phylogenetic and taxonomic relationships of the Polypedates
leucomystax complex (Amphibia)
JOURNAL Zool. Scr. 42, 54-70 (2013)
REMARK DOI:10.1111/j.1463-6409.2012.00562.x
REFERENCE 2 (bases 1 to 445)
AUTHORS Kuraishi,N. and Matsui,M.
TITLE Direct Submission
JOURNAL Submitted (11-JUN-2012) Contact:Norihiro Kuraishi Kyoto
University,
Graduate School of Human and Environmental Studies;
Yoshida_Nihonmatsu, Sakyo, Kyoto, Kyoto 606-8501, Japan
FEATURES Location/Qualifiers
source 1..445
/organism="Polypedates megacephalus"
/mol_type="genomic DNA"
/specimen_voucher="KUHE:16589"
/db_xref="taxon:68449"
/country="Thailand:Kanchanaburi, Kanchanaburi"
gene <1..>445
/gene="Tyr"
CDS <1..>445
/gene="Tyr"
/codon_start=2
/product="tyrosinase"
/protein_id="BAM37353.1"

/translation="FSGIDDRENWPFVFYNRTCQCQGNFTGYNCGECKFGYTGPNCDI

RRNLIRKEIFKMTTAEKDKFIAYLNLAKRTISPDYVISTGTYEQMGNGSNPMFADINV
YDLFVWMHYYASRDAFLEDGGVWENIDFAHEAPGFLPWHRLFLLVW"
ORIGIN
1 cttctcaggc attgatgacc gagaaaactg gcccttcgtc ttttataaya ggacttgcca
61 atgccagggt aactttacgg gctacaattg tggtgagtgt aagtttggct acacaggacc
121 gaactgcgac attaggcgca acctgatcag gaaggagatc ttcaagatga ccacggctga
181 gaaggacaaa ttcattgctt atctcaactt ggccaagcgg actatcagcc cagattatgt
241 catttccacc ggcacatatg agcagatggg caatggctcc aatccaatgt ttgcagatat
301 caatgtctat gatctgtttg tgtggatgca ttactatgcc tccagagatg ctttcttgga
361 agatggcggt gtgtgggaga acattgactt tgcccatgag gcccctggct ttttgccttg
421 gcacaggctc tttctgctgg tttgg
//
Polypedates macrotis Tyr gene for
tyrosinase, partial cds, specimen_voucher:
KUHE:42556
GenBank: AB728317.1

FASTA Graphics

LOCUS AB728317 445 bp DNA linear VRT 10-JAN-


2013
DEFINITION Polypedates macrotis Tyr gene for tyrosinase, partial cds,
specimen_voucher: KUHE:42556.
ACCESSION AB728317
VERSION AB728317.1
KEYWORDS .
SOURCE Polypedates macrotis (Baram whipping frog)
ORGANISM Polypedates macrotis
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea;
Rhacophoridae;
Rhacophorinae; Polypedates.
REFERENCE 1
AUTHORS Kuraishi,N., Matsui,M., Hamidy,A., Belabut,D.M., Ahmad,N.,
Panha,S., Sudin,A., Yong,H.S., Jiang,J.-P., Ota,H., Thong,H.T.
and
Nishikawa,K.
TITLE Phylogenetic and taxonomic relationships of the Polypedates
leucomystax complex (Amphibia)
JOURNAL Zool. Scr. 42, 54-70 (2013)
REMARK DOI:10.1111/j.1463-6409.2012.00562.x
REFERENCE 2 (bases 1 to 445)
AUTHORS Kuraishi,N. and Matsui,M.
TITLE Direct Submission
JOURNAL Submitted (11-JUN-2012) Contact:Norihiro Kuraishi Kyoto
University,
Graduate School of Human and Environmental Studies;
Yoshida_Nihonmatsu, Sakyo, Kyoto, Kyoto 606-8501, Japan
FEATURES Location/Qualifiers
source 1..445
/organism="Polypedates macrotis"
/mol_type="genomic DNA"
/specimen_voucher="KUHE:42556"
/db_xref="taxon:488246"
/country="Malaysia:Sarawak, Kanowit"
gene <1..>445
/gene="Tyr"
CDS <1..>445
/gene="Tyr"
/codon_start=2
/product="tyrosinase"
/protein_id="BAM37358.1"

/translation="FSGIDDRENWPFVFYNRTCQCQGNFTGYNCGECKFGYTGPNCDI

RRNLIRKEIFKMTTAEKDKFIAYLNLAKRTISPDYVISTGTYEQMGNGSXPMFADINV
YDLFVWMHYYASRDAFLEDGXVWENIDFAHEAPGFLPWHRLFLLVW"
ORIGIN
1 cttctcaggc attgatgacc gagaraactg gcccttcgtc ttttataata ggacttgcca
61 atgccagggt aactttacgg gctacaattg tggtgagtgt aagtttggct acacaggacc
121 gaactgcgac attaggcgca acctaatcag gaaggagatc ttcaagatga ccacggctga
181 gaaggacaaa ttcatcgctt atctcaactt ggccaarcgg actatcagcc cagattatgt
241 catttccacc ggcacatatg agcagatggg taatggctcc rttccaatgt ttgcagatat
301 caatgtctat gatctgtttg tgtggatgca ttactatgcc tccagagatg ctttcttgga
361 agatggcrrt gtgtgggaga acattgactt tgcccatgag gcccctggct ttttgccttg
421 gcacaggctc tttctgctgg tttgg
//