Anda di halaman 1dari 133

PERADABAN ISLAM PADA MASA RASULULLAH

Nabi Muhammad saw lahir di tengah kabilah besar bani hasyim di kota mekkah pada
pagi senin tanggal 9 Rabi’ul awwal pada tahun tragedy pasukan bergajah atau empat puluh tahun
berlalunya kekuasaan Kisra Anussyirwan. Bertepatan pada tanggal 20 atau 22 april tahun 571 M
sesuai dengan analisis seorang ulama besar, Muhammad sulaiman al-Manshur Furi dan seorang
astrolog ( Ahli ilmu falak ) Mahmud Basya. Setelah rosulullah dimuliakan oleh allah dengan
nubuwah dan risyahlah,kehidupan beliau dapat di bagi menjadi dua fase yang masing-masing
memiliki keistimewaan sendiri secara total, yaitu
1. Fase Mekkah : Berlangsung selama kurang lebih 13 tahun
2. Fase Madinah : Berlangsung selama 10 tahun lebih

Fase mekkah dapat di bagi menjadi tiga tahapan :


1. Tahapan dakwah sirriyyah ( dakwah secara sembunyi-sembunyi); berlangsung selama
tiga tahun
2. Tahapan dakwah jahiriyyah ( dakwah secara teang-terangan ) kepada penduduk mekah ;
dari permulaan tahun keempat kenabian hingga Rosulullah hijrah ke madinah
3. Tahapan dakwah di luar mekkah dan penyebarannya di kalangan penduduknya ; dari
penghujung tahun ke sepuluh kenabian,yang juga mencakup Fase Madinah dan
berlangsung hingga akhir hayat Rosulullah .

Dan kami rasa kami tidak perlu lagi menjelaskan Dakwah Rosulullah pada Fase Mekkah,
karna kelompok dua sebelumnya sudah menjelaskan secara detile tentang Dakwah Rosulullah
pada Fase Mekkah, dan kami akan melanjutkan pada Fase Madinnah, Hijrahnya Rosulullah ke
madinah
A. Fase Makkah
1. Keadaan arab Makkah sebelum masuk Islam
Pada awal sebelum dakwah Islam dilakukan oleh Rasulullah di kota Makkah,
bangsa arab Makkah pada waktu itu dikenal dalam sejarah sebagai kaum jahiliyah,
“jahiliyah secara harfiah berarti kebodohan; menurut istilah adalah penyembahan
berhala (Wasaniyyah) yang terjadi disemenanjung arab sebelum Islam. Jahiliyah
diambil dari kata jahila(bodoh), kebalikan ‘alima(pandai). Istilah jahiliyah biasa
digunakan untuk menggambarkan “masa kebodohan” atau masa kegelapan, yaitu
masa-masa ketika bangsa arab tidak memiliki aturan hukum, Nabi, dan kitab suci
yang diwahyukan.
Kejahiliyahan bangsa arab mekkah pada waktu itu terlihat sekali pada
tingkahlaku dan kebiasaan mereka sehari-hari yaitu berhala yang mereka buat sendiri
mereka sembah sebagai tuhan dan kebiasan membunuh anak perempuan mereka
hidup-hidup. Bisa kita bayangkan betapa cemasnya seorang ibu yang sedang hamil
menunggu kelahiran anaknya, takut jika yang lahir itu adalah berjenis kelamin
perempuan, dan betapa kecewanya seorang ibu ketika mendapatkan seorang putera
yang baru lahir dan mungkin sedang lucu-lucunya kemudian dibunuh oleh bapak
kandungnya sendiri.
a) Keadaan ilmu pengetahuan
Keadaan ilmu pengetahuan pada masyarakat arab Makkah sebelum masuknya
Islam sangat memprihatinkan sekali, menurut ahmad amin dalam bukunya fajr al-
Islam, kaum Quraisy penduduk Makkah sebagai bangsawan dikalangan bangsa
arab hanya memiliki 17 orang yang pandai tulis baca. Suku aus dan suku khazroj
penduduk yatsrib (Madinah) hanya memiliki 11 orang yang pandai membaca. Hal
ini menyebabkan bangsa arab sedikit sekali mengenal ilmu pengetahuan dan
kepandaian lain. Hidup mereka mengikuti hawa nafsu, berpecah-belah, saling
berperang satu dengan yang lain karena sebab yang sepele, yang kuat menguasai
yang lemah, wanita tidak ada harganya, berlakulah hukum rimba. Keistimewaan
mereka hanyalah ketinggian dalam bidang syair-syair jahili yang disebarkan
secara hafalan.
b) Keadaan sosial
Keadaan sosial masyarakat arab Makkah sebelum masuknya Islam adalah
bersifat kesukuan dan tidak adanya kesatuan politik, tentunya solidaritas sesama
anggota suku sangatlah kuat, sedangkan perasaan terhadap suku lain tidak ada.
Merka tidak memiliki undang-undang dan peraturan seperti saat ini, mereka
hanya memiliki seperangkat adat istiadat yang berbeda-beda antara suku dengan
suku lainnya. Masyarakat- masyarakat yang ada sebelum datangnya misi kenabian
(Muhammad SAW), mereka telah kehilangan ikatan antar individu-individunya,
sedang yang ada hanya ikatan kesukuan yang tegak diatas asas
‘ashabiyah(fanatisme) jahiliyah. Saudara dan keponakan dalam tradisi masyarakat
arab jahiliyah akan selalu ditolong dan dibela baik dalam posisi benar maupun
salah.
c) Keadaan ekonomi
Ekonomi pada masa itu dikuasai oleh kelompok-kelompok minoritas yang
monopoli ekonomi, karenanya terciptalah starata sosial antara kelompok yang
kaya dan kelompok yang miskin, sehingga secara alami kekuasaan dipegang oleh
kelas sosial yang memiliki kekayaan. Mereka biasa dengan transaksi dan
berbisnis cara riba.
2. Nabi Muhammad SAW diutus sebagai Rasulullah
Pada saat Nabi Muhammad di gua hira itulah pertama kali wahyu diturunkan dari
Allah melalui malaikat Jibril kepada Nabi Muhammad SAW, yaitu surat al-‘alq ayat 1-
5. Dengan turunnya wahyu pertama itu, berarti Muhammad telah dipilih oleh tuhan
sebagai Nabi. Dalam wahyu pertama ini, dia diperintahkan untuk menyeru manusia
pada suatu agama. Setelah wahyu pertama itu datang jibril tidak muncul lagi untuk
beberapa lama, sementara Nabi Muhammad menantikannya dan selalu datang ke gua
hira. Dalam keadaan menanti itulah turun wahyu yang membawa perintah kepadanya.
Wahyu tersebut berbunyi sebagi berikut : hai orang yang berselimut, bangun, dan beri
ingatlah. Hendaklah engkau besarkan tuhanmu dan bersihkanlah pakaianmu,
tinggalkanlah perbuatan dosa, dan janganlah engkau memberi (dengan maksud)
memperoleh (balasan) yang lebih banyak dan untuk (memenuhi perintah) tuhanmu
bersabarlah(al-muddatsir:1-7). Ayat al-Muddatsir 1-7 itulah yang menjadi dasar
Rasulullah berdakwa secara sembunyi-sembunyi.
1) Dakwah Secara sembuny-sembunyi
Rasulullah memulai dakwah secara sembunyi-sembunyi dengan mengajak
sahabat-sahabatnya yang terdekat terlebih dahulu untuk menyembah Allah SWT
dan meng-esakannya, membangun persatuan dan meninggalkan peperangan.
Pada dakwah secara sembunyi-sembunyi ini berhasil mendakwahkan kepada
orang-orang terdekatnya sehingga orang yang pertama kali menerima masuk
Islam adalah:
1. Siti Khadijah (istri Rasulullah)
2. Ali Bin Abi Thalib (sepupu Rasulullah)
3. Abu Bakar (sahabat karib Rasulullah)
4. Zaid bin haritsah (Anak angkat Rasulullah), Dan beberapa orang terdekat Abu
Bakar, yaitu :
5. Ustman Bin Affan
6. Zubaer Bin Awwam
Mereka inilah sebagai pondasi pertama mulai ditegakkannya peradaban Islam
dan dengan seruan mereka juga sangat membantu Rasulullah dalam menyebarkan
ajaran Islam.
1) Dakwah secara terang-terngan
Setelah tiga tahun berlalu dakwah secara sembunyi-sembunyi kemudian
Rasulullah mulai dakwah secara terang-terangan dengan mengundang kerabatnya
untuk berkumpul dan Rasulullah menyeru mereka secara terus-terang untuk mengajak
kepada Islam dan mengesakan Allah SWT serta mendukungnya dalam
menyampaikan ajaran Islam, kemudian mereka semuanya menolak kecuali Ali.
Langkah dakwah seterusnya yang diambil Nabi Muhammad SAW adalah
menyeru masyarakat umum. Nabi mulai menyeru segenap lapisan masyarakat kepada
Islam dengan terang-terangan, baik golongan bangsawan maupun hamb sahaya.
Mula-mula ia menyeru penduduk Makkah, kemudian penduduk negeri-negeri lain.
Disamping itu, ia juga menyeru orang-orang yang datang ke Makkah, dari berbagai
negeri untuk mengerjakan haji. Setelah Rasulullah berdakwah secara terang-terangan,
orang kafir Quraisy banyak yang merasa terganggu, apalagi dakwah Rasulullah sudah
menyebar luas di kalangan masyarakat dan sudah mulai memiliki banyak pengikut
terutama para hamba sahaya dan orang-orang miskin.
Para pemimpin kafir Quraisy pun mulai berusaha untuk menghalangi dan
mencegah berkembangnya ajaran Nabi Muhammad SAW. Menurut Ahmad Syalabi
ada 5 faktor yang mendorong orang-orang Quraisy menentang ajaran Islam;
a) Mereka tidak dapat membedakan antara kenabian dan kekuasaan. Mereka mengira
bahwa tunduk kepada seruan Muhammad berarti tunduk kepada kepemimpinan
Bani Abdul Muthalib.
b) Nabi Muhammad menyerukan persamaan hak antara bangsawan dan hamba
sahaya. Hal ini tidak disetujui oleh kelas bangsawan.
c) Para pemimpin Quraisy tidak dapat menerima ajaran tentang kebangkitan kembali
dan pembalasan di hari akhirat.
d) Taklid kepada nenek moyang adalah kebiasaan yang berurat berakar kepada
bangsa Arab.
e) Pemahat dan penjual patung memandang Islam sebagai penghalang rezeki.
Berbagai upaya dilakukan oleh pemimpin-pemimpin Quraisy untuk menantang
dan menghentikan dakwah Nabi Muhammad SAW diantaranya :
a) Pertama-tama mereka mendatangi paman Rasulullah yang bernama Abu Thalib.
Orang-orang Quraisy tahu betul bahwa Nabi Muhammad SAW memliki
kedudukan istimewa di sisi Abu Thalib. Demikian juga Abu Thalib memiliki
kedudukan yang istimewa di sisi kaum Quraisy, karena itu orang-orang Quraisy
yakin sekali bahwa melalui Abu Thalib mereka akan berhasil menghentikan
serangan-serangan Muhammad terhadap akidah-akidah mereka yang sesat.
Kemudian abu Thalib pun menolak mereka dengan perkataan yang lemah-lembut.
b) Mendatangi Abu Thalib kali yang kedua. Setelah pemimpin Quraisy melihat
rasullah tidak juga kunjung berhenti untuk berdakwah maka mereka menemui
Abu Thalib untuk yang kedua kalinya, kedatangan mereka disertai dengan nada
mengancam Abu Thalib, mereka berkata:
Mereka berkata : bahwa kami tidak sabar atas caci-maki terhadap tuhan kami,
dan menganggap bodoh akal pikiran kami, dan mencela tuhan kami, maka jika
tidak mampu melarang anak saudaramu itu maka izinkan kami yang
melarangnya.
a. Abu Thalib pun menyampaikan kepada Muhammad dan meminta kepada
Muhammad untuk menghentikan dakwahnya, tetapi Muhammad tetap konsisten
pada dakwahnya dan Abu Thalib pun mendukungnya.
c) Mendatangi Abu Thalib kali yang ketiga. Tatkala kafir Quraisy melihat abu thalib
juga tidak bermaksud untuk menghentikan Muhammad, kemudian mereka datang
sekali lagi dengan membawa ‘Umarah bin Walid (seorang Pemuda gagah dan
tampan) untuk ditukarkan dengan Muhammad. Kemudian Abu Thalib pun
menolak dengan nada yang tinggi.
d) Untuk kali berikutnya mereka lansung kepada Nabi Muhammad SAW. Mereka
mengutus Utbah ibn Rabiah, seorang ahli retorika, untuk membujuk Nabi. Mereka
menawarkan tahta, wanita dan harta asalkan Nabi Muhammad bersedia
menghentikan dakwahnya. Semua tawaran itu ditolak oleh Nabi Muhammad
dengan mengatakan : demi Allah, biar pun mereka meletakkan matahari di tangan
kananku dan bulan di tangan kiriku, aku tidak akan berhenti melakukan ini,
hingga agama ini menang atau aku binasa karenanya.
2) Hijrah ke habsyah
Penyiksaan-penyiksaan terhadap pengikut Rasulullah terus dilakukan oleh
kaum kafir Quraisy sehingga Rasulullah merasa perlu untuk mengungsikan para
sahabatnya untuk meninggalkan kota makka ke tempat yang lebih aman. Pada
tahun kelima dari kerasulannya, Nabi menetapkan habsyah(ethiopia) sebagai
pengungsian. Konon khabarnya raja habsyah yang memerintah pada waktu itu
adalah seorang pemimpin yang adil, maka untuk tahap pertama Rasulullah
mengungsikan 10 orang laki-laki dan 5 orang perempuan dan salah diantara
mereka Utsman bin Affan dan istrinya Ruqoyyah binti Rasulullah. Kemudian
menyusul rombongan kedua sebanya 73 orang laki-laki dan 11 orang perempuan.
Semakin keras kekejaman yang di lakukan terhadap kaum muslimin pada
waktu itu semakin tinggi simpati masyarakat terhadap ajaran yang dibawa
Rasulullah, hal ini terbukti dengan masuk Islamnya dua orang yang kuat
pengaruhnya di masrakat Quraisy waktu itu yaitu Umar bin Khattab dan hamzah
paman rasullah sendiri, mereka berdua terkenal dengan keberanian dan
kekuatannya, dengan Islamnya mereka berdua membuat kekuatan umat Islam
waktu itu bertambah.
3) Pemboikotan terhadap Rasulullah dan keluarganya
Kekuatan Islam makin hari makin bertambah dan semakin banyak orang yang
yang membela Rasulullah terutama keluarganya yaitu dari Bani Hasyim dan Bani
Muthallib, maka para pemimpin kafir Quraisy melarang masyarakat Quraisy
bertransaksi dengan mereka, tidak boleh menikahkan atau dinikahi dengan salah
seorang dari mereka, pemboikotan ini mendatangkan penyiksaan yang sangat
besar bagi rasullah dan pengikutnya.
Setelah berlalu tiga tahun pemboikotan terhadap rasululullah pengikut dan
keluarganya membuat ekspektasi terhadap ajaran Rasulullah semakin tinggi.
Melihat hal ini pemboikotan tersebut dihentikan oleh pemimpin Quraisy.
Setelah pemboikotan diakhiri, umat Islam merasa dapat sedikit bernafas,
mereka bisa kembali ke rumah masing-masing. Namun tidak lama sesudah itu
paman Nabi yang bernama Abu Thalib dan Istrinya Siti Khadijah yang selalu
membela dan melindungi Rasulullah meninggal dunia, kemudian terjadilah
peristiwa isra’ mikraj.
4) Bai’at ‘Aqobah
Setelah peristiwa isra, suatu perkembangan besar bagi kemajuan dakwah
Islam muncul. Perkembangan datang dari sejumlah penduduk Yatsrip (Madinah)
yang berhaji ke Makkah, Mereka terdiri dari suku Aus dan Khazraj. Mereka
masuk Islam dan membenarkan ajaran yang dibawa Rasulullah, inilah awal dari
berkembangnya ajaran Islam di Madinah. Pada tahun ke 12 kenabian, datanglah
jamaah haji dari Yatsrip(Madinah) berjumlah 12 orang laki-laki, didepan Nabi
mereka berikrar untuk memeluk Islam yang disebut Bai’at ‘Aqobah pertama
dengan syarat :
Tidak menyekutukan Allah SWT,Tidak mencuri,Tidak berzina,Tidak
membunuh anak-anak mereka,Tidak melakukan kebohongan yang mereka buat
sendiri dengan tangan dan kaki mereka sendiri, Tidak akan membangkang dari
kebaikan,Jika kalian menempati bai’at ini, maka kalian mendapatkan surga. Dan
jika kalian melakukan satu saja diantara(larangan dalam bai’at) ini, maka
urusannya kembali kepada Allah dan jika Allah berkehendak, maka Allah
menyiksanya, dan jika Allah berkehendak maka Allah mengampuninya.
Kemudian mereka kembali ke Madinah dan menyebarkan ajaran Islam di
sana. Pada tahun ke 13 datanglah kepada Rasulullah 73 orang laki-laki dan 2
orang perempuan. Mereka meminta Rasulullah untuk pindah ke Madinah, mereka
berjanji akan membela Rasulullah dari berbagai ancaman, dinamakan dengan
Bai’at ‘Aqobah Kedua. Kemudian mereka kembali ke Madinah dan menyebarkan
Islam.
B. Fase Madinah
Setelah terjadinya baiat aqobah II, Rasulullah menyuruh umat islam berhijrah ke Yasrib
secara sembunyi-sembunyi agar tidak diketahui oleh orang kafir. Beliaupun akhirnya
menyusul hijrah. Di Madinah, Nabi Muhammad SAW segera meletakkan dasar kehidupan
yang kukuhbagi pembentukan masyarakat baru. Disamping kaum Muhajirin dan Ansyar,
modal utama yang dimiliki oleh Nabi Muhammad SAW adalah Islam yang bersumber pada
wahyu yang ada dalam Al-Qur’an. Di dalamnya terkandung ajaran aqidah yang tinggi dan
sempurna sehingga mampu menyatukan manusia dibawah satu bendera. Fase madinah dapat
di bagi menjadi tiga tahapan :
1. Tahapan yang diliputi oleh suasana instabilitas dan penuh goncangan,terjadinya
problem-problem internal serta merangsaknya para musuh ke madinah untuk
menghabisi para penduduknya dari luar. Tahapan ini berakhir hingga terjadinya
“Perjanjian Hudaibiyyah” pada bulan zhulqa’dah tahun 6 H.
2. Tahapan gencatan senjata bersama para pucuk pimpinan kaum peganis dan berakhir
dengan terjadinya “ Penaklukan Mekkah “ ( Fathu Mekkah ) pada bulan ramadhan tahun
8 H yang merupakan tahapan berdakwah kepada para raja untuk menganut islam.
3. Tahapan berbondong-bondongnya manusia masuk Islam, yaitu tahapan berdatangannya
para kabilah dan bangsa ke Madinah. Tahapan ini terus berlangsung hingga Rasulullah
wafat pada bulan Rabi’ul Awwal tahun 11 H.
C. Tahapan Pertama Kondisi Aktual Di Madinah Ketika Berhijrah
Hijrah bukan berarti hanya sekedar lolos dari fitnah dan penyiksaan semata, akan
tetapi lebih dari itu, Hijrah artinya merangkai kerjasama dengan membangun tatanan baru
di negri yang aman. Oleh karna itu, merupakan kewajiban bagi setiap orang atau individu
muslim yang mampu untuk ikut berpartisipasi dalam pembangunan tanah air dan baru-
baru ini dan berupaya dengan segenap tenaga membentengi dan mengangkat citranya.
Kaum-kaum yang di hadapi Rasulullah di Madinah terdiri dari tiga golongan,
masing-masing berbeda kondisinya dengan yang lain dengan perbedaan yang mencolok
beliau juga menghadapi. Beliau juga menghadapi beragam kaum tersebut dengan beragam
masalahnya. Adapun tiga golongan itu adalah :
1. Para sahabatnya yang merupakan orang-orang pilihan mulia dan ahli kebajikan
2. Kaum musrikin yang belum beriman sementara mereka berasal dari jantung kabilah-
kabilah di Madinah.
3. Orang-orang yahudi
Prolema yang beliau hadapi terkait dengan para sahabatnya adalah kondisi Madinah
yang berbeda sama sekali dengan kondisi yang telah mereka lalui ketika di mekah dulu.
Sekalipun mereka ini, ketika di Mekkah dapat menyatukan kata, dan memiliki tujuan yang
sama namun ketika itu mereka berada di rumah-rumah terpisah, hidup sebagai orang yang
tertekan di hina dan terusir sedangkan ketika di madinah, urusan di kendalikan oleh kaum
muslimin sendiri sejak dari pertama kalinya dan tidak ada seorang pun yang menguasai
mereka karenanya, tibalah saatnya bagi mereka untuk menghadapi problematika politik
dan pemerintahan, problemamatika komdisi damai dan perang,penyeleksian total di dalam
masalah halal dan haram, ibadah dan akhlak serta problematika kehidupan lainnya.
Inikah problema terbesar yang di hadapi Rasulullah, berkaitan dengan kaum
muslimin sendiri dan inilah dalam tataran yang luas yang menjadi tujuan dalam dakwah
Islamiyah dan Risyalah Muhammad akan tetapi ini bukanlah permasalahan dadakan benar,
bahwa selain ini banyak sekali permasalahan yang perlu mendapatkan penyelesaian secara
sempurna kelompok islam terbagi menjadi dua bagian :
a. Mereka yang berada di tanah air, rumah dan harta mereka sendiri, tidak ada yang
mereka pentingkan dari hal itu selain layaknya seseorang yang berada dalam kondisi
aman di kelompoknya. Mereka ini adalah kaum Anshar. Diantara mereka terjadi
hubungan yang tidak mesra dan permusuhan-permusuhan bertahun-tahun sejak dulu.
b. Adapun kelompok kedua yaitu orang orang musyrikin yang merupakan jantung
kabilah kabilah Madinah. Akan tetapi mereka tidak dapat berkuasa atau kaum
muslimin, diantara mereka ini ada yang masih di liputi keraguan dan rasa bimbang
c. Kelompok ketiga adalah orang orang yahudi mereka pada mulanya menyebrang
hingga ke kawasan Hijaz pada masa penindaasam kaum Asyria dan Romawi
sebagaimana telah kami kemukakan sebelumnya. Mereka ini sebenarnya adalah kaum
ibrani akan tetapi setelah lari ke Hijaz, melebur dalam kultur arab, baik dalam
pakaian,bahasa maupun kebudayaan bahwa nama kabilah atau nama nama mereka
berubah menjadi ke arab araban.
1. Aspek Sosial Kemasyarakatan Di Madinah
Berbeda dengan Makkah, madinah senantiasa mengalami perubahan sosial yang
meninggalkan bemtuk keamsyarakatan absolut model badui. Kehidupan sosial
Madinah secara berangsur-angsur diwarnai oleh unsur kedekatan ruang daripada oleh
sistem kekerabatan. Madinah juga memimiliki sejumlah warga Yahudi, yang mana
sebagian besarnya lebih simpatik terhadap monotheisme.
Penduduk Madinah yang terdiri dari kaum Muhajirin, Anshar, dan nonmuslim
tersebut, merupakan sebuah keberagaman yang ada pada masa lalu dan sudah menjadi
suatu hal yang tidak bisa lagi dipungkuri eksistensinya. Tapi bukan hal itu yang akan
digaris bawahi, yang terpenting adalah jiwa sosialis masyarakat madinah sangat tinggi.
Ini terbukti dari persaudaraan yang tinggi dan sangat kokoh. Tidak ditemukan konflik
karena masalah perbedaan. Kalaupun ada masalah itu dengan cepat segara
terselesaikan, karena nabi sangat bijak dalam hal itu dan sangat hati-hati terhadap
peletakan sebuah nilai kemasyarakatan.
Nabi berhasil membentuk sistem yang luar biasa bagus. Masyarakat Madinah
merasa bahwa dirinya itu satu. Maka dari itu, apabilah ada satu yang sakit maka yang
lain turut merasakan. Hal ini lebih khusus lagi pada umat Muslim sendiri, di mana
sudah menjadi kewajiban di setiap Muslim sebagaimana dalam riwayat nabi seringkali
memerintahkannya. Ada Beberapa Teradisi Yang Yang Perlu Digaris Bawahi:
a. Silaturahim yang membudaya
b. Gotonngroyong sering diadakan demi kepentingan bersama
c. Kepedulian yang tinggi, mengungjungi orang yang sedang sakit atau yang terkena
musibah.
2. Aspek Politik Pemerintahan
Sistem pemerintahan yang digunakan Nabi yaitu sistem Musyawarah dan
Demokrasi dan yang terpenting adalah perkara diputuskan dengan seadil-adilnya.
Sehingga Golongan yang berbeda merasa tenang karena tidak ada diskriminasi. Pada
kebijakan politik yang pertama oleh Nabi adalah bagaimana menghapus perinsip
kesukuan dan mempererat persatuan. Beberapa strategi yang dilakukan Rasulullah,
dalam rangka memperkokoh masyarakat dan negara baru yang telah terbentuk.
Adapun strategi yang dilakukan adalah sebagai berikut:
a. Membangun Masjid Nabawi
Langkah pertama yang di lakukan Rasulullah setelah itu adalah mendirikan
masjid nabawi, beliau membelinya dari dua orang anak yatim, sang pemiliknya,
beliau sendiri ikut terjun di dalam membangun, masjid tersebut.
Pada lokasi tersebut terdapat bekas kuburan orang orang
musyrikin,puing,pohon kurma dan pohon Gharqad, lalu Rasulullah memerintakan
agar kuburan-kuburan musyrikin itu di bongkar, puing itu di ratakan dan pohon
korma dan pohon Gharqad tersebut di tebangi, lalu membuat shaf mengarah ke
kiblat, ketika itu arah kiblat masih mengarah ke Baitul Maqdis. Dua tiang pintu
(kusen) masjid ini terbuat dari batu, dinding-dindingnya terbuat dari batu bata dan
tanah liat, atapnya tersebut dari pelepah kurma,tiang tiangnya dari batang
pohon,lantai dasarnya di hamari oleh pasir dan krikil, terdiri dari tiga pintu
panjangnya dari kiblat hingga ke ujung belakang adalah 100 hasta, kedua isinya
juga demikian atau kurang dari itu serta pondasinya kira-kira sedalam tiga hasta.
Masjid tersebut bukan hanya di gunakan untuk beribadah ( sholat ),tetapi lebih
dari itu ialah sebuah kampus,tempat kaum muslimin untuk mempelajari ajaran
ajaran islam dan menerima pengarahan-pengarahan, tempat bertemu dan
bersatunya seluruh komponen beragam suku setelah sekian lama di jauhkan oleh
konflik-konflik dan peperangan jahiliyah , pangkalan untuk mengatur semua
urusan dan bertolaknya pemberangkatan serta parlemen untuk menghadapi siding-
sidang permusyawaratan dan Eksekutif. Pada permulaan hijrah, di syariatkanlah
adzan;suara lantunan keras yang menggema di angkasa. Setiap hari lima kali.
Karenanya , seluruh pelosok alam nyata menjadi beragama. Kisah mimpi
Abdullah bin Zaid bin Dawud,Ahmad dan Ibnu Khuzaimah amatlah mashur,
b. Mempersaudarakan sesama kaum muslimin
Nabi melakukan langkah yang paling indah yang pernah di torehkan oleh
sejarah, yaitu mempersaudarakan antara kaum Muslimin dengan kaum Anshar
Ibnu Kasim berkata “kemudian Rasulullah mempersaudarakan antara kaum
Muhajirin dengan kaum Anshar di rumah Anas bin Malik. Mereka berjumlah 90
orang, separuh dari kalangan Muhajirin dan separuhnya lagi dari kalangan Anshar.
Beliau mempersaudarakan di antara mereka untuk saling memiliki dan saling
mewarisi setelah mati tanpa memberikannya kepada kerabat. Hal ini berlangsung
hingga terjadi perang Badar namun setelah Allah menurunkan Ayat :
  
 
 
  
 
   
     
