Anda di halaman 1dari 7

Sikapkomunikasidalammengakomodasinilaidankeyakinan

Dalam melakukan komunikasi dengan klien yang berkaitan dengan nilai dan
keyakinan, sikap yang dilakukan bertujuan untuk menghadirkan diri perawat dalam
berinteraksi dengan klien. Menurut Egan (1995), dikutip dari Nurhasanah, 2010 ada lima
sikap yang teridentifikasi dan cara menghadirkan diri secara fisik, yaitu :
a. Berhadapan, maksudnya sikap perawat yang menunjukan kesiapannya untuk
memberikan bantuan untuk klien dan menghormati keberadaan klien.
b. Mempertahankan kontak mata. Mempunyai makna bahwa perawat bersungguh-
sungguh dalam merespon yang dikatakan oleh klien. Mempertahankan kontak mata
dimaksudkan juga untuk mengetahui respon non verbal yang ditunjukan oleh klien
saat melakukan interaksi komunikasi.
c. Membungkuk kearah klien. Sikap ini menunjukan perawat peduli pada klien,
menghormati keberadaan klien. Membungkuk disini adalah dalam posisi yang wajar,
yaitu dalam sikap posisi yang sedikit condong kedepan. Karena perawat juga bisa
melakukannya dengan sikap non verbal yang lain, seperti menganggukkan kepala
juga bisa menunjukan rasa menghormati.
d. Mempertahankan sikap terbuka. Tidak melipat tangan atau kaki saat berkomunikasi.
Maksudnya adalah dalam berintraksi dengan klien bahwa perawat menunjukan sikap
bahwa perawat hadir untuk klien.
e. Tetap rileks. Maksudnya dalam berintraksi dengan klien perawat tidak menunjukan
sikap tergesa-gesa, menampakan raut muka yang tenang, berbicara dengan pelan dan
intonasi yang cukup. Contoh bila perawat menunjukan sikap tergesa-gesa maka klien
akan mempersepsikan bahwa perawat sedang sibuk dan tidak ada waktu untuk yang
cukup untuk berkomunikasi.

Sumbersumbernilai yang mempengaruhikomunikasiefektif

Komunikasi terapeutik adalah suatu interaksi interpersonal antara perawat dan klien,
yang selama interaksi berlangsung, perawat berfokus pada kebutuhan khusus klien untuk
meningkatkan pertukaran informasi yang efektif antara perawat dan klien. ( Videbeck, 2001).
Dalam komunikasi terapeutik perawat perlu memahami dirinya dan memahami klien secara jelas
. Semakin besar pemahaman perawat terhadap perasaan dan respon diri dirinya , semakin baik
pula ia berkomunikasi dan memahami orang lain.

Tindakan personal perawat timbul dari respon yang disadari ataupun tidak disadari yang
dibentuk oleh nilai dan keyakinan pendidikan, spiritual, dan budaya. Begitu pula dengan klien ,
respon klien juga banyak dipengaruhi oleh nilai dan keyakinan yang mereka anut. Dalam
hubungan terapeutik akan muncul banyak reaksi emosional yang berbeda antara perawat-klien ,
seperti kesedihan, kemarahan, rasa tidak nyaman dan sebagainya. Perawat harus menyadari hal
ini dan menentukan bagaimana respon emosional mempengaruhi baik komunikasi verbal
maupun non verbal. Ketika menghadapi klien terutama dari latarbelakang budaya atau etnis yang
berbeda , perawat perlu mengetahui dan menemukan gaya komunikasi yang nyaman bagi klien
dalam hal kontak mata, sentuhan, kedekatan dan sebagainya.

