Anda di halaman 1dari 19

Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

1.Whatcharacteristicismostusedtodefinelipids?
a.ioniccharge
b.meltingpoint
c.solubility
d.abilitytobindmetalions

ANSWER:c

2.Whichofthefollowinglipidmoleculespossessadifferentfundamentalstructuralmake-upfromtheothers?
a.Fattyacids
b.Cholesterol
c.Triglycerides
d.Sphingolipids
e.Glycolipids

ANSWER:b

3.Whatdoesamphipathicmean?
a.havingbothpositiveandnegativecharges
b.havingbothacidandbaseproperties
c.havingbothhydrophilicandhydrophobicregions
d.havingtwostereoisomers

ANSWER:c

4.Whichofthefollowingstatementsistrue?
a.Alltriacylglycerolsandallphosphoacylglycerolshavethesamefattyacidsinthem.
b.Alltriacylglycerolshavethesamefattyacids,butthefattyacidsinphosphoacylglycerolsvary.
c.Thefattyacidsintriacylglycerolsvary,butallphosphoacylglycerolshavethesamefattyacidsinthem.
d.Thefattyacidsinbothtriacylglycerolsandinphosphoacylglycerolsvary.

ANSWER:d

5.Howmanyhydroxylgroupsdoesamoleculeofglycerolhave?
a.none
b.1
c.2
d.3
e.4

ANSWER:d

Copyright Cengage Learning. Powered by Cognero. Page 1


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

6.Whichofthefollowingistrue?
a.Allfattyacidshaveanevennumberofcarbons
b.Mostfattyacidshaveanoddnumberofcarbons
c.Fattyacidsareequallylikelytohaveanevennumberofcarbonsastheyareanoddnumber
d.Fattyacidswithanoddnumberofcarbonsaremorerarethanthosewithanevennumber
e.noneofthese

ANSWER:d

7.Whichofthefollowingisnotacharacteristicofmostfattyacids?
a.Presenceoftransdoublebonds.
b.Evennumberofcarbonatoms.
c.Onlyonecarboxyl(COOH)group.
d.Absenceofconjugateddoublebonds.
e.Allofthesecharacterizelipids.

ANSWER:a

8.Unsaturatedfattyacidsusuallyhave____doublebonds.
a.cis
b.trans
c.no
d.sevenoreight

ANSWER:a

9.Whichofthefollowingcompoundsyieldsthemostenergypergram?
a.triacylglycerols
b.carbohydrates
c.proteins
d.Theyallyieldaboutthesameamountofenergypergram.

ANSWER:a

10.Whatkindsofbondsdolipasebreakinordertoreleasefattyacidsfromtriacylglycerols?
a.esters
b.carbon-carbonsinglebonds
c.carbon-carbondoublebonds
d.Therearenofattyacidsintriacylglycerolstorelease.

ANSWER:a

Copyright Cengage Learning. Powered by Cognero. Page 2


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

11.Whichofthefollowinggroupsisnotpresentinaphosphatidicacid?
a.Choline
b.Fattyacids
c.Glycerol
d.Phosphate
e.Allofthesearecomponentsofphosphatidicacid.

ANSWER:a

12.Whichofthefollowinggroupsisnotpresentinacerebroside?
a.Sphingosine
b.Fattyacid
c.Phosphate
d.Sugar
e.Allofthesecanbecomponentsofcerebrosides.

ANSWER:c

13.Whichofthefollowingisnotaproductofsaponificationofatriglyceride?
a.Longchainfattyalcohols.
b.Thesaltofthefattyacids.
c.Soaps.
d.Glycerol.
e.Alloftheseareproductsofsaponification.

ANSWER:a

14.Saponificationisthehydrolysisofa(n)
a.peptidebond
b.esterbond
c.anhydridebond
d.glycosidicbond

ANSWER:b

15.Whichofthefollowinggroupsisnotpresentinlecithin?
a.Choline
b.Fattyacids
c.Glycerol
d.Phosphate
e.Allofthesearecomponentsoflecithin.

ANSWER:e

Copyright Cengage Learning. Powered by Cognero. Page 3


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

16.Whichofthefollowingalcoholsisneverfoundinphosphatides?
a.Ethanolamine
b.Serine
c.Inositol
d.Sugars
e.Allofthesecanbecomponentsofphosphatides.