  
Artinya : “Dan orang-orang yang beriman sesudah itu Kemudian berhijrah
serta berjihad bersamamu Maka orang-orang itu termasuk golonganmu (juga).
orang-orang yang mempunyai hubungan kerabat itu sebagiannya lebih berhak
terhadap sesamanya (daripada yang bukan kerabat)[626] di dalam Kitab Allah.
Sesungguhnya Allah Maha mengetahui segala sesuatu. (Al-anfal :75)
c. Piagam Madinah
Rasulullah melakukan akad perjanjian yang mengikis habis setiap dendam
kesumat yang pernah terjadi pada masa Jahiliyah dan sentiment-sentimen
kesukuan. Beliau tidak menyisakan satu tempat pun bagi bersemayamnya tradisi-
tradisi Jahiliyah. Perjanjian yang di buat oleh Nabi Muhammad saw di antara
sesama kaum muslimin dan muslim dari suku Quraisy Yastrib dan orang yang
mengikuti mereka,berafiliasi dengan mereka serta berjuang bersama sama mereka :
1. Bahwa mereka adalah satu umat, yang berbeda dengan umat lainnya
2. Golongan muhajirin dari suku Quraisy tetap pada kelompok mereka,satu sama
lain saling bahu membahu dalam membayar diayat ( ganti rugi atas
pembunuhan tidak sengaja,pent ) dan menebus tawanan mereka dengan cara
yang ma’ruf dan adil di antara sesame kaum muslimin. Dan setiap kaum
Anshar tetap pada kelompok mereka, setiap kelompok saling membahu dan
membayar diyat mereka.
3. Bahwa kaum muslimin tidak akan membiarkan ada orang yang di lihat hutang
dan tidak mampu membayarnya di antara mereka, dengan cara memberinya
secara ma’ruf baik dalam hal tebusan atau pun diyat.
4. Bahwa kaum muslimin yang bertaqwa akan memusuhi orang yang melakukan
pembangkangan di antara mereka,mencari alas an berbuat
zhalim,dosa,permusuhan ataupun atau pun kerusakan diantara kaum muslimin.
5. Bahwa mereka semua bersatu menentangnya sekalipun dia adalah anak dari
salah seorang di antara mereka.
6. Seorang mukmin tidak boleh membunuh mukmin yang lain karena membunuh
orang yang kafir.
7. Tidak menolong orang kafir untuk melawan seorang mukmin
8. Tanggungan pelindungan Allah itu adalah satu,dan dapat di berikan kepada
mereka sekalipun oleh orang yang paling rendah di antara mereka ( kaum
mukmin )
9. Bahwa orang Yahudi yang mengikuti kami maka dia berhak mendapatkan
pertolongan dan perlakuan sama,tidak terzhalimi dan tidak tertindas.
10. Bahwa kondisi damai bagi kaum mukminin adalah satu, tidaklah seorang
mukmin yang lain di dalam perang di jalan allah kecuali mendapatkan hak
yang sama dan keadilan diantara mereka.
11. Bahwa kaum mukminin, sebagian mereka dapat menolak (melindungi)
sebagian yang lain,dalam tanggungan darah mereka di jalan Allah.
12. Bahwa orang musyrik tidak boleh melindungi harta ataupun jiwa orang
Quraisy dan juga tidak boleh menghalangi seorang mukmin terhadapnya.
13. Bahwasanya siapa yang membunuh seorang mukmin yang bersih dari
perbuatan criminal dan kejahatan lain yang membolehkannya untuk di bunuh
maka dia diqishash (terbunuh) merelakannya.
14. Bahwa orang orang mukmin seluruhnya menentang pelaku tersebut dan tidak
halal bagi mereka kecuali menegakkan hokum atas orang yang bersangkutan.
15. Bahwa tidak di bolehkan bagi seorang mukmin menolong seorang pembuat
Bid’ah dan memberikan pelindungan padanya.
16. Bahwa dalam hal apapun kalian berselisih (berbeda pendapat) maka dia harus
di kembalikan kepada Allah dan Muhammad saw.
D. Bidang Politik
Selanjutnya, Nabi Saw. Merumuskan piagam yang berlaku bagi seluruh pendudukan
Yatsrib, baik orang muslim maupun non muslim (Yahudi). Piagam inilah yang oleh Ibnu
Hasyim disebut sebagai Undang-undang Dasar Negara Islam (Daulah Islamiyah) yang
pertama.
1. Setiap kelompok mempunyai pribadi keagamaan dan politik. Adalah hak kelompok,
menghukum orang yang membuat kerusakan dan memberi keamanan kepada orang
patuh.
2. Kebebasan beragama terjamin buat semua warga Negara.
3. Adalah kewajiban penduduk madinah, baik kaum muslimin maupun bangsa Yahudi,
untuk saling membantu, baik secara moril atau materil. Semuanya dengan bahu
membahu harus menangkis setiap serangan terhadap kota Madinah.
E. Bidang Militer
Peperangan yang terjadi pada masa Rasul membawa akibat perkembangan Islam dan
kebudayaan Islam. Peperangan pada masa Rasul terdiri dari:
1. Ghazwah; yaitu peperangan yang dipimpin langsung oleh Rasul sendiri. Peperangan
ini terjadi dua puluh tujuh kali.
2. Syariah; yaitu peperangan yang dipimpin oleh para sahabat untuk memimpinnya,
peperangan ini terjadi tiga puluh delapan kali.
F. Bidang Dakwah
Musuh–musuh Islam melontarkan tuduhan kepada umat Islam, bahwa Islam
berkembang dibawah sinar mata pedang / kekerasan. Tuduhan yang demikian tidak
berdasar kenyataan. Dengan dakwah agama Islam mengalami perkembangan yang cukup
pesat. Hal ini disebabkan oleh beberapa faktor, yaitu:
a. Ajaran Islam simple, mudah, tidak memberatkan, tidak banyak tuntutan dan aturan.
b. Prinsip-prinsip dari masyarakat Islam bersendikan ukhuwah Islamiyah.
c. Islam tersiar luas dan cepat semata-mata karena Dakwah bi al-Hikmah dari Nabi dan
para sahabat.
Jihad dalam Islam mempunyai fungsi dan kedudukan:
a. Melindungi dan membela dakwah dari gangguan.
b. Melindungi masyarakat Islam dankaum Muslimin.
c. Merupakan tindakan pengamanan.
Adapun Ruang Lingkup Dakwah Islamiyah tidak hanya untuk bangsa Arab atau
hanya di jazirah Arab saja. Rasul diangkat sebagai rahmatan lil’alamin, maka dakwah
adalah untuk seluruh umat di dunia. Terbukti sebagaimana yang telah dilakukan Rasul,
setelah menata kehidupan Jazirah Arab secara Islami, Rasul menyeru kepada seluruh raja-
raja, penguasa yang ada disekitar Jazirah Arab, dengan mengirim utusan yang membawa
surat seruan mengikuti dakwah Islamiyah.
G. Perlawanan Kaum Quraisy Terhadap Kaum Muslim
Pesatnya perkembangan islam di Madinah, mendorong pemimpin Quraisy Mekkah
dan musuh-musuh Islam lainnya meningkatkan permusuhan mereka tehadap Islam. Untuk
mengantisipasi kemungkinan-kemungkinan gangguan dari musuh,Nabi sebagai kepala
Negara mengatur siasat dan membentuk pasukan perang. Umat islam pun pada tahun ke-2
Hijriah telah di izinkan berperang dengan dua alasan :
A. Untuk mempertahankan diri dan melindungi hak miliknya, dan
B. Menjaga keselamatan dalam penyebaran islam dan mempertahankannya dari orang-
orang yang menghalanginya.
Maka tidak mengherankan jika terjadi perperangan atara umat islam dengan kafir
Quraisy selama 8 tahun dalam puluhan kali pertempuran. Yang terpenting di antaranya
adalah :
a. Perang Badar
Terjadi pada bulan ramadhan 2 H (624) M. di dekat sebuah sumur milik Badr.
Sebab utamanya adalah untuk memenuhi tekat kaum Quraisy membunuh nabi yang
berhasil meloloskan diri ke Madinah dan menghukum orang yang melindunginya.
Penyebabnya secara kusus karena adanya berita lewat mata-mata bahwa kabilah
dagang yang di pimpin Abu Sofyan yang kembali dari syam akan di cegat oleh umat
islam di Madinah, sehingga Abu Sofyan mengambil jalan lain hingga selamat sampai
Mekkah. Umat islam memang memutuskan melakukan pencegahan itu, karna harta
kaum muhajirin yang di tinggal di Mekkah telah di ambil oleh orang Quraisy.
Orang orang Quraisy sebanyak 1000 orang di bawah pimpinan abu jalal bergerak
menuju Madinah. Sementara umat islam sebanyak 314 orang menyongsong barisan
itu. Dalam perang ini kaum muslimin keluar sebagai pemenang itu. Pihak islam gugur
14 orang dan pihak musuh gugur 70 orang terbunuh, termasuk Abu jahal sebagai
pemimpin perang, dan beberapa orang lain tertawan.
b. Peran Uhud
Terjadi pada tahun 3 H (625). Penyebabnya karena kekalahan kaum Quraisy dalam
perang Badr merupak pukulan berat. Mereka bersumpah akan melakukan pembalasan.
Untuk itu pemimpin Abu Sofyan memobilisasi 3000 prajurit. Beberapa orang
pembesar di sertai istrinya berperang termasuk istri Abu Sofyan sendiri bernama
Hindun. Mereka berangkat menuju madinah. Mendengar berita itu, Nabi
bermusyawarah dengan para sahabat dan di sepakati menyongsong musuh di luar kota.
Nabi Muhammad ddengan pasukan 1000 orang meninggalkan kota Madinah. Tetapi
baru saja melewati batas kota, Abdullah ibn Ubay seorang munafik dengan 300 orang
yahudi membelot kembali ke Madinah. Meskipun dengan 700 pasukan, Nabi tetap
melanjutkan perjalanan. Di bukit Uhud ke 2 pasukan itu bertemu. Nabi memilih 50
orang pemanah ahli di bawah pimpinan Abdullah ibn Jabir untuk menjaga garis
belakang pertahanan.
Mereka di perintahkan agar tidak meninggalkan tempat, apapun yang terjadi.
Perang dahsatpun berkobar. Pertama tama prajurit islam dapat memukul mundur
tentara musuh yang lebih besar itu. Pasukan berkuda yang di pimpin oleh Khalid ibn
Walid gagal menebus benteng pasukan pemanah islam. Sayangnya kemenangan yang
sudah di ambang pintu tiba-tiba gagal karena godaan harta godimah. Prajurit islam
mulai memungut harta rampasan perang tanpa menghiraukan gerakan musuh.
Termasuk di dalam anggota pasukan pemanah yang di peringatkan Nabi agar tidak
meninggalkan posnya. Kelengahan kaum muslimin ini di manfaatkan oleh Khalid bin
walid untuk melumpuhkan pasukan pemanah islam, dan pasukan musuh yang tadinya
sudah kalah berabalik menyerang pasukan islam, akibatnya satu persatu pahlawan
islam gugur, bahkan Nabi sendiri terluka dan terperosok jatuh ke dalam sebuah
lubang, dengan bercucuran darah.
Melihat kejadian itu, seorang Quraisy meneriakkan bahwa Nabi telah tewas. Karna
yakin bahwa nabi telah terbunuh, kaum Quraisy menghentikan perang di pihak islam
lebih dari 70 orang gugur termasuk paman Nabi Hamzah yang dadanya di belah dan
hatinya dimakan istri Abu SOfyan, Hidun. Penghianatan Abdullah ibn Ubay dan
pasukan yahudi yang membot di ganjar dengan tindakan tegas. Mereka itu terdiri dari
Yahudi Bani Nadir,salah satu suku Madinah, di usir keluar kota. Kebanyakan mereka
mengungsi ke khaibar, sedangkan yahudi lainnya yaitu bani Quraisy masih tetap di
madinah.
c. perang Ahzab
Terjadi pada bulan syawal 5 H (627 M). di pihak musuh membentuk pasukan
gabungan yang terdiri dari orang orang Quraisy,suku yahudi yang mengungsi ke
khaibar, dan beberapa suku Arab lainnya. Menghadapai pasukan sebanyak itu Nabi
Muhammad bertahan setelah mendengar usul Salman al-farisi, agar umat islam
bertahan dengan menggali parit(khandaq), terutama di bagian utara kota. Sisi lain di
kelilingi bukit yang dapat di jadikan sebagai benteng pertahanan. Itu lah sebabnya
selain perang ini di sebut perang ahzab (pasukan sekutu) juga perang khandaq (farit) .
di pihak islam terdapat 3000 orang prajurit. Taktik Nabi itu membawa hasil.
Pasukan musuh tidak dapat menyebrangi parit. Namun mereka mengepung
Madinah dengan mendirikan kemah kemah di luar parit hamper sebulan lamanya.
Karena mereka di tugasi nabi mempertahankan garis belakang gerbang dengan yahudi
Bani Nadir akan memukul umat isla. Hal itu membuat umat islam makin terjepit.
Apalagi mereka mengalami kesulitan yang amat dahsyat,menderita kelaparan,sehingga
terpaksa mengikat batu ke perut mereka. Namun dalam yang sempat mengoncangkan
jiwa mereka itu, pertolongan allah tiba. Angina dan badai yang amat kencang turun
merusak dan menerbang kan debu yang membuat mereka susah melihat. Mereka
terpaksa kembali ke negri masing masing tanpa hasil apapun. Sementara itu
penghianat-penghianat yahudi Bani Quraisy di jatuhi hukuman mati, sebanyak 7000
orang.

PERADABAN ISLAM MASA AL-KHULAFA’UR RASYIDIN

A. Pembentukan Khilafah pada khalifah Abu Bakar


1. Proses Pengangkatan Abu Bakar
Ketika kaum Muhajirin dan Anshar berkumpul di Saqifah Bani Sa’idah terjadi
perdebatan tentang calon khalifah. Masing-masing mengajukan argumentasinya tentang
siapa yang layak sebagai khalifah. Selanjutnya Abu Bakar menawarkan pola dualisme
kepemimpinan sekedar mewujudkan keadilan di antara keduanya dan demi menjaga
persatuan umat Islam. Semula pendapat ini diterima oleh kaum Anshar, namun Umar
bin Khattab tidak menyetujui adanya dualisme kepemimpinan di kalangan suku Arab,
karena Nabinya bukan berasal dari kaum Anshar. Pendapat Umar bin Khattab
mendapat perlawanan keras dari al-Hubab bin al-Munzir bin al-Jamur (kaum Anshar),
dan sempat terjadi perkelahian kecil diantara keduanya. Di tengah perdebatan tersebut,
Abu Bakar mengajukan dua calon yaitu Abu Ubaidah bin Jahrah dan Umar bin
Khattab. Pengajuan dua calon ternyata menimbulkan kegaduhan dan perselisihan
karena diantara keduanya terdapat perbedaan kualitas, terutama menyangkut wibawa
dan kedudukan.
Tetapi Umar bin Khattab tidak membiarkan perselisihan itu terus terjadi, maka
dengan suaranya yang lantang beliau membaiat Abu Bakar sebagai khalifah yang
diikuti oleh Abu Ubaidah. Kemudian proses pembaitan terus berlanjut seperti yang
dilakukan oleh Basyir bin Sa’ad beserta pengikutnya dan kaum muslimin dari suku
Aus. Proses pembaitan Abu Bakar sebagai khalifah ternyata tidak sepenuhnya mulus
karena ada beberapa orang yang belum memberikan ikrar seperti Ali bin Abi Thalib,
Abbas bin Abdul Muthalib, Fadl bin al-Abbas, Zubair bin al-Awwam bin al-As, Khalid
bin Sa’id, Miqdad bin Amir, Salman al-farisi, Abu Zar al-Gifari, Ammar bin Yasir,
Bara’bin Azib dan Ubai bin Ka’ab. Telah terjadi pertemuan sebagian kecil kaum
Anshar dengan Ali bin Abi Thalib di rumah Fatimah mereka bermaksud membaiat Ali,
dengan anggapan Ali lebih patut menjadi khalifah karena Ali berasal dari Bani Hasyim
yang berarti Ahlulbait Rasulullah saw.
Keengganan Ali bin Abi Thalib serta kemungkinan adanya segelintir kaum
Muhajirin dari Bani Hasyim ditepis sebagian ahli sejarah dengan kesaksian Sa’ad bin
Zaid tentang tidak adanya orang yang tertinggal dalam proses pembaitan Abu Bakar
sebagai khalifah. Setelah Abu Bakat terpilih menjadi khalifah, Abu Bakar kemudian
menyampaikan pidato yang memuat pernyataan antara, bahwa :
1. Dia mengakui bahwa dirinya bukanlah orang terbaik.
2. Dia harus dibantu hanya selama dirinya berbuat baik dan harus diluruskan bila dia
berbuat tidak baik (in asa'tu).
3. Dia akan memberikan hak setiap orang tanpa membedakan yang kuat dengan yang
lemah.
4. Ketaatan kepadanya tergantung pada ketaatannya kepada Allah.
Dijumpai fenomena menarik dari proses pembaitan Abu Bakar, bahwa isu
menjaga persatuan dan menghindarkan perpecahan di kalangan umat Islam saat itu
menjadi argumentasi Abu Bakar untuk meyakinkan kekhalifahannya. Argumentasi ini
cukup efektif karena kondisi sosial umat Islam saat itu di ambang krisis persatuan. Hal
itu ditandai dengan munculnya orang-orang murtad, keengganan sejumlah suku
membayar zakat dan pajak.
B. Perkembangan Islam Sebagai Kekuatan Politik
Masa kakhalifahan Abu Bakar merupakan masa kritis perjalanan syiar Islam
karena dihadapkan sejumlah masalah seperti ridat atau kemurtadan dan ketidaksetiaan.
Beberapa anggota suku muslim menolak untuk membayar zakat kepada khalifah untuk
Baitul Mal (perbendaharaan publik). Kemudian masalah berikutnya adalah munculnya
beberapa kafir yang menyatakan dirinya sebagai Nabi, serta sejumlah pemberontakan-
pemberontakan kecil yang merupakan bibit-bibit perpecahan.
Semasa hidupnya, Rasulullah saw pernah mengirimkan satu ekspedisi ke Syria di
bawah pimpinan Usamah bin Zaid, putera dari Zaid bin Harits ra yang gugur pada
perang Mut’ah di tahun 8 Hijriah. Pengiriman ekspedisi ini sempat diusulkan para
sahabat untuk ditarik kembali ke Madinah guna membantu mengatasi masalah dalam
negeri seperti memerangi orang-orang murtad, orang-orang yang enggan membayar
zakat dan memadamkan pemberontakan-pemberontakan kecil.
Namun usulan ini ditolak dengan tegas oleh Abu bakar karena pengiriman
ekspedisi ini merupakan amanah dari Rasulullah saw. Sikap tegas yang ditunjukkan
oleh Abu Bakar kelak membuahkan hikmah tersendiri bagi usaha penyelesaian konflik
sosial di dalam negeri.
Selama 40 hari berperang melawan orang-orang Romawi di Syria, akhirnya
ekspedisi usamah meraih kemenangan. Keberhasilan ini menimbulkan opini positif
bahwa Islam tetap jaya, tidak akan hilang seiring dengan wafatnya Rasulullah saw.
Akhirnya satu persatu suku-suku yang semula meninggalkan Islam kembali memeluk
Islam dan loyal terhadap kekhalifahan Abu Bakar al-Shiddiq. Kini persoalan dalam
negeri yang terakhir dan perlu segera dipadamkan adalah pemberontakan yang
digerakkan oleh nabi-nabi palsu seperti Aswad ‘Ansi dari Yaman, Tsulaiha dari suku
bani Asad di Arab Utara, Sajah binti al Harits di Suwaid,dan Musailamah al-Kadzdzab,
anggota suku Arab Tengah.
Abu Bakar mengirim Khalid bin Walid ra untuk manumpas pemberontakan-
pemberontakan tersebut dan berhasil memadamkannya. Demikian juga terhadap
gerakan kemurtadan dan suku-suku yang enggan membayar zakat dapat diselesaikan
dengan baik oleh Abu Bakar melalui perantaraan panglima perangnya, Khalid bin
Walid ra.
Setelah permasalahan besar dalam negeri dapat diatasi dengan baik, abu Bakar
memfokuskan pada kebijakan luar negeri yakni menyelamatnya suku-suku Arab dari
penganiayaan pemerintahan Persia. Untuk misi ini, Abu bakar kembali mengirimkan
Khalid bin Walid ra dengan pasukannya ke Iraq dan akhirnya bertempur dengan tentara
Persia di Hafir, pada tahun 12 H (633 M). Pada 15 Dzulqa’idah 12 H, Khalid bin Walid
ra, mengalahkan musuhnya secara total dan menduduki seluruh Iraq Selatan. Ekspedisi
berikutnya adalah ke Syria membantu perjuangan Usamah bin Zaid untuk
mengamankan daerah perbatasan dari serangan orang-orang Romawi. Karena
perbatasan merupakan jalur-jalur perdagangan bangsa Arab.
Sekitar bulan Rabi’uts-Tsani 13 H yang bertepatan dengan 31 Juli 634 M.
Akhirnya kekaisaran Romawi dapat ditumbangkan melalui perang Ajnadin. Padahal
dari sekian banyak pertempuran-pertempuran pasukan muslim jauh lebih kecil dari
pasukan lawan. Keberhasilan pasukan muslim mengalahkan pasukan lawan tidak
terlepas dari spiritual yang tinggi kaum muslimin seperti tersirat dalam opsi yang
disampaikan Khalid bin Walid ra maupun utusan-utusan muslim lainnya kepada Kaisar
Persia dan Panglima Perang Romawi.
Apa yang dilukiskan Khalid bin Walid ra tentang kondisi mental spritual pasukan
muslim memang tepat, karena mati syahid adalah dambaan setiap muslim dengan
ganjaran surga dan kekal didalamnya, apalagi kaum muslimin saat itu yang berada
dalam barisan pasukan muslim memiliki kualitas keimanan yang tinggi dengan
kesadaran akhirat yangtak tertandingi, sehingga kematian bukanlah sesuatu yang
menakutkan melainkan sesuatu yang didambakan karena yakin akan adanya hari
perhitungan atas segala amal yang diperbuat dan kehidupan akhirat setelah kehidupan
di dunia ini.
Di saat kemenangan demi kemenangan diraih pasukan muslim di Ajnadin. Abu
Bakar dikabarkan jatuh sakit tepatnya pada tanggal 7 Jumadil Akhir, 13 H, dan
akhirnya meninggal dunia setelah menderita sakit selama dua minggu. Beliau
meninggal dunia pada usia 61 tahun pada hari Selasa, 22 Jumadil akhir, 13 H (23
Agustus 634 M).
Meskipun Abu Bakar menjabat khalifah relatif singkat yakni dua tahun tiga bulan,
beliau berhasil membina dan mempertahankan ekstensi persatuan dan kesatuan umat
Islam yang berdomisili di berbagai suku dan bangsa. Wibawa umat Islam pun semakin
terangkat dengan ditaklukannya dua imperium terbesar dunia saat itu, yaitu Romawi
dan Persia. Kedua imperium ini menjadi poros kebudayaan dan peradaban dunia.
Karena penaklukan atau peletakan kedaulatan umat Islam di kedua imperium itu
menjadi aset yang sangat berpengaruh bagi pembangunan peradaban dunia Islami. Hal
itu terbukti dengan peradaban Islam yang pernah jaya berabad-abad lamanya di Jaziarh
Arab dan benua Eropa.
Implikasi sejarah semacam ini tentu tidak teranalisis pada masa kekhalifahan Abu
Bakar, karena beliau berperang bukan dengan tujuan kekuasaan melainkan semata-mata
menegakkan syariat Islam dan menciptakan kedamaian di mana pun umat Islam berada,
pekerjaan besar semacam ini tentu menguras energi tenaga dan pikiran yang sangat
besar. Usia Abu Bakar yang mencapai 60 tahun ketika dilantik menjadi khalifah, dan
kerja keras yang dilakukannya beresiko bagi kesehatan fisiknya, Abu Bakar pun jatuh
sakit dan meninggal dunia.
Prestasi lainnya adalah upaya pengumpulan Qur’an. Dari dialog Umar bin khattab
dengan Abu bakar bahwa begitu banyak para huffaz Qur’an yang syahid di medan
pertempuran sehingga dikhawatirkan oleh Umar dapat merusak kelestarian Qur’an itu
sendiri di masa yang akan datang.
Melalui kesaksian sejumlah sahabat yang pernah mendapat pengajaran Al-Qur’an
dari Rasulullah saw, dikumpulkan dan disalin kembali oleh Zaid bin Tsabit ra atas
instruksi khalifah Abu Bakar. Akhirnya Qur’an terhimpun dalam bentuk mushaf yang
dikenal dengan nama Mushaf al-Imam (Mushaf Usman). Dari sekian prestasi yang
terukir pada masa kekhalifahan Abu Bakar, maka jasa terbesar Abu Bakar yang dapat
dinikmati oleh peradaban manusia sekarang adalah usaha pengumpulan Qur’an yang
kelak melahirkan mushaf Usmani dan selanjutnya menjadi acuan dasar dalam
penyalinan ayat-ayat suci Al-Qur’an hingga menjadi kitab Al-Qur’an yang menjadi
pedoman utama kehidupan umat Islam bahkan bagi seluruh umat yang ada di
permukaan bumi ini.
C. Pembentukan Khilafah Pada Masa Umar Bin Khattab
1. Proses Pengangkatan Umar bin Khattab
Sebelum Abu Bakar meninggal, ditunjuklah Umar bin Khattab sebagai
penggantinya. Menurutnya hanya Umar bin Khattablah yang mampu untuk
meneruskan tugas kepemimpinan umat Islam yang waktu itu berada pada saat-saat
yang paling menentukan dalam sejarahnya yang akan mempengaruhi keberadaan
Islam dan umatnya yang masih muda usianya, khususnya dengan banyaknya
penaklukan-penaklukan umat Islam.
Sebelum Abu Bakar memutuskan untuk menetapkan Umar bin Khattab sebagai
penggantinya, terlebih dahulu beliau berkonsultasi dengan tokoh-tokoh masyarakat
yang datang menjenguknya, antara lain : Abd al-Rahman bin Auf, Usman bin Affan,
Usaid bin Hudlair al-Anshary, Said bin Zaid dan lain-lain dari kaum Muhajirin dan
Anshar. Ternyata mereka tidak keberatan atas maksud Khalifah untuk mencalonkan
Umar bin Khattab sebagai penggantinya.
Melihat kondisi umat Islam waktu itu, penunjukan Abu Bakar terhadap Umar
sebagai penggantinya merupakan pilihan yang sangat tepat. Umar adalah seorang
yang berkharisma tinggi, dan mempunyai sifat yang adil amat disegani terutama
terhadap orang yang mengenalnya. Salah satu bukti atas besarnya kharisma dan
keadilan Umar dihadapan pengikutnya adalah kebijaksanaannya ketika memecat
Khalid bin Walid yang digelari Rasulullah saw dengan gelar pedang Allah yang
amat dikagumi kawan maupun lawan. Pemecatan itu sendiri dilakukan sewaktu umat
Islam sangat membutuhkan seorang panglima perang sehebat Khalid bin Walid.
Tunduknya Khalid kepada kebijakan Umar itu menunjukkan betapa hebatnya
kharisma Umar bin Khattab di mata kaum muslimin.
Umar yang namanya dalam tradisi Islam adalah yang terbesar pada masa awal
Islam setelah Muhammad SAW. telah menjadi idola para penulis Islam karena
keshalehan, keadilan dan kesederhanaannya. Mereka juga mengannggapnya sebagai
personifikasi semua nilai yang harus dimiliki oleh seorang khalifah. Wataknya yang
yang terpuji menjadi teladan bagi para penerusnya. Para ilmuwan Barat pun
mengakui ketokohan Umar bin Khattab dalam panggung sejarah Islam. Michael H.
Hart menempatkannya pada urutan ke-51 dari seratus tokoh yang dianggap sangat
berpengaruh di dunia.
Meskipun pengangkatan Umar bin Khattab sebagai khalifah merupakan
fenomena yang baru yang menyerupai penobatan putra mahkota, tetapi harus
dicatat bahwa proses peralihan kepemimpinan tersebut tetap dalam bentuk
musyawarah yang tidak memakai sistem otoriter. Sebab Abu Bakar tetap meminta
pendapat dan persetujuan dari kalangan sahabat Muhajirin dan Anshar.
D. Perkembangan Islam Sebagai Kekuatan Politik
Setelah Abu Bakar menyelesaikan tugas kekhalifaannya dan menyusul kepergian
Rasulullah SAW. Kehadirat Allah SWT. Umar meneruskan langkah-langkahnya untuk
membangun kedaulatan Islam sampai berdiri tegak. Kemampuannya dalam melaksanakan
pembangunan ditandai dengan keberhasilannya diberbagai bidang. Pemerintahan dibawah
kepemimpinan Umar dilandasi prinsip-prinsip musyawarah. Untuk melaksanakan prinsip
musyawarah itu dalam pemerintahannya, Umar senantiasa mengumpulkan para sahabat
yang terpandang dan utama dalam memutuskan sesuatu bagi kepentingan masyarakat.
Karena pemikiran dan pendapat mereka sangat menentukan bagi perkembangan
kehidupan kenegaraan dan pemerintahan. Umar menempatkan mereka dalam kedudukan
yang lebih tinggi dari semua pejabat negara lainnya. Hal ini tidak lain karena dilandasi
rasa tanggung jawab kepada Allah SWT.
Di zaman Umar gelombang ekspansi secara besar-besaran pertama terjadi, ibukota
Syiria, Damaskus ditaklukkan dan setahun kemudian (636 M), setelah tentara Bizantium
kalah di pertempuran Yarmuk, seluruh daerah Syiriah jatuh ke bawah kekuasaan Islam.
Dengan memakai Syiria sebagai basis, ekspansi diteruskan ke Mesir di bawah pimpinan
Amr bin Ash dan ke Irak di bawah pimpinan Sa’ad bin Abi Waqash. Iskandaria
ditaklukkan pada tahun 641 M. Dengan demikian, Mesir jatuh di bawah kekuasaan Islam.
Al-Qadisiyah, sebuah ibukota dekat Hirah di Irak, ditaklukkan pada tahun 637 M, dari
sana serangan dilanjutkan ke ibukota Persia, al-Madain ditaklukkan pada tahun itu juga.
Pada tahun 641 M, Musol dapat dikuasai. Pada masa kepemimpinan Umar bin Khattab ra,
wilayah kekuasaan Islam sudah meliputi jazirah Arabiah, Palestina, Syiriah, sebagian
besar wilayah Persia dan Mesir.
Umar mengajak dunia memeluk Islam dengan ajakan yang baik dan penuh hikmah.
Setelah pasukan muslim menaklukkan Persia, Umar berwasiat kepada Sa’ad ibn Abi
Waqash, ”kuperintahkan engkau untuk mengajak mereka memeluk Islam; ajakla mereka
dengan cara yang baik, sebelum memulai pertempuran. Umar juga berwasiat kepada para
pemimpin pasukan agar tidak memaksa penduduk setempat untuk mengganti agama
mereka dengan Islam. Umar justru berwasiat agar umat Islam dapat memuliakan mereka
dan tidak mengganggu praktik-praktik ibadah mereka.
Seiring dengan berkembang dan meluasnya wilayah kekuasaan Islam pada masa
Khalifah Umar bin Khattab mengharuskan ia mengatur adminstrasi pemerintahannya
dengan cermat. Dalam sejarah umat Islam, Umar bin Khattab dipandang sebagai Khalifah
yang cukup berhasil mengembangkan dan mewujudkan tata pemerintahan dan sistem
adminstrasi kenegaraan yang baik. Baik dalam kehidupan sosial kemasyarakatan, politik,
hukum maupun ekonomi.
Adapun sistem yang beliau terapkan dalam keihidupan sosial kemasyarakatan ialah
menerapakan perlunya menghargai hak-hak individu dalam kehidupan masyarakat. Hal itu
tampak pada masyarakat yang ditaklukkannya. Beliau memberikan kelonggaran dalam
menjalankan ibadah menurut ajaran agamanya masing-masing. Dalam bidang
pemerintahan, kemasyarakatan dan kenegaraan, Umar menyelesaikan tiap permasalahan
yang dihadapi tidak cukup dengan pengamatan fisik semata-mata. Semua diselesaikan
dengan peelitian yang cermat, teliti dan seksama. Kebijakan ini diberlakukan ke seluruh
wilayah yang menjadi tanggung jawab kekhalifaannya.
Lebih jauh lagi, Umar berhasil menghapuskan sistem feodal Roma yang diterapkan di
Suria, dan kemudian membagi-bagikan tanah di situ kepada penggarap yang asli, yang
memang penduduk Suriah. Wilayah kekuasaan yang sangat luas itu mendorong Umar
untuk segera mengatur administrasi negara. Administrasi pemerintahan diatur menjadi
delapan wilayah propinsi, yaitu: Mekah, Madinah, Syiriah, Jazirah, Basrah, Kufah,
Palestina dan Mesir, dan yang menjadi pusat pemerintahannya adalah Madinah. Sehingga
dapat dikatakan bahwa Umar bin Khatab telah menciptakan sistem desentralisasi dalam
pemerintahan Islam.
Sejak pemerintahan Umar, telah dilengkapi adminstrasi pemerintahan dengan
beberapa jawatan yang diperlukan sesuai dengan perkembangan negara pada waktu itu.
Jawatan-jawatan penting itu antara lain adalah; Dewan al-Kharaj (jawatan pajak) yang
mengelolah adminstrasi pajak tanah di daerah-daerah yang telah ditaklukkan. Dewan al-
Hadts (jawatan kepolisian) yang berfungsi untuk memelihara ketertiban dan menindak
pelanggar-pelanggar hukum yang nantinya akan diadili oleh qadhi. Beliau juga telah
merintis jawatan pekerjaan umum (Nazarat al-Nafiah), Jawatan ini bertangung jawab atas
pembangunan dan pemeliharaan gedung-gedung pemerintah, saluran-saluran irigasi, jalan-
jalan, rumah-rumah sakit dan sebagainya.
Pada masa pemerintahan Khalifah Umar juga telah didirikan pengadilan, untuk
memisahkan antara kekuasaan eksekutif dan yudikatif yang pada pemerintahan Abu
Bakar, khalifah dan para pejabat adminstratif merangkap jabatan sebagai qadhi atau
hakim. Awalnya konsep rangkap jabatan trersebut juga diadopsi pemerintahan Umar.
Tetapi, seiring dengan perkembangan keukasaan kaum muslimin, dibutuhkan mekanisme
administraif yang mendukung terselenggaranya sistem pemerintahan yang baik.
Setidaknya ada 3 faktor penting yang ikut andil mempengaruhi kebijakan-kebijakan umar
dalam bidang hukum yaitu militer, ekonomi dan demografis (multi suku)
1. faktor militer
Penaklukan besar-besaran pada masa pemerintahan Umar adalah fakta yang tak dapat
difungkiri. Beliau menaklukan Irak, Syiria, Mesir, Armenia dan daerah-daerah yang ada
di bawah kekuasaan Romawi dan Persia. Untuk mewujudkan dan menyiapkan pasukan
profesional, Umar menciptakan suatu sistem militer yang tidak pernah dikenal
sebelumnya yaitu seluruh personil militer harus terdaptar dalam buku catatan negara dan
mendapat tunjangan sesuai dengan pangkatnya. Pembentukan militer secara resmi
menuntut untuk melakukan mekanimisme baru yang sesuai dengan aturan-aturan militer.
2. faktor ekonomi
Dengan semakin luasnya daerah kekuasaan Islam, tentu membawa dampak pada
pendapatan negara. Sumber-sumber ekonomi mengalir ke dalam kas negara, mulai dari
kharaj (pajak tanah), jizyah (pajak perlindungan), ghanimah (harta rampasan perang),
Fai’ (harta peninggalan jahiliyah), tak ketinggalan pula zakat dan harta warisan yang tak
terbagi. Penerimaan negara yang semakin bertumpuk, mendorong Umar untuk merevisi
kebijakan khalifah sebelumnya (Abu Bakar). Umar menetapkan tunjangan yang berbeda
dan bertingkat kepada para rakyat sesuai dengan kedudukan sosial dan kontribusinya
terhadap Islam. Padahal sebelumnya, tunjangan diberikan dalam porsi yang sama.
3. faktor demografis
Faktor ini juga sangat berpengaruh pada kebijakan-kebijakan yang diambil oleh
Umar. Jumlah warga Islam non-Arab semakin besar setelah terjadi penaklukan sehingga
kelompok sosial dalam komunitas Islam semakin beragam dan kompleks sehingga terjadi
asimilasi antara kelompok. Terlebih lagi setelah kota Kufah dijadikan sebagai kota
pertemuan antarsuku baik dari utara maupun selatan. Perbauran inilah yang membawa
pada perkenalan institusi baru.
Dari uraian faktor-faktor yang ikut andil mempengaruhi kebijakan-kebijakan Umar di
atas, dapat dipahami dan disimpulkan bahwa metodologi Umar dalam menetapkan
hukum dipengaruhi oleh dua sikap yaitu beradaptasi dengan kemajuan zaman dengan
kreatif dan berorientasi pada sejarah secara kontekstual.
Beberapa Kasus Penetapan Hukum Umar
1. Kasus Mauallaf
Dalam surah Taubah ayat 60, Allah telah menjelaskan bahwa ada delapan kelompok
yang berhak menerima zakat. Diantaranya adalah muallaf yaitu orang yang masih lemah
imannya, agar mereka tetap memeluk Islam dan orang yang dibujuk hatinya agar
bergabung dengan Islam atau menahan diri untuk tidak mengganggu umat Islam. Namun
pada masa pemerintahan Umar, orang-orang kafir tidak lagi mendapatkan zakat
sebagaimana yang telah dilakukan oleh Rasulullah dan Abu Bakar dengan alasan bahwa
kondisi umat Islam pada masanya telah kuat dan stabilitas pemerintahan sudah mantap.
Menurut Umar, muallaf dari kelompok kafir hanya berhak menerima zakat di kala
Islam masih lemah, akan tetapi jika alasan itu sudah tidak ada (Islam sudah kuat) maka
mereka tidak berhak lagi. Keputusan Umar ini berdasarkan penalaran ijtihad tahqiq al-
manath (memperjelas dan merealisasikan alasan hukum syariat) yang tidak bersentuhan
langsung dengan teks. Keputusan ijtihad Umar tidaklah bertentangan dengan nash al-
Qu’ran dan tidak menggugurkan hukum muallaf dari kelompok penerima zakat,
melainkan hanya merupakan penerapan hukum untuk suatu kondisi dan pada saat tertentu
karena ada maslahah yang perlu dicapai. Sedangkan muallaf dari golongan Islam tetap
mendapatkan zakat.
2. Kasus potong tangan bagi pencuri
Dalam hukum Islam, pencurian yang dilakukan oleh seseorang akan dihukum
dengan hukuman potong tangan.seperti yang tertera pada surat al-maida:38