Setiap budaya memiliki aturan sendiri yang mengatur komunikasi verbal dan non verbal.
Dalam budaya tertentu orang berbicara dengan intonasi yang rendah , bahasa yang jelas dan
pengulangan secukupnya untuk membantu pendengar memahami apa yang dibicarakan, namun
pada budaya yang lain bisa sebaliknya. Setiap budaya dan kelompok etnik memiliki gaya
komunikasi yang berbeda. Etnik Arab menyampaikan informasi dengan penuh semangat dan
volume suara yang tinggi. Etnik Pakistan mendecakkan lidah tanda tidak setuju. Orang Asia
lebih tenang dalam berbicara, karena berteriak atau meninggikan suara menunjukan kehilangan
kendali. Etnik Eropa Utara dan etnik asli Amerika lebih menunjukan ketegaran dan kurang
memperhatikan emosi dibanding etnik Mediterania misalnya Yunani dan Itali , dimana emosi
harus ditunjukan berulang-ulang . Dalam budaya penduduk asli Amerika , melakukan kontak
mata saat berbicara tidak dapat diterima karena menandakan sikap tidak hormat. Dalam budaya
muslim kontak mata antara jenis kelamin yang berbeda tidak dianjurkan.. dan dianggap tidak
sopan. Demikian pula dengan sentuhan , praktek sentuhan berbeda pada setiap budaya. India dan
Kamboja hanya berjabat tangan dengan pria, tidak boleh dengan wanita. Orang Korea selatan
mengganggap sentuhan orang asing sebagai penghinaan. Dalam budaya barat berjabat tangan
merupakan salam nonverbal bagi orang yang baru bertemu, bagi budaya asia membungkukkan
badan merupakan bentuk salam nonverbal yang diterima dan menunjukan status sosial.
Karenanya perawat perlu mengkomunikasikan terlebih dahulu pada awal kontak dengan klien
terkait perbedaan budaya , nilai dan keyakinan, sehingga perawat dapat melakukan komunikasi
yang efektif dan terapeutik terhadap klien.

Ada beberapa sumber yang mempengaruhi pembentukan nilai pada seseorang atau
kelompok orang , diantaranya adalah :

a. Pengaruh budaya terhadap nilai

Nilai dan keyakinan dapat berasal dari berbagai sumber. Nilai berakar pada kondisi
eksistensi manusia, baik genetik maupun budaya . ( Fromm, 1957, dalam Craven RF & Hirnle
CJ, 2003). Ada 8 dasar nilai universal yaitu : cinta, kebenaran, keadilan, kebebasan, persatuan,
toleransi, tanggungjawab dan penghormatan terhadap kehidupan. ( Kidder, 1994, dalam Craven
RF & Hirnle CJ, 2003). Walaupun nilai nilai diatas menunjukan sifat yang universal namun
budaya dapat membuatnya berbeda satu dengan yang lainnya. Suatu budaya dapat
mempengaruhi , dilihat dari cerita atau mitos tentang bagaimana orang orang tersebut hidup
dan menjalankan kehidupan. Misalnya berbagai macam nilai pada orang Amerika yang
dipengaruhi oleh budaya mereka antara lain seperti : nilai individualisme, nilai kesetaraan, nilai
kebebasan, nilai personal ( privacy ), nilai berubah, nilai kemajuan, nilai pencapaian, dan nilai
materialistis.

b. Pengaruh sosialisasi

Yaitu nilai-nilai yang dalam pembentukanya dipengaruhi oleh institusi sosial, seperti
keluarga, sekolah, dan agama. Pada periode masa Anak-anak , mereka belajar nilai dalam
beberapa cara. Anak belajar melalui orang tua dan keluarga yang mengasuh, guru, dan figure
otoritas lain :

dalam menjalankan perilaku menghargai dan memberi hukuman,


bahasa yang mewarnai fikiran dan persepsi
model perilaku seseorang yang bermakna yang menghasilkan berbagai macam
gambaran dan mempengaruhi perilakunya
harapan yang tidak langsung diucapkan
( Hall et al, 1982, dalam Craven & Hirnle , 2003).