ANSWER:e

17.Whichofthefollowinglipidsisnotfoundinbiologicalmembranes?
a.triacylglycerols
b.phosphoacylglycerols
c.glycolipids
d.cholesterol

ANSWER:a

18.Glycolipidsarecharacterizedbycontainingthefollowingnon-lipidcomponent:
a.Sugars
b.Glycerol
c.Phosphate
d.Sphingosine
e.Morethanoneofthesecharacterizeglycolipids.

ANSWER:a

19.Phospholipidsareparticularlyimportantinthesestructures:
a.Membranes.
b.Lipoproteins.
c.Thebrainandnervoussystem.
d.Membranes,thebrainandthenervoussystem.
e.Allofthesearecorrect.

ANSWER:e

20.Whichofthefollowingmoleculesisnotamphipathic?
a.cholesterol
b.glucose
c.oleicacid
d.phosphatidylcholine

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 4


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

21.Whichofthefollowingistrue?
a.FattyacidswithtransdoublebondsmaybeparticularlyunhealthybecausetheyincreasetheratioofLDLsto
HDLs.
b.Afattyacidwith14carbonsandonetransdoublebondwillbehavemorelikeasaturatedfattyacidwith14
carbonsthanwillanunsaturatedfattyacidwithacisdoublebond.
c.Fattyacidswithtransdoublebondscanbeformedbyhydrogenationreactionofpolyunssaturatedfattyacids
d.fattyacidswithtransdoublebondstendtohavehighermeltingpointsthanthosewithcisdoublebondsallelse
beingequal
e.Allofthesearecorrect

ANSWER:e

22.Glycolipidsareparticularlyimportantinthesestructures:
a.Membranes.
b.Lipoproteins.
c.Thebrainandnervoussystem.
d.Membranes,thebrainandthenervoussystem.
e.Allofthesearecorrect.

ANSWER:d

23.Sphingolipidsareparticularlyimportantinthesestructures:
a.Membranes
b.Lipoproteins
c.Thebrainandnervoussystem.
d.Membranes,thebrainandthenervoussystem.
e.Allofthesearecorrect.

ANSWER:d

24.Whichofthefollowinggroupsisnotpresentinsphingomyelin?
a.Sphingosine
b.Fattyacid
c.Phosphate
d.Sugar

ANSWER:d

Copyright Cengage Learning. Powered by Cognero. Page 5


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

25.Whichofthefollowingfourfattyacidshasthehighestmeltingpoint?

1. CH3CH2CH2CH2CH2COOH
2. CH3CH2CH2CH2CH2CH2CH2CH2CH2COOH
3. CH3CH2CH2CH2CH2CH2CH2COOH
4. CH3CH=CHCH2CH2COOH
a.1
b.2
c.3
d.4

ANSWER:b

26.TheHDLclassoflipoproteinisgenerallybelievedtobepreventativeofheartdisease.
a.True
b.False

ANSWER:a

27.Fattyacidswithmultipledoublebondsareusuallyconjugated.
a.True
b.False

ANSWER:b

28.Whichofthefollowingfourfattyacidshasthelowestmeltingpoint?

1. CH3CH2CH2CH2CH2COOH
2. CH3CH2CH2CH2CH2CH2CH2CH2CH2COOH
3. CH3CH2CH2CH2CH2CH2CH2COOH
4. CH3CH=CHCH2CH2COOH
a.1
b.2
c.3
d.4

ANSWER:d

29.Withwhatcompoundarefattyacidsreactedtomakeafatoroil?
a.cholesterol
b.glycerol
c.sphinganine
d.ceramide

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 6


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

30.Themyelinsheathsofneuronstypicallycontainlargeamountsof
a.waxes
b.triacylglycerols
c.cholesterol
d.sphingolipids

ANSWER:d

31.Lipidsdifferfrommostotherbiomoleculesbecausetheyaredefinedonthebasisofsolubility,ratherthanontheir
chemicalstructure.
a.True
b.False

ANSWER:a

32.Whichofthefollowingbestdescribeslipids'insolubilityinwater?
a.Theyaretypicallyverysoluble.
b.Theyaretypicallyinsoluble.
c.Thereisnogeneraltrendastolipids'solubilityinwater.