 
  
    
  
Artinya : Laki-laki yang mencuri dan perempuan yang mencuri, potonglah tangan
keduanya (sebagai) pembalasan bagi apa yang mereka kerjakan dan sebagai siksaan
dari Allah. dan Allah Maha Perkasa lagi Maha Bijaksana.
Namun terkadang sebagian umat Islam tidak memahami model-model pencurian
yang mendapat hukuman potong tangan, bahkan terkadang arogan untuk menvonis
semua pencuri dihukum dengan hukuman potong tangan, sehingga menimbulkan imej
bahwa hukum Islam itu tidak manusiawi. Sebagaimana yang telah diketahui bahwa
Umar pernah tidak memberlakukan hukum potong tangan terhadap pencurian di kala
umat Islam terbelit krisis ekonomi. Umar tidak menentang hukum potong tangan akan
tetapi memperketat kriteria seorang pencuri dijatuhi hukuman yang sangat berat ini.
Oleh karena itu, kasus pencurian perlu difahami dan diteliti secara menyeluruh,
bukan saja menyangkut objek, materi curian akan tetapi juga memahami penyebab
terjadinya kejahatan itu sendiri dan sudah barang tentu pelakunya. Pada akhirnya
hukuman potong tangan tidak semudah yang dipahami oleh sebagian umat Islam saat
ini, sehingga tidaklah layak mengatakan bahwa Islam tidak mengenal HAM. Dan
sangat perlu diingat bahwa menjaga keamanan masyarakat itu lebih penting,
meskipun dengan cara mengorbankan seseorang yang sudah menjadi sampah
masyarakat.
B. KHALIFAH UTSMAN BIN AFFAN ( TAHUN 23 H- 35 H/ 644 M- 656 M )
1. Pengangkatan Khalifah Usman bin Affan
Panitia pemilihan Khalifah, memilih Usman menjadi Khalifah ketiga
menggantikan Umar bin Khattab. Pemerintahan Usman bi Affan ini berlangsung dari
tahun 644 sampai 656 M. ketika Usman dipilih, Usman telah tua ( 70 tahun) dengan
kepribadian yang agak lemah.
Dalam Pidato pelantikan (inaugural speech) dari khalifah terpilih Utsman bin
Affan ra, setelah beliau dibai’at adalah sebagai berikut: “ Amma ba’du,
sesungguhnya, tugas ini telah dipikulkan kepadaku dan aku telah menerimanya, dan
sesungguhnya aku adalah muttabi’ (pengikut sunnah Rasulullah SAW) dan bukannya
seorang mubtadi’ (seorang yang berbuat bid’ah). Ketahuilah bahwa kalian berhak
menuntut aku mengenai selain Kitab Allah dan Sunnah Nabi Nya, yaitu mengikuti
apa yang telah dilakukan oleh orang- orang sebelumku dalam hal- hal yang kamu
sekalian telah bersepakat dan telah kamu jadikan sebagai kebiasaan, membuat
kebiasaan baru yang layak bagi ahli kebajukan dalam hal- hal yang belum kamu
jadikan sebagai kebiasaan, dan mencegah diriku dari bertindak atas kamu kecuali
dalam hal- hal yang kamu sendiri telah menyebabkannya. “
Kelemahan ini dipergunakan oleh orang- orang di sekitarnya untk mengejar
keuntungan pribadi, kemewahan dan kekayaan. Hal ini dimanfaatkan terutama oleh
keluarganya sendiri dari golongan Umayyah. Banyak pangkat- pangkat tinggi dan
jabatan- jabatn penting dikuasai oleh familinya. Pelaksanaan pemerintahan seperti ini,
dalam bahasa orang sekarang disebut nepotisme (kecenderungan untuk
mengutamakan atau menguntungkan sanak saudara (keluarga sendiri ).
2. Sebab-sebab Pemberontakkan
Sebab-sebab terjadinya pemberontakkan yang berakhir dengan terbunuhnya
khalifah Usman dapat teliti dari berbagai segi. Pertama, bahwa ditengah-tengah
mayarakat terdapat sejumlah kelompok yang memeluk islam dengan tidak sepenuh
kesadaran melainkan demi kepentingan-kepentigan tertentu seperti Abdullah Ibn Saba’,
orang yaman yang semula pengikut agama yahudi. Mereka ini menyebarkan hasutan
terhadap Usman. Setelah berpindah dari Bashrah, Kufah lalu ke Syiria, ia berhasil
menyebar isu jahatnya, lalu ia berpindah ke mesir untuk tujuan yang sama. Keberhasilan
propaganda jahat Abdullah Ibn Saba’ membuat jumlah kekuatan pemberontak semakin
bertambah banyak. Mereka sebagian besar terdiri dari bangsa-bangsa lain yang semula
penentang pertempuran. Mereka ini sebenarnya masih menyimpan kebencian dan
permusuhan terhadap islam. Mereka mengambil kesempatan kacau ini dan bergabung
dengan kaum pemberontak.
Kedua, bahwa persaingan dan permusuhan antara keluarga Hasyim dan keluarga
Umayyah turut memperlemah kekuatan Usman dan menjadi sebab utama kegagalan
Usman di akhir masa pemerintahannya
Ketiga, lemahnya karakter kepemimpinan Usman turut juga menyokong
kegagalannya, khususnya dalam menghadapi gejolak pemberontakkan. Bahwa Usman
adalah Pribadi yang sederhana, saleh, dan berhati lemah lembut. Sifat sederhana dan
sikap lemah lembut sangat tidak sesuai dalam urusan politik dan pemerintahan, lebih-
lebih dari kondisi yang kritis. Pada kondisi yang demikian diperlukan ketegasan sikap
untuk menegakkan stabilitas pemerintahan. Sikap seperti ini tidak dimiliki oleh Usman.
Ia adalah figure yang terlalu baik yang tidak mudah menerima laporan-laporan bahwa
pihak-pihak musuh telah menghasutnya dan merusak stabilitas Negara.
3. Peradaban pada masa Khalifah Utsman bin Affan
Di antara jasa- jasa Usman Bin Affan yang lain adalah tindakannya untuk menyalin
dan membuat Al- Quran standar, yang di dalam kepustakaan disebut dengan kodifikasi al
Quran.
Standarisasi Al Quran perlu diadakan, karena pada masa pemerintahannya wilayah
Islam telah sangat luas dan didiami oleh berbagai suku bangsa dengan berbagai bahasa
dan dialek yang tidak sama. Karena itu, di kalangan pemeluk agama Islam terjadi
perbedaan ungkapan dan ucapan tentang ayat- ayat al quran yang disebarkan melalui
hafalan. Perbedaan cara mengucapkan itu menimbulkan perbedaan arti. Berita tentang ini
sampai pada Usman. Ia lalu membentuk Panitia yang kembali dipimpin oleh Zaid bin
Tsabit untuk menyalin naskah Al- Quran yang telah dihimpun di masa Khalifah Abu
Bakar dahulu, disimpan oleh Hafsah, janda Nabi Muhammad SAW. Panitia ini bekerja
dengan satu disiplin tertentu, menyalin naskah Al Quran ke dalam lima Mushaf
(kumpulan lembaran- lembaran yang ditulis, dan Al Quran itu sendiri disebut pula
Mushaf ), untuk dijadikan standar dalam penulisan dan bacaan Quran di wilayah
kekuasaan Islam pada waktu itu. Semua naskah yang dikirim ke ibukota Propinsi (
Makkah, Kairo, Damaskus, Baghdad) itu disimpan dalam masjid. Satu naskah tinggal di
Madinah untuk mengenang jasa Usman, naskah yang disalin di masa pemerintahnnya itu
disebut Mushaf Usmany atau al- Imam karena ia menajadi standar bagi Quran yang lain.
Kemudian disalin dan diberi tanda- tanda bacaan di Mesir seperti yang kita lihat sekarang
ini. Khalifah Utsman bin Affan menjalankankan roda pemerintahannya selama lebih
kurang 12 Tahun.
C. KHALIFAH ALI BIN ABI THALIB ( TAHUN 36 H- 41 H/ 656 M-661 M)
1. Proses Pengangkatan Ali Bin abi Thalib
Menurut penuturan Abu Mihnaf, sebagaimana tercantum dalam Syarh Nahjil
Balaghah, jilid IV, halaman 8, dikatakan, bahwa ketika itu kaum Muhajirin dan
Anshar berkumpul di masjid Rasulullah s.a.w. Di antara tokoh-tokoh muslimin yang
menonjol tampak hadir Ammar bin Yasir, Abul Haitsam bin At Thaihan, Malik bin
'Ijlan dan Abu Ayub bin Yazid. Mereka bulat berpendapat, bahwa hanya Ali bin Abi
Thalib r.a. lah tokoh yang paling mustahak dibai'at. Diantara mereka yang paling
gigih berjuang agar Imam Ali r.a. dibai'at ialah Ammar bin Yasir. Dalam
mengutarakan usulnya, pertama-tama Ammar mengemukakan rasa syukur karena
kaum Muhajirin tidak terlibat dalam pembunuhan Khalifah Utsman r.a. Kepada
kaum Anshar, Ammar menyatakan, jika kaum Anshar hendak mengkesampingkan
kepentingan mereka sendiri, maka yang paling baik ialah membai'at Ali bin Abi
Thalib sebagai Khalifah. Ali bin Abi Thalib, kata Ammar, mempunyai keutamaan dan
ia pun orang yang paling dini memeluk Islam. Kepada kaum Muhajirin, Ammar
mengatakan: kalian sudah mengenal betul siapa Ali bin Abi Thalib. Oleh karena itu
aku tak perlu menguraikan kelebihan-kelebihannya lebih panjang lebar lagi. Kita
tidak melihat ada orang lain yang lebih tepat dan lebih baik untuk diserahi tugas itu!
Usul Ammar secara spontan disambut hangat dan didukung oleh yang hadir. Malahan
kaum Muhajirin mengatakan: "Bagi kami, ia memang satu-satunya orang yang paling
afdhal!" Setelah tercapai kata sepakat, semua yang hadir berdiri serentak, kemudian
berangkat bersama-sama ke rumah Imam Ali r.a.
Di depan rumahnya mereka beramai-ramai minta dan mendesak agar Imam Ali
r.a. keluar. Setelah Imam Ali r.a. keluar, semua orang berteriak agar ia bersedia
mengulurkan tangan sebagai tanda persetujuan dibai'at menjadi Amirul Mukminin.
Pada mulanya Imam Ali r.a. menolak dibai'at sebagai Khalifah. Dengan terus terang
ia menyatakan : "Aku lebih baik menjadi wazir yang membantu daripada menjadi
seorang Amir yang berkuasa. Siapa pun yang kalian bai'at sebagai Khalifah, akan
kuterima dengan rela. Ingatlah, kita akan menghadapi banyak hal yang
menggoncangkan hati dan fikiran." Jawaban Imam Ali r.a. yang seperti itu tak dapat
diterima sebagai alasan oleh banyak kaum muslimin yang waktu itu datang
berkerumun di rumahnya. Mereka tetap mendesak atau setengah memaksa, supaya
Imam Ali r.a. bersedia dibai'at oleh mereka sebagai Khalifah. Dengan mantap mereka
menegaskan pendirian: "Tidak ada orang lain yang dapat menegakkan pemerintahan
dan hukum-hukum Islam selain anda. Kami khawatir terhadap ummat Islam, jika
kekhalifahan jatuh ketangan orang lain…"
Beberapa saat lamanya terjadi saling-tolak dan saling tukar pendapat antara
Imam Ali r.a. dengan mereka. Para sahabat Nabi Muhammad s.a.w. dan para pemuka
kaum Muhajirin dan Anshar mengemukakan alasannya masing-masing tentang apa
sebabnya mereka mempercayakan kepemimpinan tertinggi kepada Imam Ali r.a.
Betapapun kuat dan benarnya alasan yang mereka ajukan Imam Ali r.a. tetap
menyadari, jika ia menerima pembai'atan mereka pasti akan menghadapi berbagai
macam tantangan dan kesulitan gawat. Baru setelah Imam Ali r.a. yakin benar, bahwa
kaum muslimin memang sangat menginginkan pimpinannya, dengan perasaaan berat
ia menyatakan kesediaannya untuk menerima pembai'atan mereka. Satu-satunya
alasan yang mendorong Imam Ali r.a. bersedia dibai'at, ialah demi kejayaan Islam,
keutuhan persatuan dan kepentingan kaum muslimin. Rasa tanggung jawabnya yang
besar atas terpeliharanya nilai-nilai peninggalan Rasul Allah s.a.w., membuatnya siap
menerima tanggung jawab berat di atas pundaknya. Sungguh pun demikian, ia tidak
pernah lengah, bahwa situasi yang ditinggalkan oleh Khalifah Utsman r.a. benar-
benar merupakan tantangan besar yang harus ditanggulangi.
Keputusan Imam Ali r.a. untuk bersedia dibai'at sebagai Amirul Mukminin
disambut dengan perasaan lega dan gembira oleh sebagian besar kaum muslimin.
Kepada mereka Imam Ali r.a. meminta supaya pembai'atan dilakukan di masjid agar
dapat disaksikan oleh umum. Kemudian Imam Ali r.a. juga memperingatkan, jika
sampai ada seorang saja yang menyatakan terus terang tidak menyukai dirinya, maka
ia tidak akan bersedia dibai'at.
2. Peristiwa tahkim Pada Masa Ali Bin Abi Thalib
Konflik politik antara Ali Bin Abi Thalib dengan Muawwiyah Ibn Abi Sufyan
diakhiri dengan Tahkim. Dari pihak Ali Ibn Abi Thalib diutus seorang ulama yang
terkenal sangat jujur dan tidak “ cerdik” dalam politik yaitu Abu Musa Al Asyari.
Sebaliknya dari pihak Muawiyah Ibn Abi Sufyan diutus seorang yang sangat terkenal
sangat “cerdik” dalam berpolitik yaitu Amr ibn Ash.
Dalam tahkim tersebut, pihak Ali Ibn Abi Thalib dirugikan oleh pihak Muawiyah
Ibn Abi Sufyan karena kecerdikan Amr Ibn Ash yang dapat mengalahkan Abu Musa Al
Asyari. Pendukung Ali Ibn Abi Thalib, kemudian terpecah menjadi dua, yaitu kelompok
pertama adalah mereka yang secara terpaksa menghadapi hasil Tahkim dan mereka tetap
setia kepada Ali Ibn Abi Thalib, sedangkan kelompok yang kedua adalah kelompok yang
menolak hasil Tahkim dan kecewa terhadap kepemimpinan Ali Ibn Abi Thalib yang
kemudian melakukan gerakan perlawanan terhadap semua pihak yang terlibat dalam
Tahkim, termasuk Ali Ibn Abi Thalib. Khalifah Ali bin Abi Thalib menjalankankan roda
pemeriintahannya selama lebih kurang 5 Tahun.
3. Sebab-sebab Kegagalan Khalifah Ali
Kegagalan Khalifah Ali yang sekaligus sebagai kemenangan muawiyah tidak
terlepas dari beberapa fakta sebagaimana disampaikan sebagai berikut
Pertama, pada masa awal pemerintahannya, sikap berperang melawan persekutuan
Thalhah, Zubair dan A’isyah secara umum memperlemah kedudukan Ali. Ketika Thalhah
dan Zubai bersedia berunding untuk mengakhiri pertempuran, tiba-tiba pengikut ali
menangkap Thalhah dan Zubair lalu mereka membunuh keduanya. Kematian dua tokoh
ini otomatis meningkatkan kemarahan pengikut mu’awiyah dan semakin bertambah
pengikutnya. Sementara peristiwa ini justru mengurangi kekuatan dukungan atas
perjuangan Ali.
Kedua, bahwa pemberontak yang terjadi khususnya Bashrah, Kufah, mesir, Syiria,
serta pengakuan kemerdekaan atas beberapa wilayah negeri muslim sangat merugikan
dan menyulitkan posisi Ali. Terlepasnya Ali oleh mu’awiyah merupakan pertanda
kehancuran kekuatan Khalifah Ali.
Ketiga, mu’awiyah didukung kesatuan masyarakat syiria yang setian dan
mendambakkan Umayyah sebagai pemimpinny, sementara itu Ali bersandar pada
dukungan masyarakat Kufah yang berjiwa lemah dan tidak memberikan bantuan yang
sepenuhnya kepada Khalifah Ali terutama dalam kondisi dan situasi yang berbahaya.
Keempat, persainagn antara keluarga dan keturunan Hasyimiah dengan keturunan
Umayyah turut mempersulit posisi Ali. Pada sisi lainnya, kondisi permusuhan seperti ini
sangat menguntungkan mu’awiyah yang mereka sedang bangkit. Mereka bersatu
menuntut balas atas kematian Khalifah Usman.

PERADABAN ISLAM MASA DINASTI UMAYYAH


A. Sistem Pemerintahan dan Politik Dinasti Umayyah
Dengan meninggalnya Khalifah Ali bin Abi Thalib, maka bentuk pemerintahan
kekhalifahan telah berakhir dan dilanjutkan dengan bentuk pemerintahan kerajaan (Dinasti)
yakni kerajaan Bani Umayyah (Dinasti Umayyah). Daulah Bani Umayyah didirikan oleh
Muawiyah bin Abu Sufyan. Muawiyah dapat menduduki kursi kekuasaan dengan berbagai
cara, siasat, politik dan tipu muslihat yang licik, bukan atas pilihan kaum muslimin
sebagaimana dilakukan oleh para Khalifah sebelumnya. Dengan demikian, berdirinya
Daulah Bani Umayyah bukan berdasarkan pada musyawarah atau demokrasi. Jabatan raja
menjadi turun-temurun dan Daulah Islam berubah sifatnya menjadi Daulah yang bersifat
kerajaan (monarkhi). Muawiyah tidak mentaati isi perjanjian yang telah dilakukannya
dengan Ali bin Abi Thalib ketika ia naik tahta yang menyebutkan bahwa persoalan
pergantian pemimpin setelah Muawiyah akan diserahkan kepada pemilihan umat Islam.
Namun Muawiyah mewajibkan seluruh rakyatnya untuk menyatakan setia terhadap
anaknya, Yazid. Sejak saat itu suksesi kepemimpinan secara turun-temurun dimulai.
Dinasti Umayyah berkuasa hampir satu abad, tepatnya selama 90 tahun dengan empat
belas pergantian kekhalifahan dimulai oleh kepemimpinan Muawiyah bin Abi Sufyan dan
diakhiri oleh kepemimpinan Marwan bin Muhammad. Banyak kemajuan, perkembangan
dan perluasan daerah yang dicapai, lebih-lebih pada masa pemerintahan Walid bin Abdul
Malik. Adapun urut-urutan Khalifah Daulah Bani Umayyah adalah sebagai berikut:
1. Muawiyah bin Abi Sufyan (661-681 M)
Muawiyah bin Abi Sufyan adalah pendiri Daulah Bani Umayyah dan menjabat sebagai
Khalifah pertama. Ia memindahkan ibu kota dari Madinah al Munawarah ke kota
Damaskus dalam wilayah Suriah. Pada masa pemerintahannya, ia melanjutkan perluasan
wilayah kekuasaan Islam yang terhenti pada masa Khalifah Ustman bin Affan dan Ali bin
Abi Thalib. Disamping itu ia juga mengatur tentara dengan cara baru dengan meniru
aturan yang ditetapkan oleh tentara di Bizantium, membangun administrasi pemerintahan
dan juga menetapkan aturan kiriman pos. Muawiyah meninggal Dunia dalam usia 80
tahun dan dimakamkan di Damaskus di pemakaman Bab Al-Shagier.
2. Yazid bin Muawiyah (681-683 M)
Lahir pada tahun 22 Hijriah tepatnya 643 M. Pada tahun 679 M, Muawiyah
mencalonkan anaknya Yazid untuk menggantikan dirinya. Yazid menjabat sebagai
Khalifah dalam usia 34 tahun pada tahun 681 M. Ketika Yazid naik tahta, sejumlah tokoh
di Madinah tidak mau menyatakan setia kepadanya. Ia kemudian mengirim surat kepada
Gubernur Madinah, memintanya untuk memaksa penduduk mengambil sumpah setia
kepadanya. Dengan cara ini, semua orang terpaksa tunduk, kecuali Husein ibn Ali dan
Abdullah ibn Zubair. Bersamaan dengan itu, Syi’ah (pengikut Ali) melakukan konsolidasi
(penggabungan) kekuatan kembali. Perlawanan terhadap Bani Umayyah dimulai oleh
Husein ibn Ali. Pada tahun 680 M, ia pindah dari Mekkah ke Kufah atas permintaan
golongan Syi’ah yang ada di Irak. Umat Islam di daerah ini tidak mengakui Yazid.
Mereka mengangkat Husein sebagai Khalifah. Dalam pertempuran yang tidak seimbang di
Karbela, sebuah daerah di dekat Kufah, tentara Husein kalah dan Husein sendiri mati
terbunuh. Kepalanya dipenggal dan dikirim ke Damaskus, sedang tubuhnya dikubur di
Karbala.
Masa pemerintahan Yazid dikenal dengan empat hal yang sangat hitam sepanjang
sejarah Islam, yaitu :
a. Pembunuhan Husein ibn Abi Thalib, cucu Nabi Muhammad SAW.
b. Pelaksanaan Al ibahat terhadap kota suci Madinah al – Munawarah.
c. Penggempuran terhadap baiat Allah.
d. Pertama kalinya memakai dan menggunakan orang-orang kebiri untuk barisan pelayan
rumah tangga khalifah didalam istana. Ia Meninggal pada tahun 64 H/683 M dalam
usia 38 tahun dan masa pemerintahannya ialah tiga tahun dan enam bulan.
3. Muawiyah bin Yazid (683-684 M)
Muawiyah bin Yazid menjabat sebagai Khalifah pada tahun 683-684 M dalam
usia 23 tahun. Dia seorang yang berwatak lembut. Dalam pemerintahannya, terjadi masa
krisis dan ketidakpastian yaitu timbulnya perselisihan antar suku diantara orang-orang
Arab sendiri. Ia memerintah hanya selama enam bulan.
4. Marwan bin Al-Hakam (684-685 M)
Sebelum menjabat sebagai penasihat Khalifah Ustman bin Affan, ia berhasil
memperoleh dukungan dari sebagian orang Syiria dengan cara menyuap dan
memberikan berbagai hak kepada masing-masing kepala suku. Untuk mengukuhkan
jabatan Khalifah yang dipegangnya maka Marwan sengaja mengawini janda Khalifah
Yazid, Ummu Khalid.
Selama masa pemerintahannya tidak meninggalkan jejak yang penting bagi
perkembangan sejarah Islam. Ia wafat dalam usia 63 tahun dan masa pemerintahannya
selama 9 bulan 18 hari.
5. Abdul Malik bin Marwan (685-705 M)
Abdul Malik bin Marwan dilantik sebagai Khalifah setelah kematian ayahnya,
pada tahun 685 M. Dibawah kekuasaan Abdul Malik, kerajaan Umayyah mencapai
kekuasaan dan kemulian. Ia terpandang sebagai Khalifah yang perkasa dan negarawan
yang cakap dan berhasil memulihkan kembali kesatuan Dunia Islam dari para
pemberontak, sehingga pada masa pemerintahan selanjutnya, di bawah pemerintahan
Walid bin Abdul Malik Daulah bani Umayyah dapat mencapai puncak kejayaannya. Ia
wafat pada tahun 705 M dalam usia yang ke-60 tahun. Ia meninggalkan karya-karya
terbesar didalam sejarah Islam. Masa pemerintahannya berlangsung selama 21 tahun 8
bulan. Dalam masa pemerintahannya, ia menghadapi sengketa dengan Abdullah bin
Zubair.
6. Walid bin Abdul Malik (705-715 M)
Masa pemerintahan Walid bin Abdul Malik adalah masa ketentraman,
kemakmuran dan ketertiban. Umat Islam merasa hidup bahagia. Pada masa
pemerintahannya tercatat suatu peristiwa besar yaitu perluasan wilayah kekuasaan dari
Afrika Utara menuju wilayah Barat Daya, Benua Eropa yaitu pada tahun 711 M.
Perluasan wilayah kekuasaan Islam juga sampai ke Andalusia (Spanyol) dibawah
pimpinan panglima Thariq bin Ziyad. Perjuangan panglima Thariq bin Ziyad mencapai
kemenangan, sehingga dapat menguasai kota Kordova, Granada dan Toledo.
Selain melakukan perluasan wilayah kekuasaan Islam, Walid juga melakukan
pembangunan besar-besaran selama masa pemerintahannya untuk kemakmuran
rakyatnya. Khalifah Walid ibn Abdul Malik meninggalkan nama yang sangat harum
dalam sejarah Daulah Bani Umayyah dan merupakan puncak kebesaran daulah tersebut.
7. Sulaiman bin Abdul Malik (715-717 M)
Sulaiman bin Abdul Malik menjadi Khalifah pada usia 42 tahun. Masa
pemerintahannya berlangsung selama 2 tahun 8 bulan. Ia tidak memiliki kepribadian
yang kuat hingga mudah dipengaruhi penasehat-penasehat disekitar dirinya. Menjelang
saat terakhir pemerintahannya barulah ia memanggil Gubernur wilayah Hijaz, yaitu Umar
bin Abdul Aziz, yang kemudian diangkat menjadi penasehatnya dengan memegang
jabatan wazir besar.
Hasratnya untuk memperoleh nama baik dengan penaklukan ibu kota
Constantinople gagal. Satu-satunya jasa yang dapat dikenangnya dari masa
pemerintahannya ialah menyelesaikan dan menyiapkan pembangunan Jamiul Umawi
yang terkenal megah dan agung di Damaskus.
8. Umar bin Abdul Aziz (717-720 M)
Umar bin Abdul Aziz menjabat sebagai Khalifah pada usia 37 tahun. Ia terkenal
adil dan sederhana. Ia ingin mengembalikan corak pemerintahan seperti pada zaman
khulafaur rasyidin. Pemerintahan Umar bin Abdul Aziz meninggalkan semua
kemegahan dunia yang selalu ditunjukkan oleh orang kepada Bani Umayyah.
Ketika dinobatkan sebagai Khalifah, ia menyatakan bahwa memperbaiki dan
meningkatkan negeri yang berada dalam wilayah Islam lebih baik daripada menambah
perluasannya. Ini berarti bahwa prioritas utama adalah pembangunan dalam negeri.
Meskipun masa pemerintahannya sangat singkat, ia berhasil menjalin hubuingan baik
dengan Syi’ah. Ia juga memberi kebebasan kepada penganut agama lain untuk beribadah
sesuai dengan keyakinan dan kepercayaannya. Pajak diperingan. Kedudukan mawali
(orang Islam yang bukan dari Arab) disejajarkan dengan Muslim Arab. Pemerintahannya
membuka suatu pertanda yang membahagiakan bagi rakyat. Ketakwaan dan
keshalehannya patut menjadi teladan. Ia selalu berusaha meningkatkan kesejahteraan
rakyatnya. Ia meninggal pada tahun 720 M dalam usia 39 tahun, dimakamkan di Deir
Simon.
9. Yazid bin Abdul Malik (720-724 M)
Yazid bin Abdul Malik adalah seorang penguasa yang sangat gandrung kepada
kemewahan dan kurang memperhatikan kehidupan rakyat. Masyarakat yang sebelumnya
hidup dalam ketentraman dan kedamaian pada zamannya berubah menjadi kacau.
Dengan latar belakang dan kepentingan etnis politis, masyarakat menyatakan
konfrontasi terhadap pemerintahan Yazid bin Abdul Malik. Pemerintahan Yazid yang
singkat itu hanya mempercepat proses kehancuran Imperium Umayyah. Pada waktu
pemerintahan inilah propaganda bagi keturunan Bani Abbas mulai dilancarkan secara
aktif. Dia wafat pada usia 40 tahun. Masa pemerintahannya berlangsung selama 4 tahun
1 bulan.
9. Hisyam bin Abdul Malik (724-743 M)
Hisyam bin Abdul Malik menjabat sebagai Khalifah pada usia yang ke 35 tahun.
Ia terkenal negarawan yang cakap dan ahli strategi militer. Pada masa pemerintahannya
muncul satu kekuatan baru yang menjadi tantangan berat bagi pemerintahan Bani
Umayyah. Kekuatan ini berasal dari kalangan Bani Hasyim yang didukung oleh
golongan mawali dan merupakan ancaman yang sangat serius. Dalam perkembangan
selanjutnya, kekuatan baru ini mampu menggulingkan Dinasti Umayyah dan
menggantikannya dengan dinasti baru yaitu Bani Abbas. Pemerintahan Hisyam yang
lunak dan jujur menyumbangkan jasa yang banyak untuk pemulihan keamanan dan
kemakmuran, tetapi semua kebijakannya tidak bisa membayar kesalahan-kesalahan para
pendahulunya, karena gerakan oposisi terlalu kuat sehingga Khalifah tidak mampu
mematahkannya.
Meskipun demikian, pada masa pemerintahan Khalifah Hisyam kebudayaan dan
kesusastraan Arab serta lalu lintas dagang mengalami kemajuan. Dua tahun sesudah
penaklukan pulau Sisily pada tahun 743 M, ia wafat dalam usia 55 tahun. Masa
pemerintahannya berlangsung selama 19 tahun 9 bulan. Sepeninggal Hisyam, Khalifah-
Khalifah yang tampil bukan hanya lemah tetapi juga bermoral buruk. Hal ini makin
mempercepat runtuhnya Daulah Bani Ummayyah.
10. Walid bin Yazid (743-744 M)
Daulah Umayyah mengalami kemunduran dimasa pemerintahan Walid bin
Yazid. Ia berkelakuan buruk dan suka melanggar norma agama. Kalangan keluarga
sendiri benci padanya. Dan ia mati terbunuh.
Meskipun demikian, kebijakan yang paling utama yang dilakukan oleh Walid
bin Yazid ialah melipatkan jumlah bantuan sosial bagi pemeliharaan orang-orang buta
dan orang-orang lanjut usia yang tidak mempunyai famili untuk merawatnya. Ia
menetapkan anggaran khusus untuk pembiayaan tersebut dan menyediakan perawat
untuk masing-masing orang. Dia sempat meloloskan diri dari penangkapan besar-
besaran di Damaskus yang dilakukan oleh keponakannya. Masa pemerintahannya
berlangsung selama 1 tahun 2 bulan. Dia wafat dalam usia 40 tahun.
12. Yazid bin Walid (Yazid III) (744 M)
Pemerintahan Yazid bin Walid tidak mendapat dukungan dari rakyat, karena
perbuatannya yang suka mengurangi anggaran belanja negara. Masa pemerintahannya
penuh dengan kemelut dan pemberontakan. Masa pemerintahannya berlangsung
selama16 bulan. Dia wafat dalam usia 46 tahun.
13. Ibrahim bin Malik (744 M)
Diangkatnya Ibrahim bin Malik menjadi Khalifah tidak memperoleh suara bulat
didalam lingkungan keluarga Bani Umayyah dan rakyatnya. Karena itu, keadaan negara
semakin kacau dengan munculnya beberapa pemberontak. Ia menggerakkan pasukan
besar berkekuatan 80.000 orang dari Armenia menuju Syiria. Ia dengan suka rela
mengundurkan dirinya dari jabatan khalifah dan mengangkat baiat terhadap Marwan ibn
Muhammad. Dia memerintah selama 3 bulan dan wafat pada tahun 132 H.
14. Marwan bin Muhammad (745-750 M)
Beliau seorang ahli negara yang bijaksana dan seorang pahlawan. Beberapa
pemberontak dapat ditumpas, tetapi dia tidak mampu mengahadapi gerakan Bani
Abbasiyah yang telah kuat pendukungnya. Marwan bin Muhammad melarikan diri ke
Hurah terus ke Damaskus. Namun Abdullah bin Ali yang ditugaskan membunuh Marwan
oleh Abbas As-Syaffah selalu mengejarnya. Akhirnya sampailah Marwan di Mesir. Di
Bushair, daerah Al Fayyun Mesir, dia mati terbunuh oleh Shalih bin Ali, orang yang
menerima penyerahan tugas dari Abdullah. Marwan terbunuh pada tanggal 27 Dzulhijjah
132 H/5 Agustus 750 M. Dengan demikian tamatlah kedaulatan Bani Umayyah dan
sebagai tindak lanjutnya dipegang oleh Bani Abbasiyah.
C. Kemajuan Yang Dicapai Dinasti Umayyah
Pada masa Bani Umayyah beberapa kemajuan di bebagai sektor berhasil dicapai.
antara lain dibidang arsitektur, perdagangan, organisasi militer dan seni.
1. Arsitektur
Pada masa Bani Umayyah bidang arsitektur maju pesat. Terlihat dari
bangunan-bangunan artistik serta masjid-masjid yang memenuhi kota. Kota lama pun
dibangun menjadi kota modern. Mereka memadukan gaya Persia dengan nuansa Islam
yang kental di setiap bangunannya.
Adapun pada masa Walid bin Yazid dibangun sebuah masjid agung yang
terkenal dengan sebutan Masjid Damaskus yang diarsiteki oleh Abu Ubaidah bin Jarrah.
Sedangkan kota baru yang dibangun di zaman ini adalah Kota Kairawan. Didirikan oleh
Uqbah bin Nafi ketika dia menjabat sebagai gubernur.
2. Organisasi militer
Di zaman ini militer dikelompokkan menjadi 3 angkatan. Yaitu angkatan darat
(al-jund), angkatan laut (al-bahiriyah) dan angkatan kepolisian.
3. Perdagangan
Setelah Bani Umayah berhasil menaklukkan bebagai wilayah, jalur
perdagangan jadi semakin lancar. Ibu kota Basrah di teluk Persia pun menjadi pelabuhan
dagang yang ramai dan makmur, begitu pula kota Aden.
4. Kerajinan
Ketika khalifah Abdul Malik menjabat, mulailah dirintis pembuatan tiras
(semacam bordiran), yakni cap resmi yang dicetak pada pakaian khalifah dan para
pembesar pemerintahan.
D. Keruntuhan Bani Ummayah
Runtuhnya Bani umayyah bisa dilihat dari berbagai faktor, yaitu:
a. Faktor Internal
1. Sistem pergantian khalifah melalui garis keturunan adalah sesuatu yang baru (bid’ah)
bagi tradisi Islam yang lebih menekankan aspek senioritas. Pengaturannya tidak jelas.
Ketidakjelasan sistem pergantian khalifah ini menyebabkan terjadinya persaingan
yang tidak sehat di kalangan anggota keluarga istana.
2. Latar belakang terbentuknya dinasti Bani Umayyah tidak bisa dipisahkan dari konflik-
konflik politik yang terjadi di masa Ali bin Abi Thalib. Sisa-sisa Syi'ah (para pengikut
Abdullah bin Saba’ al-Yahudi) dan Khawarij terus menjadi gerakan oposisi, baik
secara terbuka seperti di masa awal dan akhir maupun secara tersembunyi seperti di
masa pertengahan kekuasaan Bani Umayyah. Penumpasan terhadap gerakan-gerakan
ini banyak menyedot kekuatan pemerintah.
3. Pada masa kekuasaan Bani Umayyah, pertentangan etnis antara suku Arabia Utara
(Bani Qays) dan Arabia Selatan (Bani Kalb) yang sudah ada sejak zaman sebelum
Islam, makin meruncing. Perselisihan ini mengakibatkan para penguasa Bani
Umayyah mendapat kesulitan untuk menggalang persatuan dan kesatuan. Disamping
itu, sebagian besar golongan mawali (non Arab), terutama di Irak dan wilayah bagian
timur lainnya merasa tidak puas karena status mawali itu menggambarkan suatu
kelompok yang minoritas, ditambah dengan keangkuhan bangsa Arab yang
diperlihatkan pada masa Bani Umayyah.
4. Lemahnya pemerintahan daulah Bani Umayyah juga disebabkan oleh sikap hidup
mewah di lingkungan istana sehingga anak-anak khalifah tidak sanggup memikul
beban berat kenegaraan tatkala mereka mewarisi kekuasaan. Disamping itu, para
Ulama banyak yang kecewa karena perhatian penguasa terhadap perkembangan
agama sangat kurang.
b. Faktor Eksternal
Penyebab langsung tergulingnya kekuasaan dinasti Bani Umayyah adalah
munculnya kekuatan baru yang dipelopori oleh keturunan al-Abbas bin Abd al-Muthalib.
Gerakan ini mendapat dukungan penuh dari Bani Hasyim dan kaum mawali yang merasa
dikelas duakan oleh pemerintahan Bani Umayyah.