Pada periode remaja dan dewasa orang orang mungkin menghadapi bebagai macam
nilai dan menjadi sadar akan perbedaan. Proses perbaikan terhadap nilai berlanjut disepanjang
perkembangan kehidupan. Hal ini mungkin akan menghasilkan perencanaan, proses penemuan
dan kesadaran diri, atau menjadi sebuah ukuran atau standar kehidupan dan berhadapan dengan
situasi kehidupan yang timbul

c. Pengaruh komunitas

Sebuah institusi seperti pendidikan, tempat kerja, membentuk rasa komunitas (sense of
community ) melalui pengembangan nilai-nilai dan tujuan yang secara konsisten
mengintegrasikan kedalam berbagai kegiatan. Institusi selanjutnya meningkatkan nilai-nilai
ini ketika memperlakukan orang-orang dengan mempertimbangkan nilai-nilai yang sudah
disepakati. Pengalaman dalam komunitas juga memberikan suatu dukungan dimana orang
menjadi lebih leluasa dalam berbagai sikap, keyakinan, dan perilaku.

d. Pengaruh budaya kelompok ( peer )

Sikap, keyakinan, dan perilaku yang tumbuh dalam hubungan dengan kelompok sebaya
( peer group) adalah sangat mempengaruhi. Kelompok sebaya menunjukan dirinya melalui
ketertarikan , kebutuhan, dan masalah yang sama.

e. Pengaruh role model

Role model yang efektif mempengaruhi nilai-nilai yang mereka yakini dan kembangkan.
Pada usia dewasa muda akan lebih cepat menyadari ketidaksesuaian antara perkataan dan
perbuatan. Respon pada dewasa tua akan membuat usaha dalam kehidupan sesuai dengan apa
yang mereka katakan.

f. Pengaruh pengalaman yang menantang cara berfikir

Semua pengalaman dalam kehidupan dapat menjadi tantangan bagi nilai-nilai individu tetapi
orang yang cerdas akan merefleksikan pengalamannya dan menterjemahkan dan
mengintegrasikan kedalam praktek .

Pengaruh Nilai dan Keyakinan Dalam Komunikasi


Praktik keperawatan mengharuskan perawat untuk berhubungan dengan klien
tidak hanya secara fisik, tetapi juga secara emosional, psikologis dan spiritual. Didalam
kehidupan manusia, nilai berperan sebagai standar yang mengarahkan tingkah laku. Nilai
membimbing individu untuk memasuki suatu situasi dan bagaimana individu bertingkah laku
dalam situasi tersebut. Nilai menjadi criteria yang dipegang oleh individu dalam memilih,
memutuskan sesuatu atau dalam berkomunikasi ( Craven &Hirnle, 2003).
Komunikasi merupakan proses penyampaian informasi dari pemberi pesan kepada
penerima pesan yang merupakan elemen dasar dari interaksi manusia yang memungkinkan
seseorang untuk menetapkan, mempertahankan dan meningkatkan kontak dengan orang lain
(Potter & Perry, 2005). Semua tingkah laku merupakan komunikasi (verbal maupun non
verbal) dan semua komunikasi akan mempengaruhi tingkah laku, sehingga komunikasi pada
dasarnya dapat menjadi suatu alat untuk memfasilitasi hubungan terapeutik atau malahan
dapat berfungsi sebagai penghalang terhadap tumbuhnya hubungan yang terapeutik.Cara
berkomunikasi dipengaruhi oleh banyak faktor antara lain perkembangan, persepsi, latar
belakang sosial budaya, emosi dan salah satu diantaranya adalah nilai dan keyakinan.
Misalnya sosial budaya sebagai sumber nilai dapat mempengaruhi bahasa dan gaya
komunikasi. Budaya juga akan membatasi cara bertindak dan berkomunikasi seseorang.
Kebudayaan yang memiliki sistem nilai dan keyakinan juga berfungsi untuk mengajarkan
tata cara berkomunikasi, baik verbal maupun non verbal(Potter & Perry, 2005).
Ketika kita berkomunikasi dengan orang dari suku budaya atau agama lain, kita
dihadapkan dengan sistem nilai dan aturan yang berbeda. Sulit memahami komunikasi atau
berkomunikasi dengan orang lain jika kita sangat etnosentrik (menganggap suku sendiri
paling baik). di Indonesia masih sering terdengar stereotip-stereotip kesukuan. Misalnya
orang Jawa dan Sunda beranggapan bahwa mereka halus dan sopan dan bahwa orang Batak
kasar, nekat, suka berbicara keras, pemberang dan suka berkelahi. Tetapi orang Batak sendiri
menganggap bahwa watak mereka itu bernilai pemberani, terbuka, suka berterus terang,
pintar, rajin, kuat dan tegar. Dan orang Batak menganggap bahwa orang sunda dan Jawa
sopan dan halus tetapi mengandung arti yang lemah dan tidak terbuka. Jadi tidak semua
perilaku komunikasi baik verbal maupun non verbal mempunyai makna yang sama dalam
setiap budaya. Itulah nilai dan keyakinan yang dimiliki oleh setiap individu maupun
komunitas, yang menuntun setiap orang dalam berkomunikasi. (Mulyana, 2001).
Dalam berkomunikasi bagaimana kita memposisikan diri kita lebih terbuka
terhadap perbedaan nilai, kepercayaan dan sikap, berkomunikasi dengan sikap positif,
menganggap berkomunikasi adalah kesetaraan, tetap percaya diri, tenang, mengisyaratkan
empati dengan ekspresi wajah, gerak gerik yang penuh minat dan perhatian, dan tidak
sombong (Mulyana, 2001).