ANSWER:b

33.Glycolipidsonthesurfaceofcellsareespeciallyimportantascellmarkers.
a.True
b.False

ANSWER:a

34.Biologicalwaxesarecomposedof
a.glycerolandonlyonefattyacid.
b.glycerolandtwofattyacids
c.afattyacidandalong-chainalcohol.
d.cholesterolandafattyacid.

ANSWER:c

35.Whichofthefollowingcelltypescontainscholesterol?
a.bacteria
b.animal
c.plant
d.Theyallcontaincholesterol.

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 7


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

36.Cholesterolisparticularlyimportantasacomponentofanimalmembranes.
a.True
b.False

ANSWER:a

37.Membranelipidsinalipidbilayerareheldtogetherby
a.hydrophobicinteractions
b.hydrogenbonds
c.electrostaticforces
d.covalentbonds

ANSWER:a

38.Cellmembranestypicallydisplayasymmetry.Whatdoesthismean?
a.Thetwoleavesofabilayercontaindifferentcollectionsoflipidsandproteins.
b.ThefattyacylchainonC-1ofamembranelipidisusuallydifferentfromthatonC-3.
c.OnlyonestereoisomeriseverseenatthechiralC-2oftheglycerolresidueinamembranelipid.
d.Membranelipidsonlyhavecisdoublebonds,nevertrans.

ANSWER:a

39.Howdoesthepresenceofcisdoublebondsinfattyacidsaffectmembranefluidity?
a.Theytendtoincreasethefluidity.
b.Theytendtodecreasethefluidity.
c.Theydon'thaveanyspecificeffectonfluidity.
d.fattyacidsdonthavecisdoublebonds

ANSWER:a

40.Howdoescholesterolaffectmembranefluidity?
a.Ittendstoincreasethefluidity.
b.Ittendstodecreasethefluidity.
c.Itdoesn'thaveanyspecificeffectonfluidity.
d.membranesdonthavecholesterol

ANSWER:b

41.Plantsneedcholesterolintheirmembranestocounteracttherigidityofthecellwall.
a.True
b.False

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 8


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

42.Membranesaregenerallysymmetrical,i.e.,theouterfaceiscomposedofthesamenumberandtypesof
phospholipidsastheinnerface.
a.True
b.False

ANSWER:b

43.Whichofthefollowingwouldnotbeenrichedontheoutersideofthelipidbilayercomparedtotheinnerside?
a.Phosphoacylglyerol
b.Ganglioside
c.Cerebroside
d.Sphingomyelin

ANSWER:a

44.Theassociationofmembraneproteinswithlipidsinthemembranebilayeralwaysinvolves
a.electrostaticinteractions
b.hydrophobicinteractions
c.covalentlinkages
d.alloftheabove

ANSWER:b

45.Theorder-disordertransition(melting)inmembranes
a.iscooperative
b.canbemonitoredbyfluorescencetechniques
c.canbemonitoredbyspinlabeling
d.allofthese

ANSWER:d

46.Howdothemembranesofplantandanimalcellscompare?
a.Animalcellmembranestendtobemorerigidthanthoseofplantcells.
b.Animalcellmembranestendtobemorefluidthanthoseofplantcells.
c.Animalcellmembranestendtobemoreasymmetricthanthoseofplantcells.
d.Animalcellmembranestendtobemoresymmetricthanthoseofplantcells.

ANSWER:a

Copyright Cengage Learning. Powered by Cognero. Page 9


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

47.Whichofthefollowingisnottrue?
a.Plantoilsarefavoredinthedietbecausetheygenerallycontainmoreunsaturatedfatsthanfoundinanimal
fats.
b.Unsaturatedfattyacidsarehealthierforhumansthansaturatedones
c.Heartdiseasecanbecorrelatedwithdietshighinsaturatedfattyacids
d.UnsaturatedfattyacidsleadtohigherlevelsofLDLthansaturatedfattyacidsdo

ANSWER:d

48.Thedistributionoflipidsinmembranesis
a.uneven,withbulkiermoleculesontheexterior
b.characterizedbyevendistributionofmolecules
c.distinguishedbytheabsenceofcholesterol
d.notwellunderstood

