Anda di halaman 1dari 9

SATUAN ACARA PENYULUHAN (SAP)

KESEHATAN LINGKUNGAN

Topik : Kesehatan Lingkungan


Subtopik :Pengertian, ciri lingkungan sehat, syarat lingkungan sehat,
pembuangan kotoran, pengelolaan sampah, penyakit akibat lingkungan
kurang sehat.
Sasaran : Keluarga
Hari, tanggal : Oktober 2016
Waktu : 20 menit
Tempat : di rumah warga

A. Tujuan Umum
Setelah peserta penyuluhan mengikuti kegiatan penyuluhan diharapkan keluarga
dapat memahami dan mengerti tentang konsep Kesehatan Lingkungan

B. Tujuan Khusus
Setelah mengikuti penyuluhan kesehatan tentang Hipertensi, keluarga diharapkan
dapat:
1. Memahami pengertian Kesehatan lingkungan
2. Memahami ciri lingkungan sehat
3. Memahami syarat lingkungan sehat
4. Memahami cara pembuangan kotoran
5. Memahami cara pengelolaan sampah
6. Memahami penyakit akibat lingkungan kurang sehat

C. Materi Penyuluhan
1. Memahami pengertian Kesehatan lingkungan
2. Memahami ciri lingkungan sehat
3. Memahami syarat lingkungan sehat
4. Memahami cara pembuangan kotoran
5. Memahami cara pengelolaan sampah
6. Memahami penyakit akibat lingkungan kurang sehat

D. Metode Penyuluhan
a. Ceramah
b. Tanya Jawab
c. Dokumentasi

E. Media Penyuluhan
a. Materi SAP
b. Leaflet
c. LembarBalik

F. Kegiatan Penyuluhan

No TahapPengk
Waktu KegiatanPenyuluhan Sasaran Media
ajian
1 Pembukaan 5 Menit Membuka acara Menjawab salam Materi
dengan dan SAP
mengucapkan salam mendengarkan
dan perkenalan perkenalan.
Menyampaikan Mendengarkan
topik dan tujuan penyampaian
Penyuluhan kepada topik dan tujuan
sasaran Menyetujui
Kontrak waktu kesepakatan
untuk kesepakatan pelaksanaan
penyuluhan dengan Penkes
sasaran

2 Kegiatan Inti 5 Menit Mengkaji ulang Menyampaikan LembarB


tingkat pengetahuan tujuan yang alik
sasaran didapat. Leaflet
Pengertian, ciri Menanyakan hal
lingkungan sehat, hal yang belum
syarat lingkungan dipahami.
sehat, pembuangan
kotoran,
pengelolaan
sampah, penyakit
akibat lingkungan
kurang sehat.
Memberikan
kesempatan kepada
sasaran untuk
menanyakan hal
hal yang belum
dipahami
3 Evaluasi / 10 Menit Memberikan Menjawab LembarB
Penutup pertanyaan kepada pertanyaan alik
sasaran tentang Mendengarkan Leaflet
materi yang telah kesimpulan
disampaikan oleh Menjawab salam.
penyuluh
Menyimpulkan
materi
Menutup acara
dengan
mengucapkan salam

G. Evaluasi
1. EvaluasiStruktur
a. Persiapan materi
b. Persiapan media
c. Kelengkapan alat
e. Penyelenggaraan penyuluhan dilaksanakan di rumah

2. Evaluasi Proses
a. Penyuluhan dimulai sesuai dengan waktu yang direncanakan
b. Peserta penyuluhan antusias terhadap materi
c. Peserta mengajukan pertanyaan dan menjawab pertanyaan secara benar