PERADABAN ISLAM MASA DINASTI UMAYYAH


A. Perkembangan agama pada masa Bani Umayyah.
Selama pemerintahan Dinasti ini, terdapat peluang untuk berkembangnya berbagai aliran
yang tumbuh di kalangan masyarakat meskipun aliran itu tidak dikehendaki oleh penguasa
waktu itu. Aliran-aliran tersebut diantaranya adalah Syiah, Khawarij, Mu’tazilah dan yang
lainnya.
Dalam menentukan kebijakan-kebijakan negara Umar selalu merujuk kepada sumber-
sumber hukum berikut ini:
a. Al-Qur’an dan as-Sunnah
b. Peninggalan hukum (jurisprudensi) Abu Bakar dan Umar bin Khatab
c. Ijma’ ulama’.

1. Ahlul Hadits
Dalam masyarakat Islam pada masa itu terdapat kelompok ulama yang metode
pemahamannya terhadap ajaran wahyu sangat terikat oleh informasi dariRasulullah.
Dengan kata lain, ajaran Islam hanya diperoleh dari Al Qur‟an dan petunjuk hadits
Rasulullah saja. Maka dari itu mereka disebut sebagai ahlul hadits.Mulanya kelompok ini
timbul di Hijaz, utamanya di Madinah karenapenduduk Hijaz lebih banyak mengetahui
hadits dan tradisi Rasulullah dibandingpenduduk di luar Hijaz. Hijaz adalah daerah yang
perkembangan budayanya dalampantauan Rasulullah hingga beliau wafat. Di Madinah
sebagai ibukota Islam,beredar hadits Rasulullah yang lebih lengkap dibanding daerah lain
di manapun.Masa pemerintahan Umar bin Abdul Aziz dikenal sebagai masa
permulaanpembukuan hadits. Kekhawatiran khalifah akan semakin tidak terurusnya
hadits-hadits Nabi menggerakkan hatinya untuk memerintahkan ulama hadits khususnya.
Masa pemerintahan Umar bin Abdul Aziz dikenal sebagai masa permulaan
pembukuan hadits. Kekhawatiran khalifah akan semakin tidak terurusnya hadits-hadits
Nabi menggerakkan hatinya untuk memerintahkan ulama hadits khususnyai Hijaz agar
membukukan hadits. Diantara ulama yang masuk kedalam kategori aliran ini adalah:
Sa‟id bin Al Musayyab, Ahmad bin Hanbal. Umar bin Abdul Aziz, ketika ia diangkat
sebagai khalifah, progam utama pemerintahannya terfokus pada usaha pengumpulan
hadist untuk dibukukan Abu Bakar Muhammad bin Muslim bin Ubaidillah bin Syihab
Az-zuhri seorang yang tepat dan siap melaksanakan perintah kholifah, maka ia bekerja
sama dengan perowi-perowi yang dianggap ahli untuk dimintai informasi tentang hadist-
hadist nabi yang berceceran ditengah masyarakat islam untuk dikumpulkan, ditulis dan
dibukukan.
Abu Bakar Muhammad, dianggap pengumpul hadits yang pertama pada masa
pemerintahan Umar bin Abdul Aziz ini.Jejak Abu Bakar Muhammad, diikuti oleh
generasi dibawahnya, seperti Imam Malik menulis kumpulan buku hadist terkenal
Muwatha’, imam Syafii menulis Al-Musnad. Pada tahap selanjutnya, program
pengumpulan hadist mendapat sambutan serius dari tokoh-tokoh islam, seperti:
1. Imam Bukhari, terkenal dengan Shohih Bukhari
2. Imam Muslim, terkenal dengan Shohih Muslim
3. Abu Daud, terkenal dengan Sunan Abu Daud
4. An –Nasa’i, terkenal dengan Sunan An-Nasa’i
5. At-Tirmidzi, terkenal dengan Sunan At-Tirmidzi
6. Ibnu Majah, terkenal dengan Sunan Ibnu Majah
Kumpulan para ahli hadist tersebut diatas, terkenal dengan nama Kutubus Shittah.
2. Ahlur Ra’y
Istilah Ahlur ra‟y digunakan untuk menyebut kelompok pemikir hokum Islam yang
memberi porsi akal lebih banyak dibanding pemikir lainnya. Bila Ahlul Hadits dalam
menjawab persoalan tampak terikat oleh teks maka Ahlur ra’y sebaliknya meskipun tidak
sepenuhnya menggunakan akal sebagai alat untuk mengambil kesimpulan hukum. Mereka
juga menggunakan nash sebagai dasarpenetapan hokum hanya saja mereka dalam melihat
nash lebih cenderung kepadasubstansi masalah daripada textual.Mereka berpendapat
bahwa nash syar’I itu memiliki tujuan tertentu. Dan nash syar‟i secara kumulatif bertujuan
untuk mendatangkan maslahat bagi manusia (Mashalihul Ibad). Karena banyaknya
persoalan yang mereka hadapi dan terbatasnya jumlah nash yang ada maka para Ahlur
Ra‟y berupaya untuk memikirkan rahasia yang terkandung di balik nash. Diantara ulama
yang masuk kedalam kategori aliran ini adalah: AlQamahbin Qois (w. 62 H), Syuraih bin
Al Harits (w. 78 H).
3. Dibidang Ilmu Fiqih
Al –Qur’an sebagai kitab suci yang sempurna, merupakan sumber utama bagi umat
islam, terkhusus dalam menentukan masalah-masalah hukum. Pada masa
Khulafaurrasyidin, penetapan hukum disamping bersumber dari Rasulullah dilakukan
sebuah metode penetapan hukum, yaitu ijtihad. Ijtihad pada awalnya hanya pengertian
yang sederhana, yaitu pertimbangan yang berdasarkan kebijaksanaan yang dilakukan
dengan adil dalam memutuskan sesuatu msalah. Pada tahap perkembangan pemikiran
islam, lahir sebuah ilmu hukum yang disebut Fiqih, yang berarti pedoman hukum dalam
memahami masalah berdasarkan suatu perintah untuk melakukan suatu perbuatan,
perintah tidak melakukan suatu perbuatan dan memilih antara melakukan atau tidak
melakukannya. Pada masa ini bermunculan para tokoh ahli fiqih, antara lain :
1. Sa’id bin Al-Musayyid (Madinah)
2. Salim bin Abdullah bin Umar (Madinah)
3. Rabi’ah bin Abdurahman (Madinah)
4. Az –Zuhri (Madinah)
5. Ibrahim bin Nakha’ai (Kufah)
6. Al –Hasan Basri (Basrah)
7. Thawwus bin Khaissan (Yaman)
8. Atha’ bin Ra’bah (Mekah)
9. Asy –Syu’aibi (Kufah)
10. Makhul (Syam)
Pada zaman dinasti Umayyah ini telah berhasil meletakkan dasar-dasar hukum
islam menurut pertimbnagan kebijaksanaan dalam menetapkan keputusan yang berdasar
Al-Qur’an dan pemahaman nalar/akal. Dalam bidang fikih, Spanyol dikenal sebagai
penganut mazhab Maliki. Yang memperkenalkan mazhab ini disana adalah Ziyad ibn
Abd al-Rahman. Perkembangan selanjutnya ditentukan oleh Ibn Yahya yang menjadi
qadhi pad masa Hisyam ibn Abd al-Rahman. Ahli-ahli fikih lainnya yaitu Abu Bakr ibn
al-Quthiyah, Munzir ibn Sa’id al-Baluthi dan Ibn Hazm yang terkenal.
4. Bidang Ilmu Taswuf
Taswuf merupakan sebuah ilmu tentang cara mendekatkan diri kepada Allah saw,
tujuannya agar hidup semakin mendapatkan makna yang mendalam, serta mendapatkan
ketentraman jiwa. Ilmu tasawuf berusaha agar hidup manusia memilki akhlak mulia,
sempurna dan kamil. Munculnya tasawuf, karena setelah umat semakin jauh dari Nabi,
terkadang hidupnya tak terkendali, utamanya dalam hal kecintaan terhadap materi. Tokoh
dalam hal tasawuf antara lain sebagai berikut :
1. Hasan Al-Basri
Hasan al-Basri mengenalkan kepada umat tentang pentingnya tasawuf, karena
tasawufdapat melatih jiwa/hati memiliki sifat zuhud(hatinya tidak terpengaruh dengan
harta benda, walau lahiriyah kaya), sifat roja’(harta benda, anak-anak, jabatan tidak
bisa menolong hidupnya tanpa adanya harapan ridho dari Allah swt) dan sifat
khouf(sifat takut kepada Allah swt yang dalam dan melekat dalam jiwanya).
2. Sufyan Ats-Tsauri
Beliau lahir dikufah tahun 97 H, mempunyai nama lengkap: Abu Abdullah
Sufyan bin SA’id Ats-Tsauri. Pemikiran bidang taswuf merangkum sebagai berikut:
a. Manusia dapat memiliki sifat zuhud, bila saat ajalnya menghampirinya, karena
kelezatan dunia telah diambil Allah swt, maka manusia baru ingat makna
kehidupannya.
b. Manusia dalam menjalani hidup didunia harus bekerja keras agar hidupnya tercukupi,
dengan kerja manusia dapat terhindar dari kegelapan dan kehinaan.

PERADABAN ISLAM MASA DINASTI ABBASIYAH


KEBANGKITAN DAN KEMAJUAN POLITIK DAN LEMBAGA PEMERINTAHAN
A. Perjalanan Kemajuan Politik Dinasti Abbasiyah
Propaganda Abbasiyah dimulai ketika Umar Ibn Abdul Aziz (717-720) menjadi
khalifah daulah Umayyah.Umar memimpin dengan adil.Ketentraman dan stabilitas
Negara memberi kesempatan kepada gerakan Abbasiyah untuk menyusun dan
merencanakan gerakannya yang berpusat di al-Humaymah.
Pemimpinnya waktu itu adalah Ali Ibn Abdullah Ibn Abbasseorang zahid. Dia
kemudian digantikan oleh anaknya Muhammadyang memperluas gerakan. Dia
menetapakan tiga kota sebagai pusat gerakan, yaitu al-Humaymah sebagai pusat
perencanaan dan organisasi, Kuffah sebagai kota penghubungdan Khurasan sebagai pusat
gerakan praktis. Muhammad wafat pada tahun 125 H/743M dan digantikan oleh anaknya,
Ibrahim al-Imam.
Panglima perangnya dipilih dari Khurasan yang bernama Abu Muslim al-
Khurasani.Abu Muslim berhasil merebut Khurasan dan kemudian menyusul kemenangan
dari kemenangan. Pada awal tahan 132H/749M Ibrahim al-Imama ditangkap bani
Umayah dan dipenjara sampai meninggal. Dia digantikan oleh saudaranya, Abu Abbas.
Tidak lama setelah itu dua bala tentaraAbbasiyah dan Umawiyahbertempur
didekat sungai Zab bagian hulu. Dalam pertempuran itu bani Abbas mendapat
kemenangandan bala tentaranya terus menuju negeri Syam (Syuriah) disini kota demi
kota dapat dikuasai.
Sejak tahun 132H/750M itulah Daulah Abbasiyah dinyatakan berdiri dengan
khalifah pertamanya Abu Abbas al-Saffah.Daulah ini berlangsung sampai tahun 756M.
Masa yang panjang itu dilaluinya dengan pola pemerintahan yang berubah-ubah sesuai
perubahan politik, sosial, budaya, dan penguasa. Berdasarkan pola dan perbedaan politik
itu, para sejarawan biasanya membagi masa yang dilalui Daulah Abbasiyah kedalam lima
periode.
1. Periode Pertama (132-232H/750-847M)
Walaupun Abu Abbas adalah pendiri daulah ini, pemerintahannya hanya
singkat (750-754). Pembina sebenarnya adalah abu Ja'afar al-Mansyur.Dia dengan
keras menghadapi lawan-lawannya dari bani Umayyah, khawarij, dan juga Syi'ah
yang merasa mulai dikucilkan dari kekuasaan.Untuk mengamankan kekuasaannya,
tokoh sezamannya yang mungkin menjadi pesaing baginya satu persatu
disingkirkannya. Abdullah bin Ali dan Muslim bin Ali, keduanya adalah pamannya
sendiri yang telah ditunjuk sebagai gubernur oleh khalifah sebelumnya disyuriah dan
Mesir, karena tidak bersedia membaiatnyaakhirnya terbunuh ditangan Abu Muslim
al-Khurasani, Abu Muslim sendiri dikhawatirkan akan menjadi pesaing baginya
akhirnya dihukum mati oleh Abu Ja’far pada tahun 775.
Untuk lebih memantapkan kekuasaannya dan stabilitas Negara yang baru
berdiri itu, Abu Ja'far memindahkan ibu kota dari al-Hasyimiyahdekat Kuffahkekota
yang baru dibangunnya yaitu kota Baghdadpada tahun 767. Disana ia menertibkan
pemerintahannya dengan mengangkat aparat yang duduk dalam lembaga eksekutif
dan yudikatif. Pada masanya konsep khalifah berubah, dia berkata "innama ana
sultan Allah fi ardhi" (sesungguhnya saya adalah kekuasaan tuhan di bumiNya).
Dengan demikian, jabatan khalifah dalam pandangannya dan berlanjut kegenerasi
sesudahnya merupakan mandat dari Allah swt dan bukan dari manusia, dan bukan
juga sekedar pelanjut Nabi saw sebagaimana pada masa khulafa' ar-Rasyidin. Puncak
popularitas dinasti ini berada pada zaman khalifah Harun ar-Rasyid (786-809) dan
putranya al-Ma'mun.Daulat ini lebih menekankan pembinaan peradaban dan
kebudayaan Islam dari pada perluasan wilayah yang memang sudah luas.
2. Periode Kedua (232-334H/847-45M)
Al-Mu'tasyim khalifah berikutanya memberi peluang besar kepada orang-orang
Turki masuk kedalam pemerintahan.Daulah Abbasyiah mengadakan perubahan
sistem ketentaraan. Prakteknya orang-orang muslim mengikuti perjalanan perang
sudah terhenti. Ketentaraan kemudian menjadi prajurit-prajurit Turki yang
professional.Kekuatan militer dinasti Abbas jadi sangat kuat.Akibatnya, tentara itu
menjadi sangat dominan sehingga khalifah berikutnya sangat dipengaruhi atau jadi
boneka ditangan mereka.
Khalifah al-Wasiq (842-847) mencaba melepaskan diri dari dominasi tentara
Turki tersebut dengan memindahkan ibu kota ke Samarra, tetapi usaha itu tidak
berhasil mengurangi dominasi turki. Akan tetapi khalifah al-Mutawaqil yang menjadi
awal periode ini adalah seorang khalifah yang lemah.
Pada masa itu orang-orang Turki dapat merebut kekuasaan dengan cepat
setelah al-Mutawaqil wafat.Merekalah yang memilih dan mengangkat khalifah sesuai
dengan kehendak mereka, dengan demikian, kekuasaan tidak lagi berada di tangan
khalifah bani Abbas, meskipun mereka berada tetap dalam jabatan khalifah.Dari dua
belas khalifah pada peride ini, hanya empat orang khalifah yang wafat dengan wajar,
selebihnya, kalau bukan dibunuh diberhentikan secara paksa.
3. Periode Ketiga (223-447H/945-1055M)
Pada periode ini, Daulah Abbasiyah dibawah kekuasan Bani
Buawiyah.Keadaan khalifah lebih buruk dari keadaan khalifah sebelumnya, terutama
karena bani Buawiyah adalah penganut aliran Syi'ah.Khalifah tidak lebih sebagai
pegawai yang diperintah dan diberi gaji.Bani Buawiyah membagi wilayah
kekuasaanya kepada tiga saudaranya yaitu Ali untuk wilayah bagian selatan negeri
Persia, Hasan untuk wilayah bagian utara, dan Ahmad untuk wilayah al-Ahwaz,
Wasit, dan Baghdad.Dengan demikian Baghdad pada periode ini tidak lagi
merupakan pusat pemerintahan Islam karena telah pindah ke Syiraz dimana berkuasa
Ali bin Buawiayah yang memiliki kekuasaan bani Buawiyah.
4. Periode keempat (447-590H/1055-1199M)
Periode ini ditandai dengan kekuasaan bani Seljuk atas daulah
Abbasiyah.Kehadiran bani Seljuk ini atas "undangan" khalifah untuk melumpuhkan
bani Buawiyah di Baghdad.Keadaaan khalifah memang membaik, paling tidak
karena kewibawaanya dalam bidang agama kembali setelah beberapa lama dikusai
orang-orang Syi'ah.
5. Periode kelima (590-656/258)
Pada periode ini, khalifah Abasiyah tidak lagi dalam kekuasaan suatu diansti
tertentu.Mereka merdeka dan berkuasa, tetapi hanya di Baghdad dan
sekitarnya.Sempitnya wilayah kekuasan khalifah menunjukan kelemahan politiknya,
pada masa inilah datang tentara mongol dan Tartar mengahancur luluhkan Baghdad
tanpa perlawanan pada tahun 656/1258.
B. Lembaga Pemerintahan Dinasti Abbasiyah
Kepala negara Adalah khalifah, yang setidaknya dalam teori memegang sesuatu
kekuasaan.ia dapatdan telah melimpahkan otoritas sipilnya kepada seoarang wazir,
otoritas pengadilan kepada seorang hakim (Qodhi)dan otoritas militer kepada seorang
jendral (Amir), tetapi khalifah sendiri menjadi pengambil keputusan akhir dalam semua
urusan pemerintahan. Dalam melaksanakan tugas dan fungsi pemerintahannya, para
kahlifah Baghdad yang paling pertama mengikuti pola administrasi Persia.
Khalifah dibantu oleh seorang pejabat rumah tangga istana (Hajib) yang bertugas
memperkenalkan para utusan dan pejabat yang akan mengunjungi khalifah. Disamping
itu ada juga seorang eksekutor, yang menjadi tokoh penting diistana Baghdad.Pada masa
itu ruang bawah tanah yang digunakan sebagai tempat penyiksaan muncul pertama kali
dalam sejarah Arab.Ruang pengamatan bintang terletak berdampingan dengan istana
khalifah.
1) Biro-biro pemerintahan
Disamping pajak, dinasti Abbasiyah juga memiliki kantor pengawas (diwan al-
dziwam) yang pertama kali diperkenalkan oleh al-Mahdidewan korespondensi atau
kantor arsip (diwan al-tauqi) yang menangani semua surat resmi, dokumen politik
serta intruksi dan ketetapan khalifah, dewan penyelidik keluhandengan departeman
kepolisian dan pos.
Dewan penyelidik keluhan (diwan al-nazhar fi al- mazhalim) adalah sejenis
pengadilan tingkat banding, atau pengadilan tinggi untuk menangani kasus-kasus
yang diputuskan secara keliru pada departeman administrtif dan politik.Raja
Normandia, Roger II, (130-1154) memperkenalkan lembaga tersebut ke Sisilia, yang
kemudian mengakar didaratan Eropa.
Departemen kepolisian (diwan al-syurthah) dikepalai oleh seorang pejabat
tinggi yang diangkat sebagai Shibab al syurthah, yang berperan sebagai kepala polisi
dan kepala keamanan istana, dan masa belakangan terkadang merangkap sebagai
seorang wazir. Pada setiap kota besar terdapat kepolisian khusus yang memiliki
pangkat kemiliteran, dan biasanya bergaji tinggi.
Kepala polisi tertinggi disebut Muhtasib, karena ia mengawasi pasar, dan
menjaga tatanan sosial. Ia bertugas mengawasi apakah ukuran dan timbangan dan
ukuran yang digunakan dalam perdagangan telah memenuhi standar, apakah hutang
piutang telah dipenuhi dengan baik, apakah moralitas telah terjaga, dan apakah hal-
hal yang terlarang telah dihindari; seperti berjudi, minum-minuman keras.
Ciri penting dari dinasti Abbasiyah adalah adanya departeman pos yang
dikepalai oleh seorang pejabat yang disebut Shahib al barid, meskipun pada awalnya
dirancang untuk memenuhi kepentingan negara, lenbaga pos juga memberikan
layanan terbatas untuk susrat-surat pribadi.
Masing-masing propinsi ibu kota membentuk kantor pos pada dinasti
Abbasiyah dari berbagai alat untuk menyampaikan surat diantaranya melatih burung
merpati untuk menyampaikan surat kepada tempat tujuan
2) Sistem organisasi militer
Kekhalifahan Arab tidak pernah memiliki pasukan regular dalam jumlah besar,
terorganisisir dengan baik, berdisiplin tinggi, serta mendapat pelatihan dan
pengajaran secara regular.
Pasukan regular pada masa awal Dinasti Abbasiyah terdiri atas pasukan
infantry (harbiyah) yang bersenjatakan tombak, pedang dan perisai, pasukan
panah(ramiyah) dan kavaleri (fursan) yang menggunakan pelindung kepala dan
dadaserta bersenjatakan tombak panjang dan kapak. Dinasti Abbasiyah
mengandalkan pasukan Persia dibanding pasukan Arab, oleh karena itu Arab
kehilangan peran dalam kemiliteran, setiap 10 prajurit dibawah komando seorang
'arif setiap 50 prajurit berada dibawah komando seorang Khalifah, dan setiap 100
prajurit oleh seorang qa'id.
Untuk pasukan 10.000 orang yang terdiri dari 10 batalion dikepalai oleh
seorangamir(jenderal). Pasukan100 orang mebentuk sebuah skuadron membentuk
sebuah unit.
3) Administrasi Wilayah Pemerintah
Propinsi Dinasti Abbasiyah mengalami perubahan dari masa kemasa, dan
klasifikasi politik tidak selalu terkait dengan klasifikasi geografis kita dapat
menjabarkan provisi-provinsi Dinasti Abbasiyah yang merupakan provinsi utama
pada masa awal pemerinatahan Baghdad:
a. Afrika disebelah barat gurun Libya bersama dengan Sisilia
b. Mesir
c. Suriah dan Palestina yang terkadang dipisahkan
d. Hijaz dan Yamamah (Arab tengah)
e. Yaman dan Arab selatan
f. Bahrian dan Oman, dengan Basrah dan Irak sebagai ibu kotanya
g. Sawad, atau Irak (Mesopotamia bawah), dengan kota utamanya setelah Bagdad,
yaitu Kuffah dan Wasit dan seterusya masih banyak lagi Negara yang lainya
Meskipun tidak dikehendaki oleh ibu kota kerajaan, proses desentralisasi
merupakan konsekuensi yang tak terhindarkan dari wilayah yang sedemikian luasnya
itu, selain karena sulitnya sarana komunikasi. Dalam persoalan lokalotoritas
gubernur cendrung sangat dominan dalam jabatannya bisa diwariskan.
Secara teoritis ia memegang jabatan itu selama disenangi oleh wazir, yang
merekomendasikan jabatannya kepada khalifah, dan ia akan diturunkannya jika wazir
itu diganti. Tentang unsur gubernur al-Mawardi membedakan atara dua jenis jabatan
gubernur: Imarah 'ammah (Amir umum), yang memiliki kekuasan tinggi untuk
mengatur masalah militer, mengangkat dan mengawasi hakim pengadilan, memungut
pajak, memelihara ketertiban, menjaga mazhab resmi Negara dari segala
penyimpamgan, menata administrsi kepolisiandan menjadi imam shalat jum'at dan
gubernur memiliki otoritas khususyang tidak memiliki otoritas peradilan dan
perpajakan.
Namunkebanyakan dari klasifikasi tersebut hanya bersifat teoritis, karena
otoritas seorang gubernur mengingat berdasarkan kemampuan pribadinya.Pemasukan
lokal dari tiap-tiap provinsi diaturberdasarkan pemerintah provinsi tersebut. Jika
pengeluaran lebih sedikit dari pada pemasukan lokal, seorang gubernur akan
mengirimkan sisa belanja ke bendahara Negara. Administrasi peradilan berada
ditangan seorang hakim provinsi yang dibantu oleh sejumlah wakil yang ditempatkan
diberbagai subdivisi provinsi.
C. Faktor yang Menyebabkan Kemunduran Dinasti Abbasiyah
Menurut Badri Yatim, M.A, bahwa beberapa faktor yang menyebabkan
kemunduran pada masa daulah Bani Abbasiyah adalah sebagai berikut:
a. Persaingan antara bangsa
Khilafah Abbasiyah didirikan oleh Bani Abbas yang bersekutu dengan orang-orang
Persia. Persekutuan dilatarbelakangi oleh persamaan nasib kedua golongan itu pada
masa Bani Umayyah berkuasa. Keduanya sama-sama tertindas.

b. Kemerosotan Ekonomi
Khilafah Abbasiyah juga mengalami kemunduran di bidang ekonomi bersamaan
dengan kemunduran di bidang politik. Pada periode pertama, pemerintahan Bani
Abbasiyah merupakan pemerintahan yang kaya. Dana yang masuk lebih besar
daripada yang keluar, sehingga baitul mal penuh dengan harta. Setelah khilafah
mengalami kemunduran, pendapatan negara menurun, dan dengan demikian terjadi
kemerosotan dalam bidang ekonomi.
c. Konflik Agama
Fanatisme keagamaan terkait erat dengan persoalan kebangsaan. Pada periode
Abbasiyah, konflik keagamaan yang muncul menjadi isu sentra sehingga
mengakibatkan terjadi perpecahan. Berbagai aliran keagamaan seperti Mu’tazilah,
Syi’ah, Ahlus Sunnah, dan kelompok-kelompok lainnya menjadikan pemerintahan
Abbasiyah mengalami kesulitan untuk mempersatukan berbagai faham keagamaan
yang ada.
d. Perang salib
Perang salib merupakan sebab dari eksternal umat Islam. Perang salib yang
berlangsung beberapa gelombang banyak menelan korban. Konsentrasi dan perhatian
pemerintahan Abbasiyah terpecah belah untuk menghadapi tentara salib sehingga
memunculkan kelemahan-kelemahan.
e. Serangan bangsa Mongol (1258M)
Serangan tentara Mongol ke wilayah kekuasaan Islam menyebabkan kekuatan Islam
menjadi lemah, apalagi serangan Hulagu Khan dengan pasukan Mongol yang biadab
menyebabkan kekuatan Abbasiyah menjadi lemah dan akhirnya menyerah kepada
kekuatan Monggol.