ANSWER:a

49.Thedegreeofmembranefluiditydependson
a.thepercentageoflipidsthatcontaincholine
b.thepercentageofglycolipids
c.thepercentageoffattyacids
d.thepercentageofunsaturatedfattyacids

ANSWER:d

50.Whichofthefollowingwasnotadesiredgoalofhydrogenatingpolyunsaturatedfattyacidsinbutter-likespreads?
a.Tomakethecompoundhavetheconsistencyofbutter
b.Tomakethecompooundasolidatroomtemperature
c.Toputtransdoublebondsintothemolecule
d.Toremovesomeofthedoublebondsinthemolecule

ANSWER:c

51.IfindthatbrieflywashingcellsinabufferedsolutionatpH11iseffectiveforisolatingacellmembrane-associated
hormonereceptor.(AstandardgrowthsolutionforthecellsispH7.)Whichoffollowingbestfitsthisdescription?
a.Thisisanintegralmembraneproteinthatcompletelytraversesthecellmembrane.
b.Thisisanintegralmembraneproteinthatonlypenetratesoneleafofthecellmembrane.
c.Thisisaperipheralmembraneproteinthatprobablyinteractswithmembranephospholipidsusingaspartate-
mediatedsaltbridges.
d.Thisisaperipheralmembraneproteinthatprobablyinteractswithmembranephospholipidsusinglysine-
mediatedsaltbridges.

ANSWER:d

Copyright Cengage Learning. Powered by Cognero. Page 10


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

52.Whichofthefollowingisnotafunctionorcharacteristicofmembraneproteins?
a.Transport
b.Catalyticactivity
c.Bloodclotting
d.Receptorsites

ANSWER:c

53.Wherecanmembraneproteinsbelocated?
a.entirelywithinthemembrane
b.onthesurfaceofthemembrane
c.ineitherposition
d.Thepositionofmembraneproteinshasneverbeendetermined.

ANSWER:c

54.Whenamembranereachesitstransitiontemperature,integralmembraneproteinsdissociatefromthebilayer.
a.True
b.False

ANSWER:b

55.Whichpropertyhasnotbeenobservedformembraneproteins?
a.beingdegradedforenergyduringbiologicalpathways
b.transportofsubstancesintoandoutofthecell
c.catalysis(enzymaticactivity)
d.actingasareceptor

ANSWER:a

56.Thefreeze-fracturetechniqueofelectronmicroscopyisusefulinstudyingmembranestructurebecause
a.integralmembraneproteinscanbeseeninassociationwithoneleafletofthelipidbilayer
b.alltheproteinscanberemovedfromthemembrane
c.thedegreeoforderofthelipidbilayercanbedetermined
d.thepresenceofboundcarbohydratescanbedetected

ANSWER:a

Copyright Cengage Learning. Powered by Cognero. Page 11


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

57.Whichofthefollowingtreatmentswouldbemostusefulinseparatinganintegralmembraneproteinfromthelipid
componentofacellmembrane?
a.ChangethepH.
b.Addasalt.
c.Addadetergent.
d.Addamixtureofproteases.
e.Noneofthese.Youcan'tseparateanintegralmembraneproteinfromthelipid.

ANSWER:c

58.Whichofthefollowingisthebestphrasetodescribethemodernviewofmembranestructure?
a.Membranesarelipid-lipidbilayers.
b.Membranesarelipid-lipidbilayerswithassociatedproteins.
c.Membranesarecomposedsolelyoflipidsandproteins.
d.Membranesareafluidmosaicoflipidsandproteins.
e.Membranesarefoundonlyineukaryoticcells.

ANSWER:d

59.Liposomesare
a.artificialmembrane-boundedstructuresusedtodelivermedications.
b.single-layeredmembranes.
c.mixedmicellesinvolvedincholesteroltransportamongcells.
d.bilayerswiththehydrophobicregionsontheoutside.

ANSWER:a

60.Inthefluidmosaicmodelofmembranestructure
a.theproteinsarespecificallybondedtothelipids
b.theproteins"float"inthelipidbilayer
c.theproteinsaresandwichedbetweenthelipidmolecules
d.thelipidsaresandwichedbetweentheproteinmolecules

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 12


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

Exhibit8A

61.RefertoExhibit8A.Whichproteinwouldlikelybeinvolvedinachannel?
a.1
b.2
c.3
d.4
e.Youcannottellfromthediagram.