Nilai dan Keyakinan Suku Jawa


Suku Jawa merupakan suku bangsa terbesar di Indonesia, setidaknya 41,7 %
penduduk Indonesia merupakan etnis Jawa. Suku bangsa Jawa sebagian besar
menggunakan Bahasa Jawa dalam bertutur sehari-hari. Bahasa Jawa memiliki aturan
perbedaan kosa kata dan intonasi berdasarkan hubungan antara pembicara dan lawan
bicara. Aspek kebahasaan ini memiliki pengaruh sosial kuat dalam budaya Jawa, dan
membuat orang Jawa biasanya sangat sadar akan status sosialnya dimasyarakat. Sifat
orang Jawa pada umumnya lembut, akomodatif dan mudah bersahabat dengan siapapun.
Tetapi orang non-Jawa perlu hati-hati menyikapi dan memandang orang Jawa. Jangan
sekali-kali meremehkan orang atau mengecewakan. Ketika cara berkomunikasi kita
sebagai lawan bicara dengan intonasi suara yang agak tinggi dan terdengar kasar, mereka
akan menganggap bahwa lawan bicara sedang marah, walaupun sebenarnya tidak sedang
marah. Hal ini memungkinkan terjadinya konflik dalam berkomunikasi. Nilai dan
keyakinan suatu budaya menuntun setiap orang untuk berkomunikasi baik secara verbal
maupun nonverbal, dengan memahami nilai dan keyakinan yang dianut oleh orang lain.

NilaidanKeyakinanSuku Batak
Orang Batak mengakusebagaisuku yang paling toleran di seluruh Indonesia.
Karenaitumenurutmereka, kerusuhandengan motif etnikmaupun agama
tidakakanmasukke tanah air mereka. Sudahmenjadihal yang lazim di sanabahwa orang
Muslim membantu orang Kristen yang merayakan Natal, dansebaliknya orang Kristen
juga membantu orang Muslim yang merayakanLebaran.
Toleransiituterjadikarenaadapertalianadatataudalihannatolu yang sangatkuatdipegangoleh
orang Batak. Secaraumum orang Batak mengakutidakpunyamasalahdenganetnik-etnik
yang lain, termasukdenganetnikTionghoa.Orang Batak dinilaisukaberbicaradengansuara
yang keras agar diperhatikan orang lain (bahkanada yang
mengidentikkansukaberbicarainidengansukamembual), bersifatpemberanidanagresif,
merekaberanidalammengemukakanpendapatsendiriwalaupunmerekaberada di
dalamkedudukanminoritas, orang bataktidak akanterkalahkanolehkaum yang
mayoritas.Orang Batak itukasar, initampakdarikebiasaanmereka yang
sukaberbicarakeras-kerasdansukaberkelahi di depan orang lain danpernyataanini di
dukungdenganperawakanmerekamisalnyabentukdanekspresimuka. Cara
berkomunikasibaik verbal maupun nonverbal dipengaruhiolehnilaidankeyakinan yang
dianut.