Sejarah Sosial dan Intelektual


A. Sejarah Sosial
Kehidupan sosial pada zaman daulah Abbasiyah adalah sambungan dari zaman
sebelumnya, yaitu zaman daulah Umayyah. Masyarakat yang menjadi warga negara
dinasti Abbasiyah terdiri dari berbagai suku bangsa, bahasa dan agama. Perbedaan ras,
etnis dan agama tidak menjadi penghambat bagi dinati Abbasiyah untuk mengembangkan
sains dan ilmu pengetahuan. Salah seorang sejarawan bernama George Zaydan dalam
bukunya Tamadun al-Islam mengatakan bahwa pada masa dinasti Bani Abbasiyah
masyarakat terbagi menjadi dua kelas sosial, yaitu:
a) Kelas khusus yang terdiri dari:
1) Khalifah
2) Keluarga Khalifah, yaitu Bani Hasyim
3) Para pembesar negara, seperti menteri, gubernur dan para pejabat negara lainnya
4) Para bangsawan yang bukan Bani Hasyim, yaitu kaum Quraisy pada umumnya
5) Para petugas khusus seperti anggota tentara, para pembantu istana
b) Kelas umum yang terdiri dari:
1) Para seniman
2) Para ulama’, fuqaha dan pujangga
3) Para saudagar dan pengusaha
4) Para tukang dan petani
Dengan demikian, maka kelas-kelas sosial yang tumbuh dan berkembang pada
masa itu lebih disebabkan oleh status sosial ekonomi dan latar belakang kultural serta
latar belakang etnis. Hal ini terbukti posisi kelas atas yang masih dimiliki oleh kelompok
masyarakat yang berasal dari masyarakat Arab keturunan Quraiys, termasuk strata sosial
politik dan kekuasaan yang ada saat itu.
Oleh karena itu, sebenarnya bila dilihat dari strata sosial yang ada, tidak terjadi
perkembangan yang sangat berarti dalam konteks perubahan sosial. Sebab nyatanya,
kelompok penguasa dan etnis minoritas yang berasal dari keturunan Arab Quraisy, masih
menempati strata sosial tertinggi dalam sistem sosial kemasyarakatan pada masa
pemerintahan Bani Abbasiyah.
Pada masa pemerintahan dinasti Abbasiyah, warga negara terdiri dari berbagai
suku bangsa dan agama yang tinggal di wilayah pemerintahannya. Unsur-unsur tersebut
antara lain berasal dari Afrika Utara, Mesir, Syam, Jazirah Arabia, Irak, Persia, India,
Turki dan sebagainya.
Warga negara yang berasal dari berbagai suku bangsa tersebut bersatu dalam satu
ikatan yang sama, yaitu Islam dan berada dalam satu wilayah kekuasaan,yaitu
pemerintahan dinasti Abbasiyah. Dari sini kemudian terjalin menjadi satu kerajaan yang
disebut sebagai Mamlakah Islamiyah.
Kelas sosial lain yang ada pada waktu itu adalah kelas budak. Kelas ini selalu ada
dalam setiap lapisan sosial masyarakat Islam saat itu. Banyak hal yang menyebabkan
munculnya kelas sosial ini, seperti adanya peperangan. Mereka yang kalah, harta yang
mereka bawa menjadi harta rampasan perang, juga diri mereka sendiri. Karena itu wajar
kalau kemudian banyak bermunculan kelas-kelas sosial ini.
1. Golongan Taulid
Sebagai akibat dari percampuran bangsa-bangsa dalam daerah-daerah Kerajaan
Islam, terutama kota-kota besarnya, maka terjadi pula perkawinan campuran antara
unsur-unsur bangsa tersebut yang menyebabkan lahir anak-anak percampuran darah,
yang disebut dengan Taulid.
Dalam periode Abbasiyah terjadi banyak perkawinan campuran yaitu antara pria
Arab dengan wanita turuna bukan Arab. Dalam taraf pertama, yang banyak
melakukan hal ini adalah para khalifah, panglima, gubernur, menteri dan pembesar;
kemudian barulah menyusul para saudagar, seniman dan sebagainya.
B. Intelektual
1. Ilmu Pengetahuan
Ilmu pengetahuan sangat berkembang pada masa dinasti abbasiyah.
2) Ilmu Filasafat
Filsafat dikalangan umat Islam mencapai puncaknya pada masa dinasti
abbasiyah, diantaranya dengan penerjemahan fisafat Yunani ke dalam bahasa
Arab, antara lain:
a. Abu Nasr Al-Farabi (961 M). karyanya lebih dari 12 buah buku. Ia
memperoleh gelar Al-Mualimuts Tsani (the second teacher), yaitu guru
kedua sedangkan guru pertama dalam bidang filsafat adalah Aristoteles.
b. Ibnu Sina, terkenal dengan Avicenna (980-1037 M) . Ia seorang filsuf
yang menghidupkan kembali filsafat Yunani aliran Aristoteles dan Plato .
selain filsuf Avicenna juga seorang dokter istana kenamaan. Di antara
bukunya yang terkenal adlah Asy-Syifa, dan Al-Qanun fi Ath-Thib (
Canon of medicine)
c. Dan khalifah Harun al-Rasyid dan al-Makmun adalah diantara khalifah-
khalifah dinasti abbasiyah yang amat tertarik dengan filsafat terutama
filsafat Aristoteles dan plato. Mereka mengadakan hubungan kerjasama
dengan raja-raja Bizantium dalam pengembangan filsafat dan ilmu
pengetahuan. Oleh karena itu tidak mengherankan pada dinasti abbasiyah
muncul beberapa orang filosof Islam dengan berpuluh-puluh dan beratus-
ratus buku karangannya dalam bidang filsafat.
3) Ilmu kedokteran
Pada mulanya ilmu kedokteran telah ada sejak pemerintahan dinasti
abbasiyah. Ini terbukti dengan adanya sekolah Tinggi Kedokteran Yundisapur
dan Harran. Sekolah ini merupakan peninggalan orang Syria. Pada masa
Umayyah ilmu kedokteran belum begitu berkembang. Pada masa abbasiyah
kedua pusat ilmu kedokteran itu semakin mendapat perhatian. Dan mulai
Rumah sakit besar dan sekolah kedokteran banyak didirikan.
Diantara ahli kedokteran ternama adalah:
a. Ibnu Sina (Avicenna), karyanya yang terkenal adalah Al-Qanun fi Ath-
Thib tentang teori dan praktik ilmu kedokteran serta membahas pengaruh
obat-obatan, yang diterjemahkan ke dalam bahasa eropa, canon of
Medicine.
b. Ar-Razi, adalah tokoh pertama yang membedakan antara penyakit cacar
dengan measles, Ar-Razi adalah penulis buku mengenai kedokteran anak.
4) Ilmu Fisika dan Matematika
Dalam bidang ilmu fisika dan matematika ini muncul ilmuwan yang terkenal
sampai sekarang,seperti al-Khawarizmi (780-850 M) al-fargani, al-Biruni dan
lain-lainnya. al-Khawarizmi mengarang buku al-Jabr dan al-aMukabala
merupakan buku pertama tentang ilmu pasti yang sistematis. Dan bukunya
inilah berasal istilah “aljabar” dan “logaritma” dalam matematika. Al-
Khawarizmi penemu angka nol.sedangkan angka latin: 1,2, 3, 4, 5, 6, 7, 8, 9, 0
disebut angka arab karena diambil dari arab. Sebelumnya dikenal angka
romawi I, II, III, IV, V, VI, V dan seterusnya.
5) Farmasi
Diantara ahli farmasi pada masa dinasti abbasiyah adalah ibnu Baithar,
karyanya yang terkenal adalah Al-Mughni (berisi tentang obat-obatan dan
makanan bergizi).
6) Ilmu Astronomi
Kaum muslimin mengkaji dan menganalisis berbagai aliran ilmu astronomi
dari berbagai bangsa seperti bangsa Yunani, India, Persia, Kaldan, dan ilmu
falak Jahiliah. Diantara hli astronomi Islam adalah:
a. Abu Mansur Al-Falaki (w. 272 H). karyanya yang terkenal adalah Isbat
Al-Ulum dan Hayat Al-Falak.
b. Jabir Al-Batani (w.319 H0. Al-Batani adalah pencipta teropong bintang
pertama. Karyanya yang terkenal adalah kitab Ma’rifat Mathiil Buruj
Baina Arbai Al-Falak.
7) Geografi
Dalam bidang geografi umat islam sangat maju, karena sejak semula bangsa
arab merupakan bangsa pedagang yang biasa menempuh jarak jauh untuk
berniaga. Di antara wilayah pengembaraan umat islam adalah umat Islam
mengembara ke cina dan Indonesia pada masa-masa awal kemunculan Islam.
Di antara tokoh ahli geografi yang terkenal adalah:
a. Abul Hasan Al-Mas’udi (w. 345 H/956 M), seorang penjelajah yang
mengadakan perjalanan sampai Persia, India, Srilanka, Cina, dan penulis
buku Muruj Az-Zahab wa Ma’adin Al-Jawahir.
b. Ibnu Khurdazabah (820-913 M) berasal dari Persia yang dianggap sebagai
ahi geografi islam tertua. Di antara karyanya adalah Masalik wa al-
mamalik, tentang data-data penting mengenai sistem pemerintahan dan
peraturan keuangan.
2. Faktor-faktor pendukung Perkembangan Ilmu Pengetahuan
Ilmu pengetahuan itu berkembang disebabkan oleh beberapa faktor pendorong. Di
antara faktor pendorong kemajuan dalam ilmu pengetahuan pada masa pemerintahan
dinasti abbasiyah ialah:
a. Perhatian pemerintah yang besar terhadap kemajuan ilmu pengetahuan.
b. Strategi kebudayaan Rasionalitas (kebebasan berpikir) di kalangan umat Islam.
c. Kemakmuran dan ekonomi yang baik.
d. Stabilitas politik.
e. Motivasi ajaran agama Islam
f. Pandangan yang tepat terhadap ilmu pengetahuan.
Sejarah perkembangan keagamaan, kalam, fiqih dan tasawuf pada masa
dinasti Abbasiyah
pemikiran Islam lahir di antara dua kebudayaan yang mengembangkan dua pola
pemikiran berbeda, yaitu Yunani dan Persia, karena Islam turun dari Hijaz, yang secara geografis
terletak diantara kedua kebudayaan tersebut. Kedua kebudayaan tersebut memberikan corak baru
bagi pemikiran Islam. Pemikiran Islam menghimpun atau menggabungkan dua pola pemikiran
(Yunani dan Persia) menjadi satu kesatuan.
Secara historis, perkembangan pemikiran Islam dapat diklasifikasikan secara detail dan
dijelaskan bahwa segera setelah wafatnya Nabi Muhammad, kebutuhan mendesak yang
dirasakan adalah bagaimana memelihara dan menyebarluaskan naskah al-Qur’an yang
mendapatkan prioritas utama dari Nabi Muhammad sendiri selama hayatnya. Perkembangan
Islam ke negara-negara selain Arab yang memiliki peradaban dan budaya sendiri, menyebabkan
bangsa Arab menghadapi tantangan-tantangan baru dalam kaitannya dengan prinsip-prinsip
ajaran agama mereka terhadap persoalan-persoalan hidup sehari-hari. Hal ini mendorong
perkembangan ilmu fikih (hukum)
A. Pemikiran Islam Pada Masa Periode Klasik (650-1250 M)
Di zaman inilah daerah Islam meluas melalui Afrika Utara sampai ke Spanyol di
Barat dan melalui Persia sampai ke India di Timur. Daerah-daerah itu tunduk kepada
kekuasaan Khalifah yang pada mulanya berkedudukan di Madinah, kemudian di
Damaskus dan terakhir di Baghdad. Periode klasik ini dimulai dengan periode peletakan
pondasi peradaban oleh Nabi Muhammad saw yang kemudian diteruskan oleh khulafaur
rasyidin dan dikembangkan era daulah (dinasti) Bani Umayyah.
Dalam mendeskripsikan sejarah penyebaran Islam periode khilafah awal, maka
analisis weberian dianggap cukup relevan. Max Weber menekankan bahwa faktor ide
atau gagasan atau pemikiran merupakan faktor yang sangat menentukan adanya
perubahan sosial. Dalam konteks ini, ide-ide yang terkandung dalam al-Qur’an
mempengaruhi struktur sosial kemasyarakatan dan membentuk struktur baru. Kehadiran
Nabi Muhammad dengan nilai-nilai baru telah mempengaruhi struktur sosial masa itu
hingga dewasa ini. Bahkan, tatanan dunia secara keseluruhan tidak dapat dilepaskan dari
gagasan-gagasan yang terinspirasi dari al-Qur’an yang dibawa Nabi. Ide-ide atau gagasan
pemikiran itu tentunya baru terlihat memiliki arti sosial jika sudah diwujudkan dalam
berbagai pergumulan dan perubahan budaya.
Dari proses inilah, kemudian peradaban Islam muncul sebagai peradaban baru
dalam kancah dunia internasional. Kehadiran Nabi membawa perubahan dalam tatanan
sosial masyarakat Arab. Ide dan gagasan Nabi yang tersurat dalam al-Qur’an menjadi
inspirasi untuk menuju tatanan kehidupan yang lebih mapan dan beradab. Pengaruh nilai
dan moralitas al-Qur’an yang dibawa Nabi termanifestasi dalam sejarah dan peradaban
Islam. Sejak mendapatkan wahyu langit dalam ‘uzlah (pengasingan) di gua Hira’ tahun
610 M., Muhammad mulai berbicara atas nama Allah swt. dan memproklamirkan Islam
sebagai agama Tauhid untuk kemaslahatan umat manusia dan rahmat bagi alam semesta.
Sejak inilah Nabi mulai membentuk sebuah komunitas masyarakat keagamaan
dalam ikatan semangat tauhid. Muhammad mulai mendapatkan perlawanan dan
tantangan keras dari masyarakat paganisme di Mekkah dan dianggapnya sebagai orang
yang terserang penyakit syaraf, gila dan sebagainya. Muhammad dilahirkan dan
dibesarkan di tengah-tengah suku Quraisy Mekkah, tetapi reformasi teologi, reformasi
kultural, dan reformasi sosial yang dibawanya berdasarkan wahyu Allah, dianggap
memiliki peran penting dalam membangun tatanan sosial-politik dan tradisi kaum
Quraisy.
Komunitas tauhid lebih leluasa untuk mengembangkan pengetahuannya
sebagaimana yang memang ditekankan oleh Nabi dalam berbagai hadisnya. Ekspansi
yang dilakukan oleh pemegang estafet pemerintahan selanjutnya Khulafa’ Al-Rasyidin,
Dinasti Umayyah dan Dinasti Abbasiyah secara garis besar memiliki peranan penting
dalam perkembangan ilmu pengetahuan di dunia Islam. Menurut Ibnu Khaldun,
pertumbuhan dan perkembangan ilmu yang amat terkait erat dengan luasnya wilayah dan
beragamnya budaya maupun ilmu yang ada di daerah-daerah yang dikuasai Islam. Secara
pasti, ekspansi Islam menyebabkan terjadinya kontak antara Islam dengan kebudayaan
Barat, atau tegasnya dengan kebudayaan Yunani Klasik yang terdapat di Mesir, Suria,
Mesopotamia dan Persia.
Pada era klasik ini metode berfikir rasional, ilmiah dan filosofis berkembang
dengan pesat. Sentuhan estetika dan filsafat telah menghantarkan peradaban Islam pada
puncak kejayaan. Ulama’-ulama’ mujtahid bermunculan, begitu juga para ilmuwan
muslim telah menghasilkan karya-karya seni, filsafat dan ilmu pengetahuan secara
mengagumkan. Di masa Bani Abbas inilah perhatian kepada ilmu pengetahuan dan
filsafat Yunani memuncak terutama di zaman Harun Al-Rasyid (785-809 M) dan Al-
Ma’mun (813-833 M). Buku-buku ilmu pengetahuan dan filsafat didatangkan dari
Bizantium dan kemudian diterjemahkan ke dalam bahasa Arab.
Kegiatan penterjemahan buku-buku ini berjalan kira-kira satu abad. Bait Al-
Hikmah, yang didirikan Al-Ma’mun, bukan hanya merupakan pusat penterjemahan tetapi
juga akademi yang mempunyai perpustakaan. Di antara cabang-cabang ilmu pengetahuan
yang diutamakan dalam Bait Al-Hikmah ialah ilmu kedokteran, matematika, optika,
geografi, fisika, astronomi, dan sejarah di samping filsafat. Maka kemudian muncul
beberapa ilmuwan muslim terkenal dan menjadi kebanggaan dunia Islam seperti; Al-
Fazari (Abad VII) sebagai astronom Islam yang pertama kali menyusun Astronomi (alat
yang dahulu dipakai untuk mengukur tinggi bintang-bintang dan sebagainya; Al-Fargani
(di Eropa dikenal dengan sebutan Al-Fragnus) adalah pengarang ringkasan tentang ilmu
astronomi; Dalam bidang optika, Abu Ali Al-Hasan Ibn Al-Haytham (Abad X) terkenal
sebagai orang yang menentang pendapat bahwa mata yang mengirim cahaya kepada
benda yang dilihat.
Dalam bidang Kimia, Jabir ibn Hayyan (w. 813 M) dikenal sebagai bapak Kimia.
Abu Bakar Zakaria Al-Razi (w. 925 M) adalah pengarang buku besar tentang kimia yang
baru dijumpai di abad XX dan juga penemu di bidang ilmu kedokteran dan farmasi. Di
zaman ini pula lahir ulama-ulama besar seperti Imam Malik, Imam Abu Hanifah, Imam
Syafi’i dan Imam Ibn Hambal dalam bidang hukum; Imam Asy’ari, Imam Al-Maturidi,
pemuka-pemuka Mu’tazilah seperti Wasil Ibn ‘Ata’, Abu Al- Huzail, Al-Nazzam, dan
Al-Zuba’i dalam bidang teologi; Dzunnun Al-Mishri, Abu Yazid Al-Bustami dan Al-
Hallaj dalam mistisisme atau tasawwuf; Al- Kindi, Al- Farabi, Ibn Sina dan Ibnu
Miskawih .
Setelah daulah Umayyah runtuh, berdirilah daulah bani Abbasiyah dengan khalifah
pertamanya Abu Abbas yang bergelar As Shaffah (Penumpah Darah). Masa Abbasiyah
merupakan zaman keemasan Islam. Pada zaman ini Islam mengalami masa kejayaan dan
mencapai puncak kemuliaan, baik dari segi kekayaan, kekuasaan dan lebih lebih dalam
bidang ilmu pengetahuan. Ilmu pengetahuan berkembang dengan pesatnya menghasilkan
karya karya tokoh tokoh besar dalam berbagai bidang.
Berikut ini ilmu pengetahuan yang berkembang pada masa Dinasti Abbasiyah:
a. Ilmu Tafsir
Pada masa Dinasti Abbasiyah, perkembangan tafsir sangat pesat. Masa itu diawali
dengan munculnya Mufasirin yang terkenal dari golongan tabiit-tabiin. Antara lain
Safyan bin Uyainah, Wakil Al-Jarrah, Syu'bah Al-Hujjaj, dan Zaid bin Harun. Mereka itu
merupakan perintis bagi Abu Ja'far Muhammad At-Tabari. Kemudian beliau menulis
Kitab Tafsir diberi nama Jami' al-Bayan fi Tafsir Al-Qur'an, yang lebih dikenal dengan
sebutan Tafsir at-Tabari.
Setelah at-Tabari, lahir penafsiran dalam berbagai aliran dan pendapat. Tafsir itu
bercampur dengan pendapat pribadi para Mufasirin. Dalam perkembangan selanjutnya
ada tafsir yang menitikberatkan pembahasan pada masalah tertentu. Tafsir yang demikian
itu disebut tafsir maudu'i, artinya tafsir tematis. Pada masa itu juga ada tafsir dengan
pendekatan ilmu pengetahuan, yang disebut tafsir al-ilmi. Selain tafsir tersebut, masih
banyak ulama tafsir yang lain, diantaranya adalah Fakhrudin ar-Razi, karyanya dalam
tafsir berjudul Mafatih Al-Gai; Az-Makhsyari, karyanya yang terkenal berjudul Al-
Kasyaf Al-Haqaiq At-Tanzil wa Uyun Al-Aqawil (Penyingkap tabir hakikat wahyu dan
mata air hikmah).
b. Ilmu Hadits
Hadits adalah perkataan, perbuatan, ketetapan, dan diamnya Nabi Muhammad Saw.
Hadits berkembang sejak Nabi Muhammad Saw. melalui para sahabat kepada sahabat
yang lain, tabiin dan tabiit-tabiin, hingga kaum muslimin. Upaya pengelompokan hadits
diawali oleh Ishaq bin Rawaih, kemudian dilanjutkan oleh Imam al Bukhari dan Imam
Muslim. Kemudian mereka menulis hadits shahih yang kemudian dikenal dengan Shahih
Al Bukhari, dan Shahih Muslim. Ulama hadits lainnya adalah Abu Dawud, At-Tirmizi,
An-Nasa'i, dan Ibnu Majah. Mereka masing masing menulis kitab sunan. Dua kitab
shahih dan empat kitab sunan itu terkenal dengan sebutan Kutubus-Sittah.
Keenam Ulama Hadits terkenal dengan kitab kitabnya adalah sebagai berikut.
1. Imam Bukhari kitab hadits susunannya berjudul "Shahih Bukhari"
2. Imam Muslim kitab hadits susunannya berjudul "Shahih Muslim"
3. Ibnu Majah kitab hadits susunannya berjudul "Sunan Ibnu Majah"
4. Abu Dawud kitab hadits susunannya berjudul "Sunan Abu Dawud"
5. At-Tirmidzi kitab hadits susunannya berjudul "Sunan At-Tirmidzi"
6. An-Nasa'i kitab hadits susunannya berjudul "Sunan An-Nasa'i"
c. Ilmu Kalam
Ilmu Kalam adalah ilmu yang membahas tentang kepercayaan (aqidah). Ilmu kalam
biasa disebut Ilmu tauhid, Ilmu usuludin, atau Ilmu akaid. Para pelopor ilmu kalam antara
lain Abu Hasan Al-Asy'ari (260-324 H) dan Abu Hamid Al-Ghazali (450-505 H).
d. Ilmu Tasawuf
Ilmu Tasawuf adalah ilmu yang mengajarkan cara cara menyucikan diri,
meningkatkan akhlak, dan membangun kehidupan jasmani serta rohani untuk mencapai
kebahagiaan abadi. Pada masa Dinasti Abbasiyah, Ilmu tasawuf juga berkembang. Tokoh
yang ahli dalam bidang tasawuf antara lain; Al-Haris Ibnu Asad Al-Muhasibi, hasil karya
beliau yang terkenal adalah kitab Ar-Ri'ayat li Huquqilillah, yang menguraikan tentang
hak Allah Swt; Kitab Al-Wasaya, yang menguraikan tentang hidup zuhud, dari kitab At-
Tawahum, yang menguraikan tentang mati di hari kiamat. Ada juga Zannun Al-Misri,
Abu Yazid al-Bistami, Abu Qasim Al-Qusyairi, dan Abu Hamid al-Gazali.
e. Ilmu Fiqih
Ilmu fiqih adalah ilmu yang mempelajari hukum Islam. Pada masa Dinasti
Abbasiyah, Ilmu fiqih juga mengalami perkembangan pesat. Hal itu terjadi karena para
tabiin sudah meletakkan dasar dasar ilmu fiqih. Hal itu ditandai dengan mujadalah
(dialogis) antara ahlur-ra'yi dan ahlul-hadis. Mujadalah itu berada di kala ahlur-Ra'yi
dapat dianggap sebagai salah satu cara dalam menetapkan hukum fiqih melalui batasan
batasan yang dibuat oleh Ahlur-Ra'yi. Pada masa itu juga ditandai dengan munculnya
empat imam mazhab fiqih, yaitu Ima Hanafi, Imam Malik, Imam Syafi'i dan Imam
Hambali.
B. Dampak kemunduran pendidikan islam pasca kejatuhan baghdad dan spanyol.
Runtuhnya Baghdad dan Cordova sebagai pusat pendidikan dan kebudayaan Islam,
menandai runtuhnya sendi-sendi pendidikan dan kebudayaan Islam, terutama dalam
bidang intlektual. Krisis yang disebabkan runtuhnya dua pusat kebudayaan islam
menyebabkan dunia Islam seakan umat islam tenggelam yang memmpengaruhi lemahnya
semua sektor tidak hanya pada sector pendidikan, tetapi juga kehidupan umat islam baik
batin, spritualnya. Kondidisi ini dimanfaatkan oleh bangsa Eropa menjajah negeri-negeri
Islam sekaligus menyebarluaskan ajaran Injil, pada saat itu daya intelektual generasi
penerus tidak mampu untuk mengatasi persoalan-persoalan baru yang dihadapi sebagai
akibat perubahan dan perkembangan zaman.
Sebagian kaum muslim tenggelam dengan tasawuf yang sudah jauh menyimpang dari
roh Islam, Karena mereka merasa lemah diri dan putus asa. Ini yang menyebabkan
mereka lalu mencari pegangan dan sandaran hidup yang bisa mengarahkan kehidupan
mereka. Aliran tradisionalisme mendapat tempat di hati masyarakat secara meluas.
Kehidupan suffi berkembang dengan pesat. Madrasah-madrasah yang ada dan yang
berkembang diwarnai dengan kegiatan-kegiatan suffi. Suffi dimasukkan kedalam
kurikulum formal, kurikulum akademis hampir buku-bukunya tentang suffi, sehingga
ilmu pengetahuan umum semakin sempit. Penyelesaian studipun relatif singkat.Kebekuan
intelektual dalam kehidupan kaum muslimin diwarnai dengan berkembangnya berbagai
macam aliran suffi yang terlalu toleran terhadap ajaran mistis yang bersal dari ajaran
agama lain (Hindu,Budha, maupun neoplatonisme), telah memunculkan berbagai tarekat
yang menyimpang jauh dari ajaran Islam.