3. Evaluasi Hasil
a. Peserta memahami dan mengerti tentang penyakit gastritis
b. Peserta hadir saat pertemuan
4. EvaluasiSasaran
Pertanyaandaripenyuluhdanjawaban yang diharapkansasaran:
a. Apa itu penyakit Gastritis?
Jawaban: peradangan yang terjadi dilambung akibat meningkatnya
sekresi asam lambung mengakibat kaniritasi/perlukaan pada lambung.
b. Apasajajenis-jenis Gastritis?
Jawaban: Gastritis akutdan gastritis kronis
c. Apasajapenyebab Gastritis?
Jawaban: Stress, usia, polamakan yang tidakbaik, makan terlalu banyak
atau cepat, merokok, minum alcohol atauminumanberkafein,
mengkonsumsi obat-obatan dalam dosis tinggi, keracunan makanan.
d. Apasajatandadangejala yang ditimbulkanoleh Gastritis?
Jawaban: Mualdanmuntah, kembung,
nyerisepertiterbakarpadaperutbagianatas, nafsu makan menurun, sering
sendawa dalam keadaan lapar, bila gastritis sudahparah,
muntahdarahatauterdapatdarahpadafeses.
e. Bagaimanacarapencegahan Gastritis?
Jawaban: Jaga pola makan secara baik dan teratur,makanmakanan yang
bersih, sehatdanbergizi, hindari stress, tidakmerokok,
tidakmengkonsumsi alcohol, tidakmengkonsumsiobat-
obatandalamdosistinggitermasuk aspirin.
f. Bagimanacarapengobatan Gastritis?
Jawaban: Makandenganporsikeciltapisering,
makanteraturdantepatwaktu, minum air
hangatjikaterjadimualdanmuntah, minumobatantasidajika gastritis
kambuh, istirahat yang cukup, hentikanmerokok, periksakanke mantra,
puskesmas, ataufasilitaskesehatanterdekat,jikanyeritidakkunjunghilang.
g. Apasajajenis-jenismakanan yang
dianjurkandantidakdianjurkanbagipenderita gastritis?
Makanan yang dianjurkan: bubur, kentang rebus, biscuit ,labusiam,
wortel, brokoli, pisang, pepaya, tomat.
Makanan yang tidakdianjurkan: ketan, jagung, ubitalas, ikanasin,
ikanpindang, kol, nangkamuda, nangka, durian, soft drink, kopi, kue
tart, coklat, keju, makanan yang pedasdanbersifatasam.

H. Referensi
http://fendy-nurse.blogspot.com/2013/01/konsep-satuan-acara-
penyuluhanpada.htmlhttp://sylviayerisca04.blogspot.com/2014/04/sap-satuan-
acara-penyuluhan-gastritis.html
LAMPIRAN

GASTRITIS

A. Pengertian Gastritis
Gastritis yang biasanya orang awammengatakannyamaagadalahperadangan
yang
terjadidilambungakibatmeningkatnyasekresiasamlambungmengakibatkaniritasi/
perlukaanpadalambung.

Secara alami lambung akan terus memproduksi asam lambung setiap waktu
dalam jumlah yang kecil, setelah 4-6 jam sesudah makan biasanya kadar
glukosa dalam darah telah banyak terserap dan terpakai sehingga tubuh akan
merasakan lapar dan pada saat itu jumlah asam lambung terstimulasi. Bila
seseorang telat makan sampai 2-3 jam, maka asam yang menumpuk dalam
lambung akan semakin banyak dan berlebih. Hal ini dapat menyebabkan luka
atau iritasi pada dinding lambung sehingga timbul rasa perih.

B. Macam-Macam Gastritis
1. Gastritis Akut
a. Gastritis stress akut, merupakan jenis Gastritis yang paling berat,
yang disebabkan oleh penyakit berat atau trauma (cedera) yang
terjadi secara tiba-tiba.
b. Gastitis erosifa kronis, bisa merupakan akibat dari
mengkonsumsiobat-obatanataukarenaterinfeksiolehbakteri.
c. Gastritis eosinofilik, terjadi akibat dari reaksi alergi terhadap infestasi
cacing gelang.
2. Gastritis Kronis
Gastritis kronisadalahsuatuperadanganbagianpermukaanmukosalambung
yang berkepanjangandanterjadisecaramenahun.