ANSWER:a

62.RefertoExhibit8A.Whichproteinmighthelptoidentifythecelltype?
a.1
b.2
c.3
d.4
e.Morethanonecouldhelpidentifythecelltype.

ANSWER:e

63.RefertoExhibit8A.Protein#2wouldmostlikelyfunctionasa:
a.Carrier
b.Channel
c.Cellidentity
d.Receptor
e.Youcannottellfromthediagram.

ANSWER:a

Copyright Cengage Learning. Powered by Cognero. Page 13


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

64.Passivetransportisthesameas:
a.simplediffusion
b.facilitateddiffusion
c.activetransport
d.primaryactivetransport

ANSWER:b

65.Themechanismofmembranetransportmayinvolvethefollowing:
a.ATPhydrolysis.
b.Conformationchangeofmembraneproteins.
c.Phosphorylationordephosphorylationofmembraneproteins.
d.ATPhydrolysisandconformationchangeofmembraneproteins.
e.Allofthesearecorrect.

ANSWER:e

66.Transportofacompoundacrossacellmembrane(downaconcentrationgradient)wasmeasuredatseveral
concentrations.ThepresenceorabsenceofATPhadnoeffectonthetransportofthiscompound.Whichbest
describesthemechanismoftransport?

ConcentrationDifference, TransportRate,
M mol/min
2.5 30
5 60
10 100
25 175
50 200
a.facilitateddiffusion
b.passivediffusion
c.primaryactivetransport
d.secondaryactivetransport
e.protonpumping

ANSWER:a

67.Thedifferencebetweenactivetransportandpassivetransportisthat
a.concentrationgradientsareinvolvedinoneandnotintheother.
b.glycolipidsplayaroleinoneandnotintheother.
c.onerequiresexpenditureofenergybythecellandtheotherdoesnot.
d.ionsaretransportedintoandoutofthecellbyoneprocessandnotbytheother.

ANSWER:c

Copyright Cengage Learning. Powered by Cognero. Page 14


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

68.Facilitateddiffusionrequires
a.achannelproteinthroughwhichthetransportedsubstancepasseswithoutbinding
b.acarrierproteintowhichthetransportedsubstancebinds
c.areceptorprotein
d.expenditureofenergybythecell

ANSWER:b

69.Whichofthefollowingisnottrue?
a.Receptorsareofteninvaginatedintothecellafterbindingtotheirspecificmolecule.
b.Agivenreceptortypeispresentataconstantlevelontheoutsideofacell
c.Incertaindiseasestates,thelevelofagivenreceptorisincreasedordecreased
d.Bindingofreceptorstoligandssometimesshowshyperbolicbindingcurves

ANSWER:b

70.Intheoperationofthesodium-potassiumpump
a.conformationalchangesinmembraneproteinsareinhibited
b.theionsinvolvedbindtothelipidportionofthemembrane
c.amembraneproteinisphosphorylatedwithATPasthesourceofthephosphategroup
d.amembraneproteinisphosphorylatedwithADPasthesourceofthephosphategroup

ANSWER:c

71.Whatdistinguishesprimaryfromsecondaryactivetransport?
a.Therequirementforprotein.
b.ThetypeoflinkagetoATPhydrolysis
c.Thenumberofkindsofmoleculesorionstransported
d.Therelativedirectionoftransport

ANSWER:b

72.Whichofthefollowingmethodsoftransportacrossamembranedoesnotrequireaprotein?
a.Passivetransport
b.Facilitatedtransport
c.ActiveTransport
d.Simplediffusion
e.theyallrequireaprotein

ANSWER:d

Copyright Cengage Learning. Powered by Cognero. Page 15


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

73.Whichofthefollowingstatementsconcerningactivetransportistrue?
a.Ittakesplaceinthesamedirectionasaconcentrationgradient.
b.Itrequiresnoexpenditureofenergybythecell.
c.Itcanbecomparedtowaterrunningdownhill.
d.Amembrane-associateproteinmustbeinvolved.