PERKEMBANGAN EKONOMI MASA DINASTI ABBASIYAH


I. Perkembangan Ekonomi Masa Dinasti Abbasiyah
Kehidupan pada masa pemerintahan Dinasti Abbasiyah merupakan kelanjutan
dari zaman sebelumnya. Menurut Zaidan, bahwa masyarakat yang ada pada masa
pemerintahan Dinasti Abbasiyah terbagi menjadi dua kelas yaitu: kelas khusus dan
kelas umum. Kehidupan sosial masyarakatnya menunjukkan adanya struktur kelompok
atau kelas yang terdiri dari:
1. Kelas penguasa, yaitu kelompok orang Arab yang memegang kekuasaan.
2. Kelas menengah, yang terdiri dari orang Islam yang bukan (penduduk asli suatu
daerah yang kemudian masuk Islam).
3. Kelompok nonmuslim yang berada di bawah perlindungan pemerintah/kekuasaan
Islam, disebut dengan kaum dzimmi.
4. Kelompok kaum pekerja, yang terdiri dari kaum budak berlian.
Namun, pada masa kejayaan peradaban Islam (Abbasiyah) telah terjadi
pembauran antara kelompok-kelompok tersebut, sehingga dapat membentuk komunitas
masyarakat dan kehidupan sosial budaya yang stabil dengan diiringi oleh mobilitas-
mobilitas sosial yang dinamis. Demikian pula perkembangan sikap-sikap demokrasi di
kalangan masyarakat, menyebabkan secara berangsur-angsur pembebasan para budak
berlian, perkawinan campuran antara berbagai kelompok masyarakat sehingga
timbullah kerja sama yang serasi dengan penuh toleransi dalam menghadapi
permasalahan-permasalahan kehidupan serta dalam upaya memenuhi kebutuhan hidup
bersama.
Kehidupan ekonomi pada hakikatnya adalah usaha untuk memenuhi kebutuhan
hidup masyarakat manusia, terutama yang berhubungan dengan kebutuhan-kebutuhan
yang bersifat material. Sedangkan kemajuan dalam bidang ekonomi ini bisa dilihat dari
berkembangnya keuangan kas negara yang banyak. Pada masa pemerintah Dinasti
Abbasiyah, sistem perekonomian dibangun dengan menggunakan sistem ekonomi
pertanian, perdagangan, perindustrian dan pertambangan. Pada masa khalifah Al-Mahdi
inilah perekonomian mulai meningkat dengan peningkatan di sektor pertanian dilakukan
melalui irigasi dan peningkatan hasil pertambangan seperti perak, emas, tembaga dan
besi. Terkecuali itu dagang transit antara Timur dan Barat juga banyak membawa
kekayaan. Bashrah merupakan pelabuhan yang terpenting pada saat itu. Selain itu,
banyak sekolah pertanian dan perkebunan dibuka pemerintah sebagai tempat praktek
pertanian dan perkebunan tersebut. Melalui sekolah inilah, perkembangan pada sektor
pertanian dan perkebunan mengalami kemajuan dan memberikan pengaruh pada rasio
atau pemikiran kaum muslim. Mereka dapat memperluas cakrawala pemikiran secara
teoritis karena telah mempelajari bermacam-macam tumbuh-tumbuhan, tanah-tanah
yang baik serta penggunaan berbagai macam pupuk untuk tumbuhan tersebut sehingga
dapat menghasilkan gandum, beras, kurma dan zaitun (oliver).
Popularitas Dinasti Abbasiyah mencapai puncaknya di zaman khalifah Harun al-
Rasyid (786-809 M) dan puteranya al-Ma’mun (813-833 M). Ketika al-Rasyid
memerintah, negara dalam keadaan makmur, kekayaan melimpah, keamanan terjamin
walaupun ada juga pemberontakan dan luas wilayahnya mulai dari Afrika Utara hingga
ke India. Kekayaan yang banyak tersebut dimanfaatkan Harun al-Rasyid untuk
keperluan sosial, seperti rumah sakit, lembaga pendidikan kedokteran dan farmasi.
Menurut Maidir Harun dan Firdaus, bahwa pada masa ini kekayaan negara sekitar 42
milyar dinar. Ini belum temasuk uang yang berasal dari pajak hasil bumi. Jumlah diatas
merupakan hal yang luar biasa pada masa itu. Sehingga pada masa beliau menjadi
khalifah, sudah terdapat paling tidak sekitar 800 orang dokter. Di samping itu,
pemandian-pemandian umum juga dibangun. Sampai-sampai dikatakan bahwa tingkat
kemakmuran yang paling tinggi terwujud pada zaman khalifah ini. Kesejahteraan sosial,
kesehatan, pendidikan, ilmu pengetahuan dan kebudayaan serta kesusasteraan berada
pada zaman keemasannya. Pada masa inilah negara Islam menempatkan dirinya sebagai
negara terkuat dan tak tertandingi. Jasa Bani Buwaih juga terlihat dalam pembangunan
kanal-kanal, masjid-masjid, beberapa rumah sakit dan sejumlah bangunan umum
lainnya. Kemajuan tersebut diimbangi dengan laju perkembangan ekonomi dibidang
pertanian, perdagangan dan industri terutama permadani.
a. Perkembangan di Bidang pertanian
Dunia Islam yang berkembang dan mencakup wilayah dunia yang cukup
luas, baik di Barat maupun di Timur pada umumnya terdiri dari daerah-daerah yang
subur, sehingga corak perekonomiannya adalah pertanian. Nasib petani lebih baik
daripada sebelum pemerintahan Islam, sebab perhatian pemerintah sangat besar
dalam pembuatan irigasi, penggalian terusan, khususnya di wilayah Sungai Tigris,
Efrat, Nil dan perluasan tanah pertanian. Mereka mendatangkan sayur-sayuran dan
buah-buahan dari Asia Barat seperti buah mangga, kentang dan sejenisnya dari
Amerika ada pohon limau, pohon sejenis jeruk nipis didatangkan dari tanah
Melayu, semua ditanam sebagai kegiatan pertanian mereka. Di Persia terdapat
kegiatan perkebunan tebu dengan kilangnya dan perkebunan serupa juga ada di
Syiria.Di Andalusia kegiatan pertanian tidak kalah maju pada masa Khalifah
Abdurrahman ad-Dakhil. Tak sejengkal pun tanah yang tidak dipergunakan untuk
kegiatan produksi, khususnya dalam bidang pertanian. Mereka menggali kanal,
menanam anggur, buah delima, jeruk, tebu, katun dan kunti serta tanaman lainnya.
Di dataran rendah di sebelah tenggara Andalusia terdapat tanaman gandum, terigu,
buah zaitun dan buah-buahan lainnya.
Pertanian maju pesat pada awal pemerintahan Dinasti Abbasiyah karena
pusat pemerintahannya berada di daerah yang sangat subur, di tepian sungai yang
dikenal dengan nama Sawad. Pertanian merupakan sumber utama pemasukan
negara dan pengolahan tanah hampir sepenuhnya dikerjakan oleh penduduk asli,
yang statusnya mengalami peningkatan pada masa rezim baru. Lahan-lahan
pertanian yang terlantar dan desa-desa yang hancur di berbagai wilayah kerajaan
diperbaiki dan dibangun secara perlahan-lahan. Mereka membangun saluran irigasi
baru sehingga membentuk “jaringan yang sempurna”. Tanaman asal Irak terdiri atas
gandum, padi, kurma, wijen, kapas, dan rami. Daerah yang sangat subur berada di
bantaran tepian sungai ke selatan, Sawad, yang menumbuhkan berbagai jenis buah
dan sayuran, yang tumbuh di daerah panas maupun dingin. Kacang, jeruk, terong,
tebu, dan beragam bunga, seperti bunga mawar dan violet juga tumbuh subur.
Usaha-usaha tersebut sangat besar pengaruhnya dalam meningkatkan perdagangan
dalam dan luar negeri. Akibatnya kafilah-kafilah dagang kaum muslimin melintasi
segala negeri dan kapal-kapal dagangnya mengarungi tujuh lautan.
b. Perkembangan di Bidang Industri dan Perdagangan
Di samping pertanian, pada masa itu kemampuan untuk menciptakan dan
membuat benda-benda budaya yang memenuhi kebutuhan hidup yang bersifat
material sudah berkembang pula, sehingga perekonomian masyarakat Islam pun
diwarnai oleh perindustrian dan kerajinan, terutama di kota-kota pusat kehidupan
sosial budaya pada saat itu.Di Persia dan Irak kegiatan pertenunan menghasilkan
barang-barang tekstil yang bermutu tinggi. Pabrik-pabrik di Susiana terkenal
dengan kain damastnya, kain tirai sutra, barang-barang dari bulu unta dan kambing
baju jubah dari pintalan sutra. Di beberapa kota wilayah Syiria terkenal dengan
gelasnya yang halus, tipis dan bening. Di Baghdad dan Samarkand terkenal dengan
pabrik kertasnya yang bermutu tinggi yang diperkenalkan oleh Tiongkok. Di
Andalusia aktivitas industri lebih maju lagi, hasil industri kulit dari Andalusia
dibawa ke Maroko, lalu diangkut ke Inggris dan Prancis. Di Kordova, Malaga,
Almeria serta pusat perdagangan lainnya terdapat industri wol dan sutra. Gelas dan
kuningan terdapat di Almeria, pusat barang pecah belah terdapat di Valencia, emas
dan perak terdapat di Algarve dan Yaen, besi dan timah hitam di Kordoba, batu
delima di Malaga, industri pedang terdapat di Toledo dengan bentuk dan modelnya.
Tak ketinggalan pula, pada masa Dinasti Abbasiyah ekonomi perdagangan
pun berkembang antardaerah-daerah penghasil pertanian dan
perindustrian/kerajinan. Pada masa kejayaan peradaban Islam telah berkembang
pula sistem perdagangan internasional, baik dengan dunia Barat (Bizantium dan
Eropa pada umumnya) maupun dengan dunia Timur (India, Tiongkok dan
Nusantara) dengan daerah-daerah Islam pusat-pusat kehidupan sosial budaya dan
pemerintahan, sebagai pusat-pusat perdagangan internasional tersebut. Ekonomi
imperium Abbasiyah paling dominan digerakkan oleh perdagangan. Sudah terdapat
berbagai macam industri seperti kain linen di Mesir, sutra dari Syiria dan Irak,
kertas dari Samarkand, serta berbagai produk pertanian seperti gandum dari Mesir
dan kurma dari Irak. Hasil-hasil industri dan pertanian ini diperdagangkan ke
berbagai wilayah kekuasaan Abbasiyah dan negara lain. Karena industralisasi yang
muncul di perkotaan ini, urbanisasi tak dapat dibendung lagi. Selain itu,
perdagangan barang tambang juga semarak. Emas yang ditambang dari Nubia dan
Sudan Barat melambungkan perekonomian Abbasiyah.
Perdagangan dengan wilayah-wilayah lain merupakan hal yang sangat
penting. Secara bersamaan dengan kemajuan Dinasti Abbasiyah, Dinasti Tang di
Cina juga mengalami masa puncak kejayaan sehingga hubungan Perdagangan
antara keduanya menambah semaraknya kegiatan perdagangan dunia. Permulaan
masa kepemimpinan Dinasti Abbasiyah, perbendaharaan negara penuh dan
berlimpah-limpah, uang masuk lebih banyak dari pada pengeluaran. Khalifah al-
Mansyur (754-775 M) adalah khalifah kedua Dinasti Abbasiyah yang telah
meletakkan dasar-dasar yang kuat bagi ekonomi dan keuangan negara. Dia
mencontoh pada Khalifah Umar bin Khattab dalam menguatkan Islam. Dia yang
membangun kota Baghdad yang sangat indah dan strategis letaknya ditinjau dari
segi perdagangan. Kota ini bahkan terkenal dalam cerita seribu satu malam (The
Thousand and One Night). Letaknya di sebelah Barat tepi sungai Tigris dekat
puing-puing kota Ctesiphon, ibukota kerajaan Persia dulu.Demikianlah kota
Baghdad yang merupakan jalan raya bagi pelayaran dunia pada waktu itu. Di
samping itu Basrah merupakan kota pelabuhan yang ramai disinggahi oleh kapal-
kapal dagang dari Timur dan Barat dan sebaliknya. Kota inipun membawa
kemajuan bagi perdagangan yang memperoleh penghasilan besar. Dan keberhasilan
kehidupan ekonomi maka berhasil pula dalam:
1. Pertanian, Khalifah membela dan menghormati kaum tani, bahkan
meringankan pajak hasil bumi mereka, dan ada beberapa yang dihapuskan
sama sekali.
2. Perindustrian, Khalifah menganjurkan untuk beramai-ramai membangun
berbagai industri, sehingga terkenallah beberapa kota dan industri-industrinya.
3. Perdagangan, Segala usaha ditempuh untuk memajukan perdagangan seperti:
a) Membangun sumur dan tempat-tempat istirahat di jalan-jalan yang
dilewati kafilah dagang.
b) Membangun armada-armada dagang.
c) Membangun armada: untuk melindungi parta-partai negara dari serangan
bajak laut.
Dari segi transportasi yang digunakan, perdagangan dunia Islam klasik
dapat dibagi atas perdagangan maritis, caravan (kafilah) dan perdagangan sungai.
Perdagangan maritim menggunakan kapal layar sebagai armada pengangkutan.
Komoditas perdagangan diangkut oleh armada pelayaran melalui samudra dan
lautan. Perdagangan caravan menggunakan hewan sebagai alat pengangkut. Suatu
kafilah terdiri dari ratusan unta, kuda atau keledai. Perdagangan sungai
menggunakan alat pengangkutan sungai dan kapal yang digunakan pada masa itu.
Pesatnya dunia perdagangan pada saat itu menumbuhkan kota dagang, seperti
Baghdad, Basrah, Siraf, Kairo dan Iskandaria. Pedagang-pedagang muslim
melakukan perniagaan ke Timur sampai ke Tiongkok, India dan Asia Tenggara
(termasuk Indonesia). Mereka juga melakukan perniagaan ke arah Barat sampai ke
Maroko, Andalusia (Spanyol), Prancis, Inggris dan negeri Barat lainnya. Mereka
kemudian mengekspor barang seperti kurma, gula, kain wol, gelas, bajak dan
sebagainya. Serta mengimpor rempah-rempah, kapur barus, sutra dari Asia, gading,
kayu arang dan bedak dari Afrika.
Selanjutnya kota-kota dagang bermunculan pula di Andalusia, seperti
Sivilia, Kordopa, Malaka dan sebagainya. Sivilia sebuah pelabuhan sungai
dipergunakan untuk mengekspor katun, zaitun dan minyak. Malaga mengekspor
kunyit, pualan dan gula. Hasil produksi Andalusia sampai ke India dan Asia Tengah
melalui Alexandria dan Konstantinopel. Di samping itu, mereka sendiri mengimpor
pakaian dari Mesir dan penyanyi dari Eropa dan Asia. Selain ketiga hal tersebut,
juga terdapat peninggalan-peninggalan yang memperlihatkan kemajuan pesat
Dinasti Abbasiyah.
1. Istana Qarruzzabad di Baghdad
2. Istana di kota Samarra
3. Bangunan-bangunan sekolah
4. Kuttab
5. Masjid
6. Majlis Muhadharah
7. Darul Hikmah
8. Masjid Raya Kordova (786 M)
9. Masjid Ibnu Taulon di Kairo (876 M)
10. Istana al-Hamra di Kordova
11. Istana al-Cazar, dan lain-lain.
Faktor-faktor yang menyebabkan kemajuan ekonomi dan kesejahteraan
masyarakat tercapai pada masa Dinasti Abbasiyah, antara lain sebagai berikut:
1. Kondisi politik yang stabil dan sistem pemerintahan yang kondusif, bagi
pemerintah dan masyarakat digunakan pembuka jalur-jalur ekonomi sebagai
alternatif pemenuhan kebutuhan hidup.
2. Tidak adanya ekspansi baru pada masa ini benar-benar dimanfaatkan oleh
seluruh lapisan masyarakat untuk meningkatkan kegiatan di bidang ekonomi
dan kesejahteraan mereka di semua sektor.
3. Besarnya arus permintaan (demand) bagi kebutuhan-kebutuhan hidup sehari-
hari baik yang bersifat primer, sekunder maupun tersier telah mendukung para
pelaku ekonomi untuk makin memperbesar kuantitas persediaan (suplai)
barang dan jasa.
4. Besarnya arus permintaan barang disebabkan karena peningkatan jumlah
penduduk terutama di wilayah perkotaan yang menjadi basis pertukaran aneka
macam komoditas komersial.
5. Luasnya wilayah kekuasaan Dinasti Abbasiyah mendorong perputaran dan
pertukaran kebutuhan komoditas menjadi ramai. Wilayah-wilayah bekas
jajahan Persia, Bizantium menjadi berkah bagi peningkatan ekonomi, karena
sebelum dikuasai Islam daerah tersebut menyimpan potensi ekonomi yang
besar.
6. Jalur transportasi laut menjadi sarana yang sangat menunjang bagi kelancaran
pengiriman barang-barang dan dibantu oleh kemahiran para pelaut muslim
yang mahir dalam ilmu kelautan atau navigasi.
7. Etos ekonomi para khalifah dan pelaku ekonomi dari golongan Arab
membuktikan sebagai pelaku ekonomi yang tangguh.Hal ini didorong oleh
kenyataan bahwa perdagangan sudah menjadi bagian hidup orang Arab,
apalagi kenyataan juga mengatakan bahwa Nabi sendiri juga adalah pedagang.

Kemunduran Peradaban Islam dan disentigrasi Politik Abbasiyah


A. Penyebab Terjadinya disintegrasi
1) Dinasti-Dinasti yang Memerdekakan Diri Dari Baghdad
Disintegrasi dalam bidang politik sebenarnya sudah mulai terjadi di akhir zaman bani
Umayyah. Akan terlihat perbedaan antara pemerintahan bani Umayyah dengan
pemerinatahan bani Abbas. Wilayah kekuasaan bani Umayyah, mulai dari awal berdirinya
sampai masa keruntuhanya, sejajar dengan batas wilayah kekuasaan Islam. Ada
kemungkinan bahwa para khalifah Abbasiyah sudah cukup puas dengan pengakuan nominal
dari provinsi-provinsi tertentu. Dengan pembiayaan upeti. Alasanya, pertama mungkin para
khalifah tidak cukup kuat untuk membuat mereka tunduk kepadanya. Kedua, penguasa bani
Abbas lebih menitik beratkan pembinaan peradaban dan kebudayaan dari pada politik dan
ekspansi.
Akibat dari kebijaksanaan yang lebih menekankan pada pembinaan peradaban dan
kebudayaan Islam dari pada persoalan politik itu, provinsi-provinsi tertentu di pinggiran
mulai lepas dari genggaman penguasa bani Abbas, dengan berbagai cara diantaranya
pemberontakan yang dilakukan oleh pemimpin lokal dan mereka berhasil memperoleh
kemerdekaan penuh, seperti Daulah Bani Umayyah di Spanyol dan Idrisiyah di Maroko.
Seseorang yang ditunjuk menjadi gubernur oleh khalifah, kedudukanya semakin bertambah
kuat, seperti daulah Aghlabiyah di Tunisia dan Thahiriyah di Khurasan.
Kecuali bani Umayyah di Spanyol dan Idrisiyah di Maroko, provinsi-provinsi itu pada
mulanya patuh membayar upeti selama mereka menyaksikan Baghdad stabil dan Khalifah
mampu mengatasi pergolakan yang muncul. Namun, saat wibawa khalifah sudah memudar
mereka melepaskan diri dari Baghdad. Mereka tidak hanya menggerogogoti kekuasaan,
bahkan diantara mereka ada yang berusaha menguasai Khalifah itu sendiri.
Menurut Watt, sebenarnya keruntuhan kekuasaan bani Abbas mulai terlihat sejak awal
abad kesembilan. Fenomena ini mungkin bersamaan dengan datangnya pemimpin-pimimpin
yang memiliki kekuasaan militer di provinsi-provinsi tertentu yang membuat mereka benar-
benar independen.
Kekuatan militer Abbasiyah waktu itu mulai mengalami kemunduran. Sebagai gantinya,
para penguasa Abbasiyah mengerjakan orang-orang profesional di bidang kemiliteran,
khususnya tentara Turki dengan sistem perbudakan baru. Pengangkatan anggota militer Turki
ini, dalam perkembangan selanjutnya ternyata menjadi ancaman besar terhadap kekuasaan
khalifah. Apalagi pada periode pertama pemerintahan dinasti Abbasiyah sudah muncul
fanatisme kebangsaan berupa gerakan syu’ubiyyah (kebangsaan/anti Arab). Gerakan inilah
yang banyak memberikan inspirasi terhadap gerakan politik, di samping persoalan-persoalan
keagamaan. Nampaknya para khalifah tidak sadar akan bahaya politik dari fanatisme
kebangsaan dan aliran keagamaan itu, sehingga meskipun dirasakan dalam hampir semua
segi kehidupan, seperti dalam kesusasteraan dan karya-karya ilmiah, mereka tidak
bersungguh-sungguh menghapuskan fanatisme tersebut, bahkan ada diantara mereka yang
justru melibatkan diri dalam konflik kebangsaan dan keagamaan itu.
Dinasti-dinasti yang lahir dan melepaskan diri dari kekuasaan Baghdad pada masa
khalifah Abbasyiah, diantaranya adalah :
a) Yang berbangsa Persia :
1. Thahiriyah di Khurasan (205-259 H/820-872 M)
2. Shafariyah di Fars (254-290 H/868-901 M)
3. Samaniyah di Transoxania (261-289 H/873-998 M)
4. Sajiyyah di Azerbeijan (266-318 H/878-930 M)
5. Buwaihiyah bahkan menguasai Baghdad (320-447 H / 932-1055 M)
b) Yang berbangsa Turki
1. Thuluniyah di Mesir (254-292 H/837-903 M)
2. Ikhsyidiyah di Turkistan (320-560 H/932-1163 M)
3. Ghazanawiyah di Afganistan (351-585 H/962-1189 M)
Dinasti Seljuk dan cabang-cabangnya
c) Yang berbangsa Kurdi
1. Al Barzuqani (348-406 H/959-1015 M)
2. Abu Ali ((380-489 H/990-1095 M)
3. Ayubiyah (564- 648 H/1167-1250 M)
d) Yang berbangsa Arab
1. Idrisiyah di maroko (172-375 H/788-985 M)
2. Aghlabiyah di Tunisia (184-289 H/800-900 M)
3. Dulafiyah di Kurdistan (210-285 H/825-898 M)
e) Yang mengaku dirinya sebagai khalifah
1. Umawiyah di spanyol
2. Fathimiyah di mesir (909-1171 M)
Faktor–faktor yang menyebabkan kemunduran bani Abbas, sehingga daerah banyak yang
memerdekakan diri ;
a. Luasnya wilayah kekuasan Bani Abbasiyah
b. Dengan profesionalisasi angkatan senjata, ketergantungan khalifah sangat tinggi
c. Keuangan negara sangat sulit karena untuk biaya tentara sangat besar.
B. Perebutan Kekuasaan Di Pusat Pemerintahan
Faktor lain yang menyebabkan peran politik bani Abbas menurun adalah perebutan
kekuasaan di pusat pemerintahan. Hal ini sebenarnya juga terjadi pada pemerintahan-
pemerintahan Islam sebelumnya. Nabi Muhammad memang tidak menentukan bagaiman acara
penggantian pemimpin setelah ditinggalkanya. Beliau menyerahkan masalah ini kepada kaum
muslimin sejalan dengan jiwa kerakyatan yang berkembang dikalangan masyarakat Arab dan
ajaran demokrasi dalam Islam. Setelah nabi wafat, terjadi pertentangan pendapat diantara kaum
muhajirin dan anshar dibalai kota bani Sa’idah di madinah. Akan tetapi, karena pemahaman
keagaamaan mereka yang baik, semangat musyawarah, ukhuwah yang tinggi, perbedaan itu
dapat diselesaikan. dan Abu Bakar terpilih menjadi khalifah.
Pertumpahan darah pertama dalam Islam karena perebutan kekuasaan terjadi pada masa
kekhalifahan Ali bin abi thalib. Ali terbunuh oleh bekas pengikutnya sendiri. Pemberontakan-
pemberontakan yang muncul pada masa Ali ini bertujuan untuk menjatuhkanya dari kursi
khalifah dan diganti oleh pemimpin pemberontak itu. Hal ini sama juga terjadi pada masa
kekhalifahan bani Umayyah di Damaskus. Seperti pemberontakan Husein bin Ali, syi’ah yang
dipimpin oleh al- Muchtar, Abdullah bin Zubair, dan terakhir pemberontakan Bani Abbas yang
untuk pertama kalinya dengan menggunakan nama gerakan Bani Hasyim. Pemberontakan
terakhir ini berhasil dan kemudian mendirikan pemerintahan baru yang diberi nama khilafah
Abbasiyah atau Bani abbas.
Pada pemerintahan bani Abbas, perebutan kekuasaan seperti itu juga terjadi, terutama di
awal berdirinya. Akan tetapi pada masa-masa berikutnya, seperti terlihat pada periode kedua dan
seterusnya, meskipun khalifah tidak berdaya, tidak ada usaha untuk merebut jabatan khilafah dari
tangan Bani Abbas. Yang ada hanyalah usaha merebut kekuasaanya dengan membiarkan jabatan
khalifah tetap dipegang Bani Abbas.
Hal ini terjadi karena Khalifah dianggap sebagai jabatan keagamaan yang sakral dan tidak
bisa di ganggu gugat lagi. Sedangkan kekuasaan dapat didirikan di pusat maupun di daerah yang
jauh dari pusat pemerintahan dalam bentuk dinasti-dinasti kecil yang merdeka. Tentara Turki
berhasil merebut kekuasaan tersebut. Ditangan mereka khalifah bagaikan boneka yang tak bisa
berbuat apa-apa. Bahkan merekalah yang memilih dan menjatuhkan khalifah sesuai dengan
keinginan politik mereka.
Setelah kekuasaan berada di tangan orang-orang Turki pada periode kedua, pada periode
ketiga (334 H/945 M-447 H/1055 M), Daulah Abbasyiah berada dibawah kekuasaan bani
Buwaih.
Setelah Baghdad dikuasai, Bani Umayyah memindahkan markas kekuasaan dari Syiraz ke
Baghdad. Mereka membangun gedung tersendiri di tengah-tengah kota dengan nama Dar al-
Mamlakah. Kekuatan politik Bani Buwaih tidak lama bertahan. Kekuasaan Bani Buwaih
akhirnya jatuh ke tangan Saljuk. Pergantian kekuasaan ini menandakan awal periode keempat
Bani Abbasiyah.
Dinasti Saljuk diakui sebagai dinasti yang sukses dalam membangun masyarakat ketika itu.
Diantara jasa-jasanya antara lain:
1. Memperluas Masjidi al-Haram dan Masjid Nabawi
2. Pembangunan rumah sakit di Naisabur
3. Pembangunan gedung peneropong bintang
4. Pembangunan sarana pendidikan.
Di bawah pemerintahan Malik Syah (1072-1092) kekuasaan Saljuk mencapai puncaknya,
wilayah kekuasaan terbentang luas dari kasygar, sebuah kota kecil di wilayah paling ujung Turki,
setelah kematian Malik syah, sejumlah perang antara putera-puteranya ditambah berbagi
kerusauhan telah melemahkan otoritas Saljuk dan mengakibatkan hancurnya pemerintahan.
C. Sebab-sebab Kemunduran Bani Abbas
Berakhirnya kekuasaan dinasti Saljuk atas Baghdad atau khilafah Abbasiyah merupakan
awal dari periode kelima. Pada periode ini, khalifah Abbasiyah tidak lagi berada di bawah
kekuasaan suatu dinasti tertentu, walaupun banyak sekali dinasti Islam berdiri. Ada diantaranya
yang cukup besar, namun yang terbanyak adalah dinasti kecil. Para khalifah Abbasiyah, sudah
merdeka dan berkuasa kembali, tetapi hanya di Baghdad dan sekitarnya. Wilayah kekuasaan
khalifah yang sempit ini menunjukkan kelemahan politiknya. Pada masa inilah tentara Mongol
dan Tartar menyerang Baghdad. Baghdad dapat direbut dan dihancurluluhkan tanpa perlawanan
yang berarti. Kehancuran Baghdad akibat serangan tentara Mongol ini awal babak baru dalam
sejarah Islam, yang disebut masa pertengahan.
Sebagaimana terlihat dalam periodisasi khilafah Abbasiyah, masa kemunduran dimulai sejak
periode kedua. Namun demikian, faktor-faktor penyebab kemunduran itu tidak datang secara
tiba-tiba. Benih-benihnya sudah terlihat pada periode pertama, hanya karena khalifah pada
periode ini sangat kuat, benih-benih itu tidak sempat berkembang. Dalam sejarah kekuasaan Bani
Abbas terlihat bahwa apabila khalifah kuat, para menteri cenderung berperan sebagai kepala
pegawai sipil, tetapi jika khalifah lemah, mereka akan berkuasa mengatur roda pemerintahan.
Disamping kelemahan khalifah, banyak faktor lain yang menyebabkan khilafah Abbasiyah
menjadi mundur, masing-masing faktor tersebut saling berkaitan satu sama lain. Beberapa
diantaranya adalah sebagai berikut:
1. Persaingan antar Bangsa
Khilafah Abbasiyah didirikan oleh Bani Abbas yang bersekutu dengan orang-orang Persia.
Persekutuan dilatarbelakangi oleh persamaan nasib kedua golongan itu pada masa Bani
Umayyah berkuasa. Keduanya sama-sama tertindas. Setelah khilafah Abbasiyah berdiri, dinasti
Bani Abbas tetap mempertahankan persekutuan itu. Ada dua sebab dinasti Bani Abbas memilih
orang-orang Persia daripada orang-orang Arab. Pertama, sulit bagi orang-orang Arab untuk
melupakan Bani Umayyah. Pada masa itu mereka merupakan warga kelas satu. Kedua, orang-
orang Arab sendiri terpecah belah dengan adanya Nashabiyah (kesukuan). Dengan demikian,
khilafah Abbasiyah tidak ditegakkan di atas Nashabiyah tradisional.
Meskipun demikian, orang-orang Persia tidak merasa puas. Mereka menginginkan sebuah
dinasti dengan raja dan pegawai dari Persia pula. Sementara itu bangsa Arab beranggapan bahwa
darah yang mengalir di tubuh mereka adalah darah (ras) istimewa dan mereka menganggap
rendah bangsa non-Arab di dunia Islam.
Selain itu, wilayah kekuasaan Abbasiyah pada periode pertama sangat luas, meliputi berbagai
bangsa yang berbeda, seperti Maroko, Mesir, Syria, Irak, Persia, Turki dan India. Mereka
disatukan dengan bangsa Semit. Kecuali Islam, pada waktu itu tidak ada kesadaran yang merajut
elemen-elemen yang bermacam-macam tersebut dengan kuat. Akibatnya, disamping fanatisme
kearaban, muncul juga fanatisme bangsa-bangsa lain yang melahirkan gerakan syu’ubiyah.
Fanatisme kebangsaan ini nampaknya dibiarkan berkembang oleh penguasa. Sementara itu,
para khalifah menjalankan sistem perbudakan baru. Budak-budak bangsa Persia atau Turki
dijadikan pegawai dan tentara. Mereka diberi nasab dinasti dan mendapat gaji. Oleh Bani Abbas,
mereka dianggap sebagai hamba. Sistem perbudakan ini telah mempertinggi pengaruh bangsa
Persia dan Turki. Karena jumlah dan kekuatan mereka yang besar, mereka merasa bahwa negara
adalah milik mereka, mereka mempunyai kekuasaan atas rakyat berdasarkan kekuasaan khalifah.
Kecenderungan masing-masing bangsa untuk mendominasi kekuasaan sudah dirasakan sejak
awal khalifah Abbasiyah berdiri. Akan tetapi, karena para khalifah adalah orang-orang kuat yang
mampu menjaga keseimbangan kekuatan, stabilitas politik dapat terjaga. Setelah al-Mutawakkil,
seorang khalifah yang lemah, naik tahta, dominasi tentara Turki tak terbendung lagi. Sejak itu
kekuasaan Bani Abbas sebenarnya sudah berakhir. Kekuasaan berada di tangan orang-orang
Turki. Posisi ini kemudian direbut oleh Bani Buwaih, bangsa Persia, pada periode ketiga, dan
selanjutnya beralih kepada dinasti Seljuk pada periode keempat.
2. Kemerosotan Ekonomi
Khilafah Abbasiyah juga mengalami kemunduran di bidang ekonomi bersamaan dengan
kemunduran di bidang politik. Pada periode pertama, pemerintahan Bani Abbas merupakan
pemerintahan yang kaya. Dana yang masuk lebih besar dari yang keluar, sehingga Bait al-Mal
penuh dengan harta. Pertambahan dana yang besar diperoleh antara lain dari al-Kharaj, semacam
pajak hasil bumi.
Setelah khilafah memasuki periode kemunduran, pendapatan negara menurun sementara
pengeluaran meningkat lebih besar. Menurunnya pendapatan negara itu disebabkan oleh makin
menyempitnya wilayah kekuasaan, banyaknya terjadi kerusuhan yang mengganggu
perekonomian rakyat. diperingannya pajak dan banyaknya dinasti-dinasti kecil yang
memerdekakan diri dan tidak lagi membayar upeti. Sedangkan pengeluaran membengkak antara
lain disebabkan oleh kehidupan para khalifah dan pejabat semakin mewah, jenis pengeluaran
makin beragam dan para pejabat melakukan korupsi. Kondisi politik yang tidak stabil
menyebabkan perekonomian negara morat-marit. Sebaliknya, kondisi ekonomi yang buruk
memperlemah kekuatan politik dinasti Abbasiyah kedua, faktor ini saling berkaitan dan tak
terpisahkan.
3. Konflik Keagamaan
Fanatisme keagamaan berkaitan erat dengan persoalan kebangsaan. Munculnya gerakan
yang dikenal dengan gerakan Zindiq ini menggoda rasa keimanan para khalifah. Al-Manshur
berusaha keras memberantasnya. Al-Mahdi bahkan merasa perlu mendirikan jawatan khusus
untuk mengawasi kegiatan orang-orang Zindiq dan melakukan mihnah (ujian) dengan tujuan
memberantas bid’ah. Akan tetapi, semua itu tidak menghentikan kegiatan mereka. Konflik antara
kaum beriman dengan golongan Zindiq berlanjut mulai dari bentuk yang sangat sederhana
seperti polemik tentang ajaran, sampai kepada konflik bersenjata yang menumpahkan darah di
kedua belah pihak. Gerakan al-Afsyin dan Qaramithah adalah contoh konflik bersenjata itu.
4. Ancaman dari Luar
Apa yang disebutkan di atas adalah faktor-faktor internal. Disamping itu, ada pula faktor-
faktor eksternal yang menyebabkan khilafah Abbasiyah lemah dan akhirnya hancur. Pertama,
Perang Salib yang berlangsung beberapa gelombang atau periode dan menelan banyak korban.
Kedua serangan tentara Mongol ke wilayah kekuasaan Islam. Sebagaimana telah disebutkan,
orang-orang Kristen Eropa terpanggil untuk ikut berperang setelah Paus Urbanus II (1088-1099
M) mengeluarkan fatwanya. Perang Salib itu juga membakar semangat perlawanan orang-orang
Kristen yang berada di wilayah kekuasaan Islam. Namun, diantara komunitas-komunitas Kristen
Timur, hanya Armenia dan Maronit Lebanon yang tertarik dengan Perang Salib dan melibatkan
diri dalam tentara Salib itu.
Pengaruh Salib juga terlihat dalam penyerbuan tentara Mongol. Disebutkan bahwa Hulagu
Khan, panglima tentara Mongol, sangat membenci Islam karena ia banyak dipengaruhi oleh
orang-orang Budha dan Kristen Nestorian. Gereja-gereja Kristen berasosiasi dengan orang-orang
Mongol yang anti Islam itu dan diperkeras di kantong-kantong ahl al-kitab. Tentara Mongol,
setelah menghancurleburkan pusat-pusat Islam, ikut memperbaiki Yerussalem.
D. Perkembangan Intelektual Masa Disintegrasi
Betapapun juga seramnya situasi politik di ibukota negara baghdad tetapi ilmu-ilmu
pengetahuan dan kebudayaan Islam tetap menunjukkan semaraknya. Pada masa disintegrasi
yang menyebabkan kehancuran dalam kekhalifahan Abbasiyah, tetapi tidak menghambat
perkembangan intelektual. Pada saat disintegrasi yang dimulai dengan berdirinya dinasti
Thahiriyah, perkembangan intelektual mengalami perkembangan yang cukup berarti. Ini terbukti
dengan munculnya tokoh-tokoh intelektual pada bidangnya, baik itu dalam bidang ilmu sastra,
ilmu filsafat, dan kedokteran maupun dalam bidang hukum dan politik.
1) Ilmu sastra, tokohnya ;
a. Abul ‘Alla al- ma’ary (363–449 H./973-1057 M.), seorang penyair filosof yang banyak
karangannya, diantaranya diterjemahkan ke dalam bahasa Latin dan Inggris oleh Thomas
Carlyle dan ke bahasa Jerman oleh Von Kremer.
b. Pujangga Proza Shabi (313 – 383 H./925-994 M.)
c. Shahib ibnu Ubbad (326–385 H./938-985 M.)
d. Ulama penyair, Abu Bakar Khuwarizmi (389 H./993 M.)
e. Penyair pengarang Badie’uz Zaman Hamdani ( 358–398 H./969-1007 M.)
f. Penyair Ibnu ‘Amied
2) Ilmu Filsafat dan kedokteran
a. Muhammad ibn Zakaria ar – razi, seorang filosof dan dokter yang terkenal
b. Ali ibn al–Majusi, dokter pribadi dari ‘Adhudud Daulah dan sekaligus pengarang buku
“Kamil as-Shina’at”
3) Hukum dan Politik
Satu nama yang tidak boleh dilupakan ialah seorang ahli hukum yang menjabat sebagai
mahkamah agung dan juga pengarang politik yaitu Imam Mawardi (368-450 H./974-1058 M.)
seorang pengarang ilmu politik yang sangat aktif, penulis buku ‘Al Ahkam as- Sulthaniyah
tentang hukum pemerintahan.
E. Munculnya Tiga Kerajaan Besar
Dampak lain dari tumbangnya Dinasti Abbasiah adalah, munculnya kerajaan-kerajaan
lain. Tiga kerajaan tersebut ialah kerjaaan Turki Usmani, Safawi dan Mughal.