C. Penyebab Gastritis
1. Stress
2. Usia
3. Polamakan yang tidakbaik. Misalnyaterlambatmakan, makanmakanan yang
pedas, asam yang dapatmerangsangasamlambungcontohcabe, cuka,
sambal, ketandan lain-lain. Makanterlalubanyakataucepat, danmakanan
yang terinfeksiolehbakterihelicobakterphylory.
4. Merokok
5. Mengkonsumsi alcohol atauminumanberkafein
6. Mengkonsumsiobat-obatandalamdosis yang tinggi. Contohnyaaspirin dan
antalgin. (aspirin
dalamdosisrendahsudahdapatmenyebabkanerosimukosalambung)
7. Keracunan makanan

D. Tanda dan Gejala


1. Mualdanmuntah
2. Kembung
3. Nyerisepertiterbakarpadaperutbagianatas
4. Nafsu makan menurun secara drastis, wajah pucat, suhu badan naik, keluar
keringat dingin
5. Sering sendawa terutama bila dalam keadaan lapar
6. Terkadangdisertaisakitkepala
7. Bila gastritis sudahparah,
makanakanterjadilukapadalambungsehinggamenyebabkanperdarahan.
Gejala yang
timbulsaatlambungsudahterdapatlukaadalahmuntahdarahatauterdapatdarah
padafeses.

E. Cara Pencegahan
1. Jaga pola makan secara baik dan teratur. Hindari menunda waktu makan
karena akan mengakibatkan produksi asam lambung meningkat
2. Makanmakanan yang bersih, sehatdanbergizi. Hindarimakanan yang
merangsangkerjalambung. Contohnyamakananpedas, asam, dan kopi
3. Hindari stress yang berlebihan. Andadapatmengalihkan rasa stress
denganberolahraga yang baikbagitubuh
4. Tidakmerokok
5. Tidakmengkonsumsi alcohol
6. Hindaripenggunaanobat-obatanterutama yang
mengiritasilambungmisalnya aspirin

F. Cara Pengobatan
Jikaandamengalamiataumempunyairiwayat gastritis, hal-hal yang
dapatandalakukanantara lain adalah:
1. Makandenganporsikeciltapisering. Contohmakananadalah snack
ataumakananringan.
2. Makanteraturdantepatwaktu
3. Dianjurkanminum air hangatjikaterjadimualdanmuntah
4. Minumlahobatantasida (obatmaag) jika gastritis kambuh
5. Istirahat yang cukup
6. Kalaumerokok, hentikanmerokok
7. Segeraperiksakankedokterjikanyeritidakkunjunghilang

G. Jenis-jenismakanan yang dianjurkandantidakdianjurkan


Makanan yang dianjurkan:
a. Sumberhidratarangataukarbohidrat: bubur, kentang rebus, biscuit
dantepung-tepungan yang dibuatbuburatau pudding.
b. Sayur yang takberseratdantidakmenimbulkan gas: labukuning, labusiam,
wortel, brokoli
c. Buah-buahan yang tidakasamdantidakberalkohol : pisang, pepaya, tomat

Makanan yang tidakdianjurkan:


a. Makanan yang secaralangsungmerusakdindinglambung: nasikeras, ketan,
jagung, ubitalas.
b. Sumber Protein Hewani: daging yang berlemak,ikanasin, ikanpindang.
c. Sayurantertentu (sawi, kol, nangkamuda,nanas)
d. Buah-buahantertentu (nangka, pisangambon, durian)
e. Minuman yang mengandung soda danalkohol: soft drink, tape, susu,
anggurputihdan kopi.
f. Makanan yang secaralangsungmerusakdindinglambungyaitumakanan
yang mengandungcukadanpedas, merica.

g. Makanan yang sulitdicerna yang


dapatmemperlambatpengosonganlambung.
Karenahalinidapatmenyebabkanpeningkatanperegangan di lambung yang
akhirnyadapatmeningkatkanasamlambungantaralainmakananberlemak,
kue tart, coklatdankeju.