ANSWER:d

74.Amajordifficultyinextractingreceptorproteinsfrommembranesisthat
a.itisdifficulttoremovetheproteinsfromthemembranewithoutdenaturation
b.theremaybeveryfewmoleculesoftheproteininacell
c.receptorproteinstendtohavehighmolecularweights
d.allofthese

ANSWER:d

75.Inthesodium-potassiumpump
a.sodiumistransportedoutofthecellandpotassiumintothecell,bothagainstconcentrationgradients
b.sodiumistransportedintothecellandpotassiumoutofthecell,bothagainstconcentrationgradients
c.sodiumistransportedoutofthecellandpotassiumintothecell,bothinthesamedirectionasconcentration
gradients
d.sodiumandpotassiumarebothtransportedoutofthecellagainstconcentrationgradients

ANSWER:a

76.Ausefulmethodforstudyingmembraneproteinsinplaceinthemembraneis
a.nuclearmagneticresonance
b.x-raycrystallography
c.treatmentwithmercaptoethanol
d.treatmentwithdetergents

ANSWER:a

77.Glycoproteinsonthecellsurfaceareinvolvedinthistypeoffunction:
a.Cellidentification
b.Receptorsites
c.Immunefunction
d.Cellidentificationandreceptorsites
e.Allofthesearecorrect.

ANSWER:e

Copyright Cengage Learning. Powered by Cognero. Page 16


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

78.Thekeyreactionofeyesight(indimlight)involvingvitaminAis:
a.ReactionoftheproteincomplexcalledRhodopsin.
b.Acis-transisomerizationofadoublebond.
c.Bleachingofapigmentintheretina.
d.ReactionofRhodopsinandcis-transisomerizationofadoublebond.
e.Allofthese.

ANSWER:e

79.Thesetwolipidvitaminsareoftenfoundinmembranes:
a.AandD
b.AandE
c.DandE
d.EandK
e.Noneoftheseisthecorrectpair.

ANSWER:b

80.Thefollowinglipidvitaminisoftenusedtopreservefoodsfromspoiling:
a.A
b.D
c.E
d.K
e.Noneofthesepreservesfood.

ANSWER:c

81.VitaminEhasallofthefollowingproperties,except:
a.Itisanantioxidant.
b.Itcanbemadeinthesunshine.
c.Itisessentialforatleastsomemammal'sfertility.
d.Itisoftenacomponentofmembranes.
e.AllofthesedescribevitaminE.

ANSWER:b

82.Ricketsiscausedbyadeficiencyin
a.vitaminA.
b.vitaminD.
c.vitaminE.
d.vitaminK.

ANSWER:b

Copyright Cengage Learning. Powered by Cognero. Page 17


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

83.Thevitaminneededforbloodcoagulationis
a.vitaminA
b.vitaminD
c.vitaminE
d.vitaminK

ANSWER:d

84.Thevitaminclassifiedasfatsolubleratherthanwatersolubleis
a.vitaminA
b.vitaminB1
c.vitaminB6
d.vitaminC

ANSWER:a

85.Therearelikelytobehugestoresoflipidvitaminsinhealthyanimals.
a.True
b.False

ANSWER:a

86.Whichofthefollowingisnotalipid-solublevitamin?
a.AscorbicAcid
b.Cholicalciferol
c.VitaminK
d.Retinol
e.Tocopherol

ANSWER:a

87.Thefollowinglipidvitaminhasimportantinvolvementwithcalciumions:
a.A
b.D
c.E
d.K
e.Morethanonereactswithcalciumion.

ANSWER:e

Copyright Cengage Learning. Powered by Cognero. Page 18


Name: Class: Date:

Chapter8LipidsandProteinsAreAssociatedinBiologicalMembranes

88.Whichofthefollowingisametabolicprecursorofprostaglandins&leukotrienes?
a.vitaminA.
b.arachidonicacid.
c.sphingomyelin.
d.cholesterol.

ANSWER:b

89.Aspirinproducesmostofitsanalgesiceffectsby
a.bindingtotheplasmamembraneofnervecells
b.inhibitingthesynthesisofvitaminA
c.inhibitingthesynthesisofphospholipids
d.inhibitingthesynthesisofprostaglandins

ANSWER:d

90.Whichofthefollowingdoesnotbelonginthelist?
a.Retinol
b.VitaminA
c.beta-carotene
d.Cholesterol

ANSWER:d

Copyright Cengage Learning. Powered by Cognero. Page 19