SEJARAH PERADABAN ISLAM DI ANDALUSIA


A. Aspek Politik
Sejak pertama kali menginjakkan kaki di tanah Spanyol hingga jatuhnya kerajaan
Islam terakhir di sana. Islam memainkan peranan yang sangat besar. Masa itu berlangsung
lebih dari tujuh setengah abad. Sejarah panjang yang dilalui umat islam di Spanyol itu dapat
di bagi menjadi beberapa periode:
a) Periode Pertama (Gerakan Pembebasan)
Periode pertama ini antara tahun 711-755 M, Andalus diperintah oleh para wali yang
diangkat oleh khalifah bani Umayah yang berpusat di Damaskus. Pada periode ini
stabilitas politik negeri Spanyol belum tercapai secara sempurna, gangguan-gangguan
masih terjadi, baik datang dari dalam maupun dari luar. Gangguan dari dalam antara lain
berupa perselisihan di antara elit penguasa, terutama akibat perbedaan etnis dan
golongan. Adapun gangguan dari luar datang dari sisa-sisa musuh Islam di Spanyol yang
bertempat tinggal di daerah-daerah pegunungan yang memang tidak pernah tunduk
kepada pemerintahan Islam.
b) Periode Kedua
Periode ini antara tahun 755-1013 M pada waktu Andalus dikuasai oleh daulah
Umayyah II. Periode ini dibagi dua:
1. Masa Keamiran
Pada masa ini, spanyol berada di bawah pemerintahan seorang yang bergelar
amir (panglima atau gubernur) tetapi tidak tunduk kepada pusat pemerintahan Islam.
yang ketika itu dipegang oleh khalifah Abbasyiah di Baghdad. Sebagaimana telah
diceritakan dalam sejarah Islam bahwa pada tahun 750 M kerajaan bani Umayyah
dapat direbut oleh bani Abbasyiah. Naiknya bani Abbasyiah dalam tahta kerajaan
diikuti dengan pembunuhan dan penumpasan terhadap keluarga bani Umayyah, hanya
sedikit warganya yang lolos dari peristiwa tersebut, diantaranya Abd al-Rahman yang
dikenal dalam sejarah Abd al-Rahman al-Dakhil artinya Abd al-Rahman yang lolos
dari pembantaian bani Abbasyiah. Dengan kecerdikannya, ia dapat mendirikan
kerajaan baru di sana, dan menyebabkan Al-Manshur (pendiri Daulah Abbasiyah)
menjadi kagum dan memberinya gelar “Sakhar Quraisy” (garuda kaum Quraisy).
Masa keamiran tahun 755-912 M. Masa ini dimulai ketika Abd al-Rahman al-
Dakhil, seorang keturunan bani Umayyah I yang berhasil menyelamatkan diri dari
pembunuhan yang dilakukan bani Abbas di Damaskus, mengambil kekuasaan di
Andalus pada masa Amir Yusuf al-Fihr. Ia kemudian memproklamirkan berdirinya
daulah Umayyah II di Andalus kelanjutan Umayyah I di Damaskus.
2. Masa Kekhalifahan
Masa kekhalifahan tahun 912-1013 M, masa ini mencapai puncaknya di bawah
kekuasaan pemerintahan amir kedelapan, ‘Abd al-Rahman III (912-961), orang
pertama yang menyandang gelar Khalifah. Ia menggelari diri dengan khalifah al-
Nashir li Dinillah. Spanyol telah mencapai puncak kejayaannya di bawah para
penguasa daulah Umayyah, Abd al-Rahman III (912-961 M), al-Hakam II (961-976
M). Pada waktu itu, ibukota Cordova menyala bagaikan cahaya kilau-kemilau di
dalam gelapnya daratan Eropa dan dengan Baghdad dan Konstantinopel dapat
diperkerikakan sebagai salah satu daripada tiga pusat peradaban dunia. Selama
periode Umayyah, Cordova di Spanyol tetap menjadi ibukota dan menikmati periode
kemegahan yang tiada tandingannya, seperti pesaingnya di Irak (Baghdad).
Awal dari kehancuran khilafah bani Umayyah di Spanyol adalah ketika Hisyam
II (976-1009 M), naik tahta dalam usia sebelas tahun. Oleh karena itu kekuasaan
aktual berada di tangan para pejabat. Pada tahun 981 M, Khalifah menunjuk Ibn Abi
amir sebagai pemegang kekuasaan secara mutlak. Dia seorang yang ambisius yang
berhasil menancapkan kekuasaannya dan melebarkan wilayah kekuasaan Islam
dengan menyingkirkan saingan-saingannya. Atas keberhasilan tersebut, ia mendapat
gelar al-Manshur Billah. Ia wafat pada tahun 1002 M dan digantikan oleh anaknya al-
Muzaffar yang masih dapat mempertahankan keunggulan kerajaan. Akan tetapi,
setelah wafat pada tahun 1008 M, ia digantikan oleh adiknya yang tidak memiliki
kualitas bagi jabatan itu. Dalam beberapa tahun saja, Negara yang tadinya makmur
dilanda kekacauan dan akhirnya kehancuran total.
Pada tahun 1009 M khalifah mengundurkan diri dan beberapa orang yang dicoba
untuk menduduki jabatan itu tidak ada yang sanggup memperbaiki keadaan. Akhirnya
pada tahun 1013 M, Dewan Menteri yang memerintah Cordova menghapus jabatan
Khalifah. Ketika itu, Spanyol sudah terpecah dalam banyak sekali Negara kecil yang
berpusat di kota-kota tertentu.
c) Periode ketiga
Periode ketiga ini antara tahun 1013-1492 M, ketika umat Islam Andalus terpecah
dan menjadi kerajaan-kerajaan kecil. Periode ini dibagi menjadi tiga masa:
1) Masa kerajaan-kerajaan kecil yang sifatnya lokal tahun 1013-1086 M. Pada masa ini,
Spanyol terpecah menjadi lebih dari tiga puluh Negara kecil dibawah pemerintahan
raja-raja golongan, masa ini disebut Muluk al-Thawaif, yang berpusat di suatu kota
seperti Seville, Cordova, Toledo dan sebagainya. Pada masa ini umat Islam Spanyol
kembali memasuki masa pertikaian intern. Ironisnya, kalau terjadi perang saudara,
ada di antara pihak-pihak yang bertikai itu yang meminta bantuan kepada raja-raja
Kristen. Melihat kelemahan dan kekacauan tersebut, orang-orang Kristen mulai
mengambil inisiatif penyerangan. Meskipun kehidupan politik tidak stabil, namun
kehidupan intelektual terus berkembang pada masa ini.
2) Masa antara tahun 1086-1235 M, pada masa ini, Spanyol Islam meskipun masih
terpecah dalam beberapa Negara, tetapi terdapat satu kekuatan yang dominan yaitu
dinasti Murabithun (1086-1143 M) dan dinasti Muwahhidun (1146-1235 M). Dinasti
Murabithun pada mulanya adalah sebuah gerakan agama yang didirikan bangsa
Barbar di Afrika Utara dipimpin oleh Yusuf ibn Tasyfin. Dinasti ini datang ke
Andalus mengusir umat Kristen yang menyerang Sevilla pada tahun 1086 M, tetapi
menggabungkan Muluk al-Thawaif ke dalam dinasti yang dipimpinnya sampai tahun
1143 M, ketika dinasti ini melemah digantikan oleh dinasti Barbar lain Al-
Muwahhidin (1146-1235 M). Dinasti ini datang ke Andalus dipimpin Abd al-
Mu’min. Pada masa putranya Abu ya’kub Yusuf bin Abd al-Mu’min (1163-1184 M)
Andalus mengalami masa kejayaan. Namun sepeninggal Sultan ini Al-Muwahhidin
mengalami kelemahan. Bersamaan dengan kelemahan yang dialami kaum muslimin,
gerakan reconquista atau pengambilan kembali wilayah-wilayah dari tangan Muslim
oleh pasukan Kristen telah dimulai yaitu ditandai dengan kekalahan kaum Muslimin
yang fatal di pertempuran Las Navas de Tolosa pada tahun 608 H/1212 M.
Kekalahan-kekalahan yang dialami Muwahhidun menyebabkan penguasanya memilih
untuk meninggalkan Spanyol dan kembali ke Afrika Utara tahun 1235 M. Dalam
kondisi demikian, umat Islam tidak mampu bertahan dari serangan-serangan Kristen
yang semakin besar. Tahun 1238 M Cordova jatuh ke tangan penguasa Kristen dan
Seville jatuh tahun 1248 M, seluruh Spanyol lepas dari kekuasan Islam, kecuali
Granada yang dikuasai oleh bani Ahmar sejak tahun 1232 M.
3) Masa antara tahun 1232-1492, ketika umat Islam Andalus bertahan di wilayah
Granada di bawah kuasa dinasti bani Ahmar. Pendiri dinasti ini adalah Sultan
Muhammad bin Yusuf bergelar al-Nasr, oleh karena itu kerajaan ini disebut juga
Nasriyyah. Kerajaan ini merupakan kerajaan terakhir umat Islam Andalus yang
berkuasa di wilayah antara Almeria dan Gibraltar, pesisir Tenggara Andalus. Dinasti
ini dapat bertahan karena dilingkupi oleh bukit sebagai pertahanan dan mempunyai
hubungan yang dekat dengan negeri Islam Afrika Utara yang waktu itu di bawah
kerajaan Marin. Ditambah lagi Granada tempat berkumpulnya pelarian dan umat
Islam dari wilayah selain Andalus ketika wilayah itu dikuasai tentara Kristen. Oleh
karena itu, dinasti ini pernah mencapai kemajuan diantaranya membangun istana Al-
Hambra. Namun pada dekade terakhir abad XIV M dinasti ini telah lemah akibat
perebutan kekuasaan. Kesempatan ini dimanfaatkan oleh kerajan Kristen yang telah
mempersatukan diri melalui pernikahan antara Isabella dari Aragon dengan raja
Ferdinand dari Castilla untuk bersama-sama merebut kerajaan Granada. Pada tahun
1487 mereka dapat merebut Malaga, tahun 1489 menguasai Almeria, tahun 1492
menguasai Granada. Raja terakhir Granada, Abu Abdullah, melarikan diri ke Afrika
Utara.
Gerakan reconquista terus berlanjut. Tahun 1499 kerajaan Kristen Granada
melakukan pemaksaan terhadap orang Islam untuk memeluk Kristen, buku-buku tentang
Islam dibakar. Tahun 1502 kerajaan Kristen ini mengeluarkan perintah supaya orang Islam
Granada keluar dari negeri itu kalau tidak mau menukar agama menjadi Kristen. Umat
Islam harus memilih antara masuk Kristen atau keluar dari Andalus sebagai orang terusir.
Maka banyak orang Islam yang menyembunyikan keislamannya melahirkan
kekristenannya. Timbul pula pemberontakan-pemberontakan. Pada tahun 1596 sekali lagi
orang Islam Granada memberontak dibantu oleh kerajaan Ostmaniyah. Antara tahun 1604-
1614 kira-kira setengah juta orang Islam Spanyol pindah ke Afrika Utara. Ini merupakan
perpindahan terakhir umat Islam Spanyol. Sejak saat itu tak ada lagi umat Islam di
Andalus.
Setelah peristiwa itu, mereka hilang di mata dunia luar dari panggung sejarah pada
abad kesembilan Hijriah/ketujuh belas Masehi, meskipun demikian, pengaruh Islam dan
budayanya masih bisa dirasakan di Spanyol sampai hari ini.
B. Sistem Pemerintahan Islam Pada Masa Bani Umayyah di Andalusia
Pada masa kekuasaan Bani Umayyah, Andalusia menjalankan pemerintahannya
seperti bangsa-bangsa Romawi yaitu bersifat sentralistik. Pemerintahan dan kekuasaan
sepenuhnya berada di tangan raja. Kekuasaan islam pada masa Bani Umayyah di
Andalusia dapat di bagi menjadi enam periode, yaitu:
a) Peride Pertama (711-755 M)
Kepemimpinan berada di bawah pemerintahan para wali yang di angkat oleh khalifah
Bani Umayyah yang berpusat di Damaskus. Stabilitas politik belum sepenuhnya tercapai
karena masih adanya pergesekan antara sesama penguasa yang di picu oleh perbedaan
etnis dan suku. Hal ini menimbulkan terjadinya konflik dalam sistem politik saat itu
sehingga tidak ada gubernur yang mampu mempertahankan kekuasaannya dalam jangka
waktu lama.
b) Periode Kedua (755-912 M)
Kepemimpinan berada di bawah pemerintahan seorang amir, tetapi tetap tunduk pada
pusat pemerintahan . Andalusia mulai memperoleh kemajuan, baik dalam politik maupun
dalam bidang peradaban. Hukum islam mulai di perbaharui dan di tegakkan. Namun
gangguan-gangguan tetap muncul, salah satunya datang dari umat islam sendiri.
Golongan orang yang merasa tidak puas dengan pemerintahan yang ada mulai
menjalankan aksi revolusi.
c) Periode Ketiga (912-1013 M)
Andalusia di perintah oleh seorag khalifah. Khalifah besar yang pernah memerintah
pada periode ini, yaitu:
1. Abd al-Rahman III
Pada masa pemerintahannya inilah Andalusia mencapai puncak kejayaannya. Abd al-
Rahman III melakukan pembaharuan dan inovasi dalam bidang administrasi. Beliau
tercatat sebagai orang yang telah membawa Spanyol muslim ke kedudukan yang lebih
tinggi.
2. Hakam II (961-976 M)
Hakam merupakan anak dari Abd Al-Rahmah III. Sepeninggal ayahnya, Hakim
mengambil alih kursi kepemimpinan Andalusia. Pada masa kepemimpinannya masih
banyak terjadi pemberontakan dan peperangan. Namun tidak mengurangi kemajuan yang
di buat oleh Hakim III. Salah satu kemajuannya adalah dengan memajukan bidang
pendidikan, ekonomi dan pembangunan.
3. Hisyam II
Hhisyam di angkat menjadi khalifah ketika usianya masih belia yang kemudian
menyebabkan ibunya Sulthonh Subh dan seoarang bernama Muhammad Ibn Abi Amir
mengambil alih kekuasaan.
d) Periode Keempat (1013-1086 M)
Andalusia terpecah menjadi lebih dari 20 kerajaan kecil. Masa ini disebut Muluk al-
Thawaif (Raja Golongan) yang mendirikan kerajaan berdasarkan etnis barbar. Meskipun
terjadi ketidakstabilan, namun peradaban di Andalusia tidak terpengaruh dan tetap
mengalami kemajuan.
e) Periode Kelima (1086-1248 M)
Meskipun Andalusia terpecah menjadi negara-negara kecil, tetapi terdapat dua
kekuatan besar yaitu dinasti Murabhitun (1086-1143 M) dan dinasti Muwahiddun (1146-
1235 M). Namun kedua dinasti tersebut tidak berkuasa lama karena adanya gangguan dari
kelompok kristen. Hingga akhirnyaseluruh wilayah Andalusia kecuali Granada jatuh pada
kekuasaan Kristen.
f) Periode Keenam (1248-1492 M)
Islam hanya berkuasa di wilayah Granada di bawah dinasti Bani Ahmar (1232-1492
M). Namun pada akhir abad ke 14 M, dinasti ini mulai mengalami kelemahan akibat
perebutan kekuasaan. Hal ini di manfaatkan oleh tentara kristen untuk menyerang
Granada. Pada tahun 1492 terjadi serangan gabungan antara kerajaan Aragon dan kerajaan
Castille terhadap kota Granada selama berbulan-bulan hingga kota tersebut jatuh kepada
pihak penyerang pada tanggal 2 Januari 1492.

Perang Salib
A. Timbulnya Perang Salib
Perang salib (The Crusades War) adalah serangkaian perang agama selama hampir
dua abad (di mulai pada akhir abad ke-11 sampai dengan abad ke-13) sebagai reaksi
Kristen Eropa terhadap Islam Asia. Perang ini terjadi karena sejumlah kota dan tempat
suci Kristen diduduki Islam sejak 632, seperti Suriah, Asia Kecil, Spanyol dan Sicilia.
Militer Kristen menggunakan salib sebagai simbol yang menunjukkan bahwa perang ini
suci dan bertujuan membebaskan kota suci Baitul Maqdis (Yerusalem) dari orang Islam.
B. Sebab-sebab Perang Salib
Ada beberapa faktor yang memicu terjadinya perang salib. Adapun yang menjadi
faktor utama yang menyebabkan terjadinya perang salib diantaranya:
a. Faktor agama
Sejak Dinasti Saljuk merebut Baitul Maqdis dari tangan Dinasti Fathimiyah
pada tahun 1070 M, pihak Kristen merasa tidak bebas lagi menunaikan ibadah ke
sana karena penguasa Saljuk menetapkan sejumlah peraturan yang dianggap
mempersulit mereka yang hendak melaksanakan ibadah ke Baitul Maqdis.
b. Faktor politik
Kekalahan Bizantium sejak 330 disebut Konstantinopel (Istanbul) di
Manzikart, wilayah Armenia, pada tahun 1071 dan jatuhnya Asia Kecil ke bawah
kekuasaan Saljuk telah mendorong Kaisar Alexius I Comnenus (kaisar
Konstantinopel) untuk meminta bantuan kepada Paus Urbanus II (1035-1099); dalam
usahanya untuk mengembalikan kekuasaannya di daerah pendudukan Dinasti Saljuk.
Paus Urbanus II bersedia membantu Bizantium karena adanya janji Kaisar Alexius
untuk tunduk di bawah kekuasan Paus di Roma dan harapan untuk dapat
mempersatukan gereja Yunani dan Roma. Pada waktu itu Paus memiliki kekuasan
dan pengaruh yang sangat besar terhadap raja yang berada di bawah kekuasaannya.
Ia dapat menjatuhkan sanksi kepada raja yang membangkang terhadap perintah Paus
dengan mencopot pengakuannya sebagai raja. Di lain pihak, kondisi kekuasaan Islam
pada waktu itu sedang melemah sehingga orang Kristen di Eropa berani untuk ikut
mengambil bagian dalam perang salib.
c. Faktor sosial ekonomi
Para pedagang besar yang beraada di pantai Timur Laut Tengah terutama yang
berada di kota Venesia, Genoa, dan Pisa, berambisi untuk menguasai sejumlah kota
dagang di sepanjang pantai timur dan selatan Laut Tengah untuk memperluas
jaringan dagang mereka. Untuk itu mereka rela menanggung sebagian dana perang
salib dengan maksud menjadikan kawasan tersebut sebagai pusat perdagangan
mereka apabila pihak Kristen Eropa memperoleh kemenangan. Di samping itu,
stratifikasi sosial masyarakat Eropa ketika itu terdiri dari tiga kelompok, yaitu kaum
gereja, kaum bangsawan, serta kesatria, dan rakyat jelata. Meskipun merupakan
masyoritas dalam masyarakat, kelompok terakhir ini menempati kelas yang paling
rendah. Kehidupan mereka sangat tertindas dan terhina, mereka harus tunduk kepada
para tuan tanah yang sering bertindak semena-mena dan dibebani berbagai pajak
serta sejumlah kewajiban lainnya. Oleh karena itu, ketika mereka dimobilisasi oleh
pihak-pihak gereja untuk turut mengambil bagian dalam perang salib dengan janji
akan diberikan kebebasan dan kesejahteraan yang lebih baik apabila perang dapat
dimenangkan, mereka menyambut seruan itu secara spontan dengan melibatkan diri
dalam perang tersebut.
C. Mongol
a. Motivasi Serangan Mongol
Serangan-serangan yang dilakukan oleh Mongol memiliki latar belakang yang
menjadi motivasi mereka untuk melakukan penyerang tersebut. beberapa hal yang
menjadi motivasi bagi Mongol untuk melakukan serangan, sebagai berikut:
1. Faktor Politik
Pada tahun 615 H. sekitar 400 orang pedagang bangsa Tartar dibunuh atas
persetujuan wali (gubernur) Utrar. Barang dagangan mereka dirampas dan dijual
kepada saudagar Bukhara dan Samarkand dengan tuduhan mata-mata Mongol.
Tentu saja hal ini menimbulkan kemarahan Jenghis Khan. Jenghis Khan
mengirimkan pasukan kepada Sultan Khawarizmi untuk meminta agar wali Utrar
diserahkan sebagai ganti rugi kepadanya. Utusan ini juga dibunuh oleh
Khawarizmi Syah sehingga Jenghis Khan dengan pasukannya melakukan
penyerangan terhadap wilayah Khawarizmi.
2. Motif Ekonomi
Motif ini diperkuat oleh ucapan Jenghis Khan sendiri, bahwa penaklukan-
penaklukan dilakukannya adalah semata-mata untuk memperbaiki nasib
bangsanya, menambah penduduk yang masih sedikit, membantu orang-orang
miskin dan yang belum berpakaian. Sementara di wilayah Islam rakyatnya
makmur, sudah berperadaban maju, tetapi kekuatan militernya sudah rapuh.
3. Tabiat Orang Mongol yang Suka Mengembara
Tabiat mereka yang suka mengembara, diundang ataupun tidak diundang
mereka akan datang juga menjarah dan merampas harta kekayaan penduduk
dimana mereka berdiam. Penyerangan-penyerangan yang dilakukan oleh Jenghis
Khan dengan pasukan perangnya yang terorganisir, berusaha memperluas wilayah
kekuasaan dengan melakukan penaklukan. Para ahli pertukangan mereka bawa
dalam pasukan batalion Zeni (yon-zipur) untuk membuat jembatan dan menjamin
melancarkan transportasi dalam penyerangan. Para tawanan perang dimanfaatkan
secara paksa untuk memanggul perlengkapan perang dan makanan. Strategi
perang Jenghis Khan yang tidak ketinggalan juga adalah membariskan penduduk
sipil yang telah kalah di depan tentara sebagai tameng untuk menggetarkan
musuh. Di samping itu, Jenghis Khan membawa penasehat yang terdiri dari para
rahib dan tukang ramal.
b. Penyerangan Mongol dan Wilayah Kekuasaannya
Pada tahun 607 H./1211 M. Jenghis Khan meluaskan wilayahnya. Ia berhasil
merebut Cina Utara dan mendirikan ibu kota Qaraqorun, lalu menduduki Siangkiang.
Penyerangan ke wilayah Islam dimulai melalui daerah Khawarizmi pada tahun 606
H/1209 M. Daerah yang menjadi tujuan utama mereka adalah Turki, Ferghana dan
Samarkand, karena daerah ini yang berdekatan dan yang berkasus dengan mereka.
Sewaktu bangsa Mongol memasuki wilayah Khawarizmi, sultan Alauddin sudah siap
untuk memukul mundur pasukan Mongol. Pasukan Mongol kembali ke negeri asal
mereka untuk melatih pasukannya dengan intensif. Sewaktu mereka kembali ke daerah
Khawarizmi 10 tahun kemudian, sudah banyak perubahan terhadap pasukannya, sehingga
mereka bisa memasuki Bukhara, Samarkand, Khurasan, Hamadzan, Quzwain dan sampai
ke perbatasan Irak. Di Bukhara, ibu kota Khawarizmi, mereka kembali mendapat
perlawanan dari sultan Alauddin, tetapi kali ini mereka dengan mudah dapat
mengalahkan pasukan Khawarizmi. Sultan Alauddin tewas dalam pertempuran di
Mazindaran tahun 1220 M. Ia digantikan oleh putranya Jalaluddin yang kemudian
melarikan diri ke India karena terdesak dalam pertempuran di dekat Attock tahun 1224
M. Dari sana pasukan Mongol terus ke Azerbeijan. Penaklukkan Bukhara ini disebutkan
oleh Jenghis Khan sebagai bencana dari Tuhan yang dikirimkan sebagai hukuman atas
orang-orang yang berdosa.
Di Bukhara, sangat terkenal karena penduduknya yang taat dan ber-pengetahuan.
Orang-orang Mongol menempatkan kuda mereka di sekeliling masjid yang suci dan
menyobek-nyobek al-Qur’an untuk dibuang di tempat sampah, penduduk yang tidak
dibantai diambil sebagai tawanan. Begitulah nasib kota Samarkand, Balkh dan kota-kota
yang lainnya di Asia Tengah, yang merupakan tempat kebudayaan Islam yang tinggi,
tempat tinggal orang-orang terkemuka dan pusat ilmu pengetahuan.
Sepulangnya ke Ibu Kota Karaqorun, ia menumpas pemberontakan di wilayah Ala
Shan dan Kausu, lalu meninggal dunia dan dikebumikan di tempat asalnya, Deligun
Buldak. Namun, sebelum Jenghis Khan meninggal pada tahun 624 H./1227 M, pada saat
kondisinya mulai lemah, dia membagi wilayah kekuasaannya menjadi empat bagian
kepada empat orang putranya, yaitu Juchi, Chagatai, Ogotai dan Tuli.
Juchi anaknya yang sulung mendapat wilayah Siberia bagian barat dan stepa
Qipchaq yang membentang hingga ke Rusia Selatan, di dalamnya terdapat Khawarizmi.
Namun ia meninggal dunia sebelum wafat ayahnya, Jenghis Khan, dan wilayah
warisannya itu diberikan kepada anak Juchi yang bernama Batu dan Orda. Batu
mendirikan Horde (Kelompok) Biru di Rusia Selatan sebagai pilar dasar berkembangnya
Horde Keemasan (Golden Horde). Sedangkan Orda mendirikan Horde Putih di Siberia
Barat. Kedua kelompok itu bergabung dalam abad keempatbelas yang kemudian muncul
sebagai kekhanan yang bermacam ragamnya di Rusia, Siberia dan Turkistan, termasuk di
Crimea, Astarakhan, Qazan, Qasimov, Tiumen, Bukhara dan Khiva. Syaibaniyah atau
Ozbeg. Salah satu cabang keturunan Juchi berkuasa di Khawarazmi dan Transoxania
dalam abad kelima belas dan enam belas. Golden Horde selanjutnya berkembang menjadi
kerajaan Mongol Islam pertama, yaitu pada saat diperintah oleh Barka Khan (anak dari
Batu). Wilayahnya meliputi Eropa Timur (Rusia dan Finlandia) dan Eropa Tengah dan
padang-padang stepa yang luas, dan beribukota di Lembah Wolga (Sarai). Dalam suatu
riwayat disebutkan bahwa Najmuddin Mukhtar az-Zahidi menyusun risalah untuk Barka
Khan. Risalah tersebut mengulas tentang kebenaran ajaran Islam dan kelemahan ajaran
Nasranai, dengan dalail dan bukti yang logis, dapat diterima akal. Hal inilah yang
membuat Barka Khan masuk Islam.
Chagatai ditugasi untuk menguasai daerah Illi, Ergana, Ray, Hamazan dan
Azerbeijan. Sultan Khawarizmi, Jalaluddin berusaha keras untuk merebut kembali
daerah-daerah yang dikuasai oleh Mongol ini, namun dia tidak sanggup menghadapi
serangan Chagatai. Sultan melarikan diri ke arah pegunungan, tetapi malang padanya,
seorang Kurdi membunuhnya. Dengan kematian Sultan Jalaluddin ini berakhirlah dinasti
Khawarizmi. Dengan demikian Chagatai lebih leluasa mengembangkan wilayah
kekuasaannya.
Ogotai adalah putra Jenghis Khan yang terpilih oleh Dewan Pemimpin Mongol
untuk menggantikan ayahnya sebagai Khan Agung yang mempunyai wilayah di Pamirs
dan Tien Syan. Tetapi dua generasi Kekhanan Tertinggi jatuh ke tangan keturunan Tuli.
Walaupun demikian cucu Ogotai yang bernama Qaydu dapat mempertahankan
wilayahnya di Pamirs dan Tien Syan, mereka berperang melawan anak turun Chagatay
dan Kubilai Khan, hingga meninggal dunia tahun 1301. Ogotai pada tahun 1234 dapat
menaklukkan Peking (sekarang Beijing) dan pada tahun 1240 dapat masuk kota Moskow.
Tuli (Toluy) anak terakhir Jenghis Khan ini mendapat bagian wilayah Mongolia
sendiri. Anak-anaknya, yakni Mongke dan Kubilai menggantikan Ogotai sebagai Khan
Agung. Mongke bertahan di Mongolia yang beribu kota di Qaraqorun. Sedangkan
Kubilai Khan menaklukkan Cina dan berkuasa di sana yang dikenal sebagai dinasti Yuan
yang memerintah hingga abad keempat belas, yang kemudian digantikan oleh dinasti
Ming. Mereka memeluk agama Budha yang berpusat di Beijing, dan mereka akhirnya
bertikai melawan saudara-saudaranya dari khan-khan Mongol yang beragama Islam di
Asia Barat dan Rusia (Kerajaan Golden Horde). Adalah Hulagu Khan, saudara Mongke
Khan dan Kubilai Khan, yang menyerang wilayah-wilayah Islam sampai ke Baghdad.
Pada tahun 1253, Hulagu Khan bergerak dari Mongol memimpin pasukan
berkekuatan besar untuk membasmi kelompok Pembunuh (Hasyasyin) dan menyerang
kekhalifahan Abbasiyah. Inilah gelombang kedua yang dilakukan bangsa Mongol.
Mereka menyapu bersih semua yang mereka lewati dan yang menghadang perjalanan
mereka; menyerbu semua kerajaan kecil yang berusaha tumbuh di atas puing-puing
imperium Syah Khawarizm. Hulagu mengundang Khalifah al-Musta’shim (1242-1258)
untuk bekerjasama menghancurkan kelompok Hasyasyin Ismailiyah. Tetapi undangan itu
tidak mendapat jawaban. Pada 1256, sejumlah besar benteng Hasyasyin, termasuk “puri
induk” di Alamut, telah direbut tanpa sedikit pun kesulitan, dan kekuatan kelompok yang
ketakutan itu hancur lebur. Bahkan lebih tragis lagi, bayi-bayi disembelih dengan kejam.
Pada bulan September tahun berikutnya, tatkala merangsek menuju jalan raya Khurasan
yang termasyhur, Hulagu mengirimkan ultimatum kepada khalifah agar menyerah dan
mendesak agar tembok kota sebelah luar diruntuhkan. Tetapi khalifah tetap enggan
memberikan jawaban. Pada Januari 1258, anak buah Hulagu bergerak dengan efektif
untuk meruntuhkan tembok ibukota. Tak lama kemudian upaya mereka membuahkan
hasil dengan runtuhnya salah satu menara benteng.
Khalifah al-Musta’shim benar-benar tidak dapat membendung “topan” tentara
Hulagu Khan. Pada saat yang kritis itu, wazir khalifah Abbasiyah, Ibn al-‘Alqami ingin
mengambil kesempatan dengan menipu khalifah. Ia mengatakan kepada khalifah, “Saya
telah menemui mereka untuk perjanjian damai. Raja (Hulagu Khan) ingin mengawinkan
anak perempuannya dengan Abu Bakar, putera khalifah. Dengan demikian, Hulagu Khan
akan menjamin posisimu. Ia tidak menginginkan sesuatu kecuali kepatuhan, sebagaimana
kakek-kakekmu terhadap sultan-sultan Seljuk”.
Khalifah menerima usul itu. Ia keluar bersama beberapa orang pengikut dengan
membawa mutiara, permata dan hadiah-hadiah berharga lainnya untuk diserahkan kepada
Hulagu Khan. Hadiah-hadiah itu dibagi-bagikan Hulagu kepada para panglimanya.
Keberangkatan khalifah disusul oleh para pembesar istana yang terdiri dari ahli fikir dan
orang-orang terpandang. Tetapi, sambutan Hulagu Khan sungguh di luar dugaan khalifah.
Apa yang dikatakan wazirnya ternyata tidak benar. Mereka semua, termasuk wazir
sendiri, dibunuh dengan leher dipancung secara bergiliran. Dengan pembunuhan kejam
ini, berakhirlah kekuasaan Abbasiyah di Baghdad. Kota Baghdad sendiri dihancurkan
rata dengan tanah, sebagaimana kota-kota lain yang dilalui tentara Mongol tersebut.
Peristiwa ini terjadi pada tanggal 10 Pebruari 1258. Dengan demikian, untuk pertama
kalinya dalam sejarah, dunia muslim terbengkalai tanpa khalifah yang namanya biasa
disebut dalam salat Jum’at.
Walaupun sudah dihancurkan, Hulagu Khan memantapkan kekuasaannya di
Baghdad selama dua tahun, sebelum melanjutkan gerakan ke Syiria dan Mesir. Dari
Baghdad pasukan Mongol menyeberangi sungai Euphrat menuju Syiria, kemudian
melintasi Sinai, Mesir. Pada tahun 1260 mereka berhasil menduduki Nablus dan Gaza.
Panglima tentara Mongol, Kitbugha, mengirim utusan ke Mesir meminta supaya Sultan
Qutuz yang menjadi raja kerajaan Mamalik di sana menyerah. Permintaan itu ditolak oleh
Qutuz, bahkan utusan Kitbugha dibunuhnya.
Tindakan Qutuz ini menimbulkan kemarahan di kalangan tentara Mongol.
Kitbugha kemudian melintasi Yordania menuju Galilie. Pasukan ini bertemu dengan
pasukan Mamalik yang dipimpin langsung oleh Qutuz dan Baybars di ‘Ain Jalut.
Pertempuran dahsyat terjadi, pasukan Mamalik berhasil menghancurkan tentara Mongol,
3 September 1260.
Baghdad dan daerah-daerah yang ditaklukkan Hulagu selanjutnya diperintah oleh
dinasti Ilkhan. Daerah yang dikuasai dinasti ini adalah daerah yang terletak antara Asia
Kecil di barat dan India di timur, dengan ibukotanya Tabriz. Umat Islam, dengan
demikian, dipimpin oleh Hulagu Khan. Hulagu meninggal tahun 1265 dan diganti oleh
anaknya, Abaga (1265-1282) yang masuk Kristen. Pada masa Abaga bangsa dinasti
Ilkhan bersekutu dengan orang-orang Salib, penguasa Kristen Eropa, Armenia Cicilia
untuk melawan Mamluk dan keturunan saudara-saudaranya dari dinasti Horde Keemasan
(Golden Horde) yang telah bersekutu dengan Mamluk, penguasa muslim yang berpusat
di Mesir. Dari sini tampak bahwa adanya hubungan erat antara orang-orang Mongol
dengan orang-orang Nasrani yang ingin menghancurkan Islam.
Ahmad Teguder (1282-1284), raja ketiga dinasti Ilkhan yang pertama kali masuk
Islam. Karena masuk Islam, Ahmad Teguder ditantang oleh pembesar-pembesar kerajaan
yang lain. Akhirnya, ia ditangkap dan dibunuh oleh Arghun yang kemudian
menggantikannya menjadi raja (1284-1291). Raja dinasti Ilkhan yang keempat ini sangat
kejam terhadap umat Islam. Banyak di antara mereka yang dibunuh dan diusir.
Selain Teguder, Mahmud Ghazan (1295-1304), raja yang ketujuh, dan raja-raja
selanjutnya adalah pemeluk agama Islam. Dengan masuk Islamnya Mahmud Ghazan —
sebelumnya beragama Budha— Islam meraih kemenangan yang sangat besar terhadap
agama Syamanisme. Sejak itu pula orang-orang Persia mendapatkan kemerdekaannya
kembali. Dari sini terlihat bahwa meskipun wilayah Islam secara politis telah ditaklukkan
dan dikuasai oleh dinasti Ilkhan, tetapi akhirnya Mongol sendiri terserap ke dalam kultur
Islam. Sehingga para raja-raja dinasti Ilkhan akhirnya memeluk agama Islam.
Berbeda dengan raja-raja sebelumnya, Ghazan mulai memperhatikan per-
kembangan peradaban. Ia seorang pelindung ilmu pengetahuan dan sastra. Ia amat gemar
kepada kesenian terutama arsitektur dan ilmu pengetahuan seperti astronomi, kimia,
mineralogi, metalurgi dan botani. Ia membangun semacam biara untuk para darwis,
perguruan tinggi untuk mazhab Syafi’i dan Hanafi, sebuah perpustakaan, observatorium,
dan gedung-gedung umum lainnya. Ia wafat dalam usia muda, 32 tahun, dan digantikan
oleh Muhammad Khubanda Uljeitu (1304-1317), seorang penganut Syi’ah yang ekstrim.
Ia mendirikan kota raja Sultaniyah, dekat Zanjan.
c. Dampak Invasi Mongol
Dampak negatif yang ditimbulkan oleh bangsa Mongol ternyata lebih banyak lagi
daripada dampak positif yang ditimbulkan. Dampak negatif yang ditimbulkan yaitu
kehancuran yang tampak jelas dari wilayah timur hingga ke barat. Kehancuran kota-kota
dengan bangunan-bangunan yang indah dan perpustakaan-perpustakaan yang mengoleksi
banyak buku memperburuk umat Islam. Pembunuhan terhadap umat Islam yang tak
berdosa. Yang lebih fatal lagi hancurnya Baghdad sebagai pusat dinasti Abbasiyah yang
di dalamnya terdapat berbagai macam tempat belajar dengan fasilitas perpustakaan,
hilang lenyap dibakar oleh Hulako Khan. Suatu kerugian besar bagi khazanah ilmu
pengetahuan.
Adapula dampak positif dengan berkuasanya dinasti Mongol setelah para
pemimpinnya memeluk agama Islam, yaitu seperti yang dilakukan oleh Ghazan Khan
(1295-1304) yang menjadikan Islam sebagai agama resmi kerajaan, walau ia pada
awalnya beragama Budha.

PERADABAN ISLAM PADA DINASTI USMANI


A. Peradaban Islam Pada Dinasti Usmani
Sejak masa Usmani bin Arthagol (1299-1326 M) yang dianggap pembina pertama
kerajaan Turki Usman. Turki membawa pengaruh cukup baik dalam bidang ekspansi agama
Islam ke Eropa. Kemajuan lainnya antara lain dalam bidang militer dan pemerintahan,
bidang militer dan pemerintahan, bidang ilmu pengetahuan dan budaya serta dalam bidang
keagamaan.
Dalam perkembangannya Turki cukup berpengaruh dalam bidang peradaban Islam
dengan corak peradaban yang khas. Pengaruh budaya tersebut sampai ke berbagaai wilayah
Turki Usmani yang wilayahnya begitu luas dalam dunia Islam.
1. Bidang Pemerintahan dan Militer
Para pemimpin kerajaan Usmani pada masa-masa pertama adalah orang-orang
yang kuat, sehingga kerajaan dapat melakukan ekspansi dengan cepat dan luas. Meskipun
demikian, kemajuan kerajaan Usmani sehingga mencapai masa keemasannya itu, bukan
semata-mata karena keunggulan politik para pemimpinnya. Masih banyak faktor lain
yang mendukung keberhasilan ekspansi itu. diantaranya adalah keberanian, keterampilan,
ketangguhan dan kekuatan militernya yang sanggup bertempur kapan saja.
Pada abad ke-16 angkatan laut Turki Usmani mencapai puncak kejayaannya.
Kekuatan militer Turki Usmani yang tangguh itu dengan cepat dapat menguasai wilayah
yang sangat luas, baik di Asia, Afrika, maupun di Eropa. Faktor utama yang mendorong
kemajuan di lapangan militer ini adalah tabiat bangsa Turki itu sendiri yang bersifat
militer, berdisiplin dan patuh terhadap peraturan. Tabiat ini merupakan tabiat alami yang
mereka warisi dari nenek moyangnya di Asia Tengah.
Keberhasilan ekspansi tersebut di barengi dengan terciptanya jaringan pemerintah
yang teratur. Dalam mengelola pemerintahan yang luas, sultan-sultan Turki Usmani
senantiasa bertindak tegas. Dalam struktur pemerintahan, Sultan sebagai penguasa
tertinggi, dibantu oleh Shadr Al-A’zham (perdana menteri) yang membawahi Pasya
(gubernur). Gubernur mengepalai daerah tingkat I. Dibawahnya terdapa beberapa orang
Az-Zanaziq atau Al-Alawiyah (bupati).
Untuk mengatur urusan pemerintahan negera, di masa Sultan Sulaiman I di susun
sebuah kitab undang-undang (Qanun). Kitab tersebut diberi nama Multaqa Al-Abhur
yang menjadi pegangan hukum bagi kerajaan Turki Usmani sampai datangnya reformasi
pada abad ke-19. Karena jasa Sultan Sulaiman I yang amat berharga ini, di ujung
namanya di tambah gelar Sultan Sulaiman Al-Qanuni. Kemajuan dalam bidang
kemiliteran dan pemerintahan ini membawa dinasti Turki Usmani mampu membawa
Turki Usmani menjadi sebuah negara cukup disegani pada masa kejayaannya.
2. Bidang Ilmu Pengetahuan
Peradaban Turki Usmani merupakan perpaduan bermacam-macam peradaban,
diantaranya adalah peradaban Persia, Bizantium dan Arab. Dari peradaban Persia, mereka
banyak mengambil ajaran-ajaran tentang etika dan tata krama dalam istana raja-raja.
Organisasi pemerintahan dan kemiliteran banyak mereka serap dari Bizantium.
Sedangkan ajaran tentang prinsip-prinsip ekonomi, sosial, kemasyarakatan dan ilmuan
mereka terima dari orang-orang Turki Usmani yang dikenal bangsa yang senang dan
mudah berasimilasi yang dikenal dengan bangsa asing dan terbuka untuk menerima
kebudayaan dari luar. Sebagai bangsa berdarah militer, Turki Usmani lebih banyak
memfokuskan kegiatan mereka dalam bidang kemiliteran, sementara dalam bidang ilmu
pengetahuan mereka tampak tidak begitu menonjol. Karena itulah dalam khazanah
intelektual Islam kita tidak menemukan ilmuwan terkemuka dari Turki Usmani.
3. Bidang Kebudayaan
Dalam bidang kebudayaan Turki Usmani banyak muncul tokoh-tokoh penting
seperti yang terlihat pada abad ke-16, 17 dan 18. Antara lain abad ke-17, muncul penyair
yang terkenal yaitu Nafi’ (1582-1636 M). Nafi’ bekerja untuk Murad Pasya dengan
menghasilkan karya-karya sastra Kaside yang mendapat tempat dihati para Sultan.
Dalam bidang sastra prosa kerajaan Usmani melahirkan dua tokoh terkemukan
yaitu Ktip Celebi dan Evliya Celebi. Yang terbesar dari semua penulis adalah Haji Halife
(1609-1657 M). Ia menulis buku bergambar dalam karya terbesarnya Kasyf Az-Znun fi
Asmai Al-Kutub wa Al-Funun, sebuah presentasi biografi penulis-penulis penting di
berbahasa Turki, Persia dan Arab, ia pun menulis buku-buku yang lain.
Salah seorang penyair diwan yang paling terkenal adalah Muhammad Esat Efendi
yang dikenal dengan Galip Dede atau Syah Galip (1757-1799 M). Adapun di bidang
pengembangan seni arsitektur islam, pengaruh Turki sangat dominan misalnya bangunan-
bangunan masjid yang indah, seperti masjid Al-Muhammadi atau masjid Sultan
Muhammad Al-Fatih, masjid Agung Sultan Sulaiman dan masjid Aya Shopia yang
berasal dari sebuah gereja.
Dalam hal pembangunan dan seni arsitek, Turki Usmani telah menghasilkan
keindahan-keindahan yang tinggi nilainya dan bercorak khusus, sehingga membedakan
dengan peradaban dan kebudayaan daulah Islam lainnya.
4. Bidang Keagamaan
Agama dalam tradisi masyarakat Turki mempunyai peranan besar dalam lapangan
sosial dan politk. Masyarakat digolong-golongkan berdasarkan agama, dan kerajaan
sendiri sangat terikat dengan syariat sehingga fatwa ulama menjadi hukum yang berlaku.
Kajian mengenai ilmu keagamaan Islam, seperti fiqh, ilmu kalam, tafsir dan hadis boleh
dikatakan tidak mengalami perkembangan yang berarti. Para penguasa lebih cenderung
untuk menegakkan satu faham keagamaan. Akibat kelesuan di bidang ilmu agama dan
fanatik yang berlebihan maka ijtihad tidak berkembang. Ulama hanya menulis buku
dalam bentuk syarah dan hasyiyah terhadap karya-karya klasik.
5. Bidang Ekonomi
Tercatat beberapa kota yang maju dalam bidang industri pada waktu itu seperti
Mesir sebagai pusat produksi kain sutra dan katun kemudian Anatoli selain sebagai pusat
produksi bahan tekstil dan kawasan pertanian yang subur, juga menjadi pusat
perdagangan dunia pada saat itu.
B. Kemunduran Kerajaan Dinasti Usmani
Setelah Sultan Sulaiman Al-Qanuni wafat (1566 M), kerajaan Turki Usmani
memulai memasuki fase kemunduran. Akan tetapi, sebagai sebuah kerajaan yang sangat
besar dan kuat, kemunduran itu tidak langsung terlihat. Sultan Sulaiman Al-Qanuni
diganti oleh Sultan Salim II (1566-1573 M) dimasa pemerintahannya terjadi
pertempuran, Pertempuran ini terjadi di Selat Liponto (Yunani).
Dalam pertempuran ini, Turki Usmani mengalami kekalahan yang
mengakibatkan Tunisia dapat direbut oleh musuh. Baru pada masa Sultan berikutnya,
Sultan Murad III, pada tahun 1575 M Tunisia dapat direbut kembali, Pada masa Sultan
Murad III (1574-1595 M) kerejaan Usmani pernah berhasil menyerbu Kaukasus dan
menguasai Tiflis di laut Hitam (1577 M), Namun, karena kehidupan moral Sultan yang
tidak baik menyebabkan timbulnya kekacauan dalam negeri. Apalagi ketika
pemerintahan dipegang oleh para Sultan yang lemah seperti Sultan Muhammad III (1595-
1603 M). Dalam situasi yang kurang baik itu, Austria berhasil memukul kerajaan
Usmani.
Dengan demikian, pemberontakan-pemerontakan yang terjadi di kerajaan Usmani
ketika ia sedang mengalami kemunduran, bukan hanya terjadi di daerah-daerah yang
tidak beragama Islam seperti di wilayah Eropa Timur, tetapi juga terjadi di daerah-daerah
yang berpenduduk muslim. Pada sumber lain dikatakanbahwa faktor-faktor yang
menyebabkan kerajaan Turki Usmani mengalami kemunduran adalah sebagai berikut :
1. Terjadinya stagnasi dalam lapangan ilmu dan teknologi
2. Heteroginitas penduduk
3. Wilayah kekuasaan yang sangat luas
4. Kelemahan para penguasa
5. Budaya korupsi
6. Terjadinya Pemberontakan
7. Merosotnya perekonomian

PERADABAN ISLAM DI PERSIA


SAFAWI
A. Kekuasaan Safawiyah
Kerajan Safawi bermula dari gerakan tarekat yang berdiri di Ardabil, sebuah kota di
Azerbaijan. Tarekat ini diberi nama Safawiyah karena pendirinya bernama Syech Safuyudin
Ishaq (1252-1334) seorang guru agama yang lahir dari sebuah keluaraga Kurdi di Iran Utara.
Beliau merupakan anak murid seorang imam Sufi yiaitu Sheikh Zahed Gilani (1216–1301,
dari Lahijan.) Safi Al-Din kemudiannya menukar Ajaran Sufi ini kepada Ajaran Safawiyah
sebagai tindak balas kepada pencerobohan tentera Mongol di wilayah Azerbaijan
Pada mulanya gerakan tasawuf Safawiyah ini bertujuan untuk memerangi orang-orang
ingkar dan golongan Ahl al-Bid’ah Namun pada perkembangannya, gerakan tasawuf yang
bersifat lokal ini berubah menjadi gerakan keagamaan yang mempunyai pengaruh besar.
Gerakan Safawi mewakili sebuah kebangkitan Islam Populer yang menentang dominasi
militer yang meresahkan dan bersifat eksploitatif, gerakan Safawiyah memprakarsai
penaklukan Iran dan mendirikan sebuah baru yang berkuasa dari 1501 sampai 1722. Sang
pendiri mengawali gerakannya dengan seruan untuk memurnikan dan memulihkan kembali
ajaran Islam.
Kerajaan Safawi mempunyai perbedaan dari dua kerjaan besarislam lainnya seperti
kerajan Turki Usmani dan Mughal. Kerajaan ini menyatakan sebagai penganut Syi’ah dan
dijadikan madzhab Negara. Oleh karena itu, kerajaan Safawi dianggap sebagai peletak dasar
pertama terbentuknya Negara Iran dewasa ini.
Dalam perkembangannya Bangsa Safawi (tarekat Safawiyah) sangat fanatik
terhadapajaran-ajarannya. Hal ini ditandai dengan kuatnya keinginan mereka untuk berkuasa
karena dengan berkuasa mereka dapat menjalankan ajaran agama yang telah mereka yakini
(ajaran Syi’ah). Karena itu, lama kelamaan murid-murid tarekat Safawiyah menjadi tentara
yang teratur, fanatik dalam kepercayaan dan menentang setiap orang yang bermazhab selain
Syiah.
Gerakan Militer Safawi yang dipimpin oleh Haidar di pandang sebagai rival politik
olehAK Koyunlu setelah ia menang dari Kara Koyunlu (1476 M). Karena itu, ketika
Safawimenyerang wilayah Sircassia dan pasukan Sirwan, AK Koyunlu mengirimkan
bantuanmiliter kepada Sirwan, sehingga pasukan Haidar kalah dan ia terbunuh.
Ali, putera dan pengganti Haidar, didesak bala tentaranya untuk menuntut balas
ataskematian ayahnya, terutama terhadap AK Koyunlu. Akan tetapi Ya’kub pemimpin AK
Koyunlu menangkap dan memenjarakan Ali bersama saudaranya, Ibrahim, Ismail dan
ibunya di Fars (1489-1493 M). Mereka dibebaskan oleh Rustam, putera mahkota AK
Koyunlu dengan syarat mau membantunya memerangi saudara sepupunya. Setelah
dapatdikalahkan, Ali bersaudara kembali ke Ardabil. Namun, tidak lama kemudian Rustam
berbalik memusuhi dan menyerang Ali bersaudara dan Ali terbunuh (1494 M)
Periode selanjutnya, kepemimpinan gerakan Safawi di serahkan pada Ismail. Selama 5
tahun, Ismail beserta pasukannya bermarkas di Gilan untuk menyiapkan pasukan dan
kekuatan. Pasukan yang di persiapkan itu diberi nama Qizilbash (baret merah).
Pada tahun 1501 M, pasukan Qizilbash dibawah pimpinan Ismail menyerang dan
mengalahkan AK Koyunlu (domba putih) di sharur dekat Nakh Chivan. Qizilbash terus
berusaha memasuki dan menaklukkan Tabriz, yakni ibu kota AK Koyunlu dan akhirnya
berhasil dan mendudukinya. Di kota Tabriz Ismail memproklamasikan dirinya sebagai raja
pertama Dinasti Safawi. Ia disebut juga Ismail I
Ismail I berkuasa kurang lebih 23 tahun antara 1501-1524 M. Pada sepuluh tahun
pertama ia berhasil memperluas wilayah kekuasaannya, Buktinya ia dapat menghancurkan
sisa-sisa kekuatan AK Koyunlu di Hamadan (1503 M), menguasai propinsi Kaspia di
Nazandaran, Gurgan dan Yazd (1504 M), Diyar Bakr (1505-1507 M) Baghdad dan daerah
Barat daya Persia (1508 M), Sirwan (1509 M) dan Khurasan. Hanya dalam waktu sepuluh
tahun itu wilayah kekuasaannya sudah meliputi seluruh Persia dan bagian timur Bulan Sabit
Subur.
Safawiah menegaskan persekutuan meraka dengan Syi’ah dan Syah Ismail, menytakan
bahwa dirinya adalah sebagai sang imam tersembunyi,sebagai reinkarnasi dari Ali, dan
sebagai simbol wujud ketuhanan. Ismail mengkelaim sebagai keturunan dari imam ketujuh,
dan sebagai generasi ketujuh dalam garis keturunan Safawiah,dimana setiap imam secara
berurutan merupakan pembawa cahaya ketuhanan yang disampaikan dari satu generasi
kegenerasi yang lainnya. Dengan kecendrunganya kepada sin kereatisme relegius dari
beberapa gerakan sufi yangtelah berlangsung selama dua abad di Iran barat, dan dengan
menggabungkan beberapa pengaruh keagamaan yang berbeda beda, termasuk Syi’isme,
mesiannisme,Sunni dan Budhisme. Ismail juga menyatakan secara tegas bahwa dirinya
adalah reingkarnasi dari Khidir, pembawa kebijaksanaan masa lampau, dan sebagai ruh
Yesus. Dengan diterangi cahaya ketuhanan yangmana cahaya tersebut mendahului alquran
dan penciptaan alam semesta ini, yang diturunkan oleh keluarga nabi untuk ditubuhkan
didalam diri Ismail, maka ia menjadi seorang mesiah,Syah,pemilik kekuasaan temporal dan
sekaligus pemilik kerajaan mistikal. Berdasarkan beberapa klaim keagamaan ini, tokoh
tokoh Syafawiah menuntut sebuah kepatuan absolut dan tanpa keraguan absolut dari para
tokoh sufi mereka
Isma’il memberlakukan faham Syi’ah sebagai madzhab resmi negara. Untuk menerapkan
keinginannya ini ia kerap mendapat tantangan dari Ulama’ Sunni. Pertentangan ideologi
muncul akibat penerapan faham Syi’ah ini. Syah Isma’l tidak segan segan menerapkan
faham ini dengan tindakan kekerasan. Di Baghdad dan Herat, misalnya, Syah Isma’il
membunuh secara kejam para Ulama’ dan sastrawan sunni yang menolak ideologi Syi;ah.
Akibatnya hinga beberapa dekade kemudian para penganut Sunni di Kurasan, misalnya,
harus menyembunyikan identitas Sunni mereka atau mempraktekkan tradisi Sunninya secara
sembunyi-sembunyi.
Ima’il adalah orang yang sangat berani dan berbakat. Ambisi politiknya mendorong
untuk menguasai negara lain sampai Turki Usmani. Namun dalam peperangan ia dikalahkan
pasukan militer Turki yang lebih unggul dalam kemiliteran. Karena keunggulan militer
kerajaan Usmani, dalam peperangan ini Isma’il mengalami kekalahan, malah Turki Usmani
dibawah pimpinan Sultan Salim dapat menduduki Tabriz. Kerajaan Safawi terselamatkan
oleh pulangnya sultan Salim ke Turki karena terjadi perpecahan dikalangan militer Turki di
negrinya
Kekalahan akibat perang dengan Turki Usmani ini membuat Isma’il frustasi. Ia lebih
senang menyendiri, menempuh kehidupan hura-hura dan berburu. Keadan itu berdampak
negatif bagi kerajaan Safawi dan pada akhirnya terjadi persaingan dalam merebut pengaruh
untuk dapat memimpin kerajaan Safawi antara suku-suku Turki, pejabat keturunan Persia
dan Qizibash.
B. Hasil-Hasil Kebudayaan Safawiyah
Pada masa Safawi berkembang dua aliran filsafat. Pertama, aliran filsafat perifatetik
sebagaimana yang dikemukakan oleh Aristoteles dan Al-farabi. Kedua, filsafat Isyragi
yang dibawa oleh Suhrawardi pada abad XII. Kedua aliran ini banyak dikembangkan di
perguruan tinggi Isfahan dan Syiraz. Di bidang filsafat ini muncul beberapa nama filosof
di antaranya, Mir Damad alias Muhammad Baqir Damad (wafat 1631 M) yang diaggap
sebagai guru ketiga (mu’allim salis) sesudah Aristoteles dan Al-farabi. Hasil
perkembangan Kerajaan Safawiyah dari beberapa bidang :
1. Bidang Ekonomi
Stabilitas politik kerajaan Safawi masa Abbas memacu perkembangan ekonomi
safawi,terutama setelah kepulangan Hurmuz dan pelabuhan Gumrun yang diubah
menjadi Bandar Abbas. Dengan demikian Safawiyah menguasai jalur perdagangan
antara Barat dan Timur. Di samping sektor
perdagangan, Safawiyah juga mengalami kemajuan bidang pertanian, terutama
hasil pertanian dari daerah Bulan Sabit yang sangat subur (Fertille Crescent).
2. Bidang Ilmu Pengatahuan
Persia di kenal sebagai bangsa yang telah berperadaban tinggi dan berjasa
mengembangkan ilmu pengetahuan, sehingga tradisi keilmuan terus berlanjut.
3. Bidang Pembangunan Fisik dan Seni
Kemajuan ini ditandai dengan berdirinya sejumlah bangunan megah yang
memperindah Isfahan sebagai ibu kota kerajaan ini. Sejumlah masjid, sekolah,
rumah sakit, jembatan raksasa di atas Zende Rud dan Istana Chihil Sutun.Kota
Isfahan juga diperindah dengan kebun wisata yang tertata apik
DINASTI QAJAR
A. Perkembangan Dinasti Qojar
1. Agha Muhammad Khan (1779 – 1797)
Pada masa pemerintahan Agha Muhammad Khan, banyak disibukkan dengan
perluasan wilayah-wilayah kekuasaannya seperti propinsi Syiraz, Isfahan, Tabriz dan
Masyhad. Dia memusatkan kekuasaannya di Teheran sebagai ibu kotanya.
Ciri-ciri pada masa kekuasaan Aga Muhammad Khan
a. Kepemimpinan Negara didasarkan kepada adat istiadat kesukuan dengan melibatkan
secara langsung pemimpin Negara untuk membangun jaringan antarsuku.
b. Mengadakan kerjasama antarsuku guna memerangi suku lain yang menjadi
saingannya, sekaligus memperkuat kekuasaannya sendiri.
2. Fath Ali Syah (1797 – 1834)
Ciri-ciri pada masa kekuasaan Fath Ali Syah
Pengembangan birokrasi Negara pada seluruh level pemerintahan dengan Teheran
sebagai pusat kekuasaannya. Pembangunan angkatan bersenjata yang permanen.
Pemberlakuan etika kerajaan sebagaimana dipakai oleh kerajaan Persia Kuno.
Perkembangan dan perubahan birokrasi pemerintahan dan angkatan bersenjata
tersebut berkaitan erat dengan masuknya pengaruh Eropa ke Persia pada awal abad ke-
19. Namun, masuknya Negara-negara Eropa seperti Rusia dan Inggris memiliki misi
tertentu untuk menguasai daerah kekuasaan Qojar Persia. Pada tahun 1813, Dinasti Qojar
mengalami kekalahan perang dengan Rusia, sehingga harus menandatangani perjanjian
Gulistan yang menyatakan bahwa daerah Georgia, Kaukasus dan pengawasan pelayaran
Laut Kaspia menjadi daerah kekuasaan Rusia, yang sebelumnya menjadi kekuasaan
Dinasti Qojar. Hal tersebut menurunkan reputasi Dinasti Qojar di mata rakyat.
Rusia memperlakukan rakyat terutama para ulama dan penduduk muslim dengan
kejam di daerah Kaukasus, ini merupakan ancaman langsung terhadap eksistensi umat Islam
di Persia. Melalui mimbar khotbah dan pengajian, ulama mendesak pemerintah untuk
melaksanakan jihad melawan Rusia. Fath Ali Syah memenuhi tuntutan rakyat sehingga pada
tahun 1826 ia menyatakan perang melawan Rusia. Namun, untuk kedua kalinya Qojar
mengalami kekalahan dan harus menandatangani perjanjian Turkomanchai pada tahun 1828
yang menyatakan:
1. Propinsi Erivan dan Nakhichevan harus diserahkan kepada Rusia
2. Rusia mendapat konsesi tarif yang rendah di bidang perdagangan
3. Rusia mendapatkan rampasan perang yang banyak
4. Kebebasan memberlakukan hokum Rusia bagi orang Rusia yang berada di Kerajaan
Qojar.
3. Muhammad Syah (1834 – 1848)
Pengangkatan Muhammad Syah sebagai raja Dinasti Qojar berjalan lancar berkat
keterlibatan diplomatic Inggris dan Rusia. Bahkan inggris memberikan dukungan langsung
secara militer dalam rangka menindas gerakan oposisi suku-suku local terhadap tahta
kekuasaan Muhammad Syah. Dan sebagai imbalannya Muhammad Syah memberikan
konsesi di bidang tarif dan hak ekstra territorial pada tahun 1836 dan 1841, pimpinan Qojar
menandatangani pakta perjanjian. Pakta ini menguntungkan Inggris karena memperoleh
keistimewaan-kwiatimewaan sebagaimana diberikan penguasa Qojar sebelumnya kepada
Rusia.
Pada masa Muhammad Syah adalah perlawanan kelompok masyarakat Syi’ah
Ismailiyah di bawah pimpinan Aga Khan, di wilayah Iran tengah dan selatan. Namun, Dinasti
Qojar dengan bantuan militer Inggris dapat memukul mundur perlawanan tersebut. Di
samping itu juga ada gerakan perlawanan yang dikenal dengan gerakan Mesiah, Pendiri
gerakan ini adalah Sayid Ali Muhammad yang lahir di kota Syiraz pada tahun 1819. dalam
waktu yang relative singkat (1844 -1850). gerakan ini telah menjadi gerakan perlawanan
yang bersifat nasional dan telah menggoncang stabilitas politik Dinasti Qojar dan
kepentingan asing di dalam negeri Qojar. Di tengah situasi seprti ini, Muhammad Syah
meninggal dunia pada tahun 1848.
4. Nasiruddin Syah (1848 – 1896)
Di bawah perlindungan dan jaminan Inggris Rusia, Nasiruddin Syah, naik
menduduku tahta kerajaan dan menjadi penguasa Qojar yang paling lama berkuasa yakni dari
tahun 1848 sampai 1896. Awal kekuasaan Nasiruddin Syah disibukkan dengan
pemberontakan gerakan Mesiah. Pada tahun 1850 Nasiruddin dapat menangkap dan
mengeksekusi pimpinan gerakan Mesiah, Sayid Ali Muhammad, dengan dukungan dan
bantuan Inggris dan Rusia. Kesuksesan membasmi gerakan Mesiah tidak menjadikan Dinasti
Qojar semakin mandiri. Sebaliknya, Dinasti Qojar semakin terjerembak dalam kekangan
Inggris dan Rusia. Beberapa daerah kekuasaannya seperti Tashkent, Samarkand dan Bukhara
dicaplok oleh Rusia. Dan pada tahun 1857 Nasiruddin mengalami kekalahan perang dan
harus menandatangani perjanjian Paris yang menyatakan bahwa:
1. Qojar harus keluar dan membebaskan daerah Heart
2. Qojar harus mengakui kemerdekaan Afghanistan
3. Memberikan konsesi perdagangan yang lebih luas kepada Inggris.
Pada tahun 1872 Nasiruddin mengadakan kerjasama dengan perusahaan Baron de
Reuter dari Inggris untuk melakukan modernisasi dengan mengadakan perubahan-perubahan
diantaranya:
a. Di bidang Ekonomi
b. Di bidang Militer
Dengan demikian, periode ini merupakan masa awal yang berpengaruh besar pada
kebangkitan dunia pendidikan Iran di kemudian hari.
Pada tahun 1890, Nasiruddin memberikan konsesi kepada perusahaan Talbot dari
Inggris untuk memonopoli produksi, penjualan dan ekspor tembakau yang banyak ditanam
petani Iran. Modernisasi yang dilakukan oleh Nasiruddin Syah menimbulkan kebencian dan
perlawanan masyarakat. Para intelektual menyerang kediktatoran para penguasa dan praktek
korupsi yang meluas di kalangan penguasa. Kaum Bazari, memprotes atas konsensi yang
diberikan Syah kepada orang asing yang mengakibatkan mereka bangkrut dan kalah
bersaing. Para petani memprotaes rendahnya daya jual hasil pertaniannya. Dan para ulama
memandang bahwa kuatnya pengaruh asing akan membahayakan keberadaan agama Islam di
Iran.
Untuk membayar hutang Nasiruddin meminjam kepada Rusia. Hal tersebut membuat
kemarahan rakyat timbul kembali dan pada tahun 1896 Nasiruddin Syah akhirnya dibunuh
oleh salah seorang pengikut al-Afgani.
5. Muzaffaruddin Syah (1896 – 1907)

Di bawah pemerintahan Muzaffaruddin Syah, keadaan Dinasti Qojar semakin


melemah. Masa kekuasaannya lebih banyak diwarnai oleh perebutan pengaruh antara Inggris
dan Rusia, oposisi rakyat semakin kuat dan hutang yang semakin banyak.
Pada tahun 1900 Syah mendapat pinjaman dari Rusia sebesar 2.400.000 pound
sterling dan dua tahun kemudian 1902 menerima penjaman kembali sebesar 10.000.000
rubel. Hutang Syah yang meninggi, cengkeraman Rusia dan Inggris yang semakin kuat serta
memburuknya perekonomian rakyat membuat suhu kebencian oposisi rakyat terhadap
Dinasti Qojar semakin menaik. Situasi yang demikian membuat terwujudnya apa yang
dikenal dalam sejarah dengan “Revolusi Konstitusional (1905 – 1911).
Revolusi tersebut memaksa agar Muzaffaruddin mendirikan Majelis Nasional, yang
akhirnya didirikan pertama kali pada awal Agustus 1906 di Iran. Dengan kehadiran Majelis
Nasional tersebut kehidupan rakyat mengalami perubahan hingga meninggalnya
Muzaffaruddin Syah pada tahun 1907.
6. Muhammad Ali Syah (1907 – 1909)
Muhammad Ali Syah sangat membenci Majelis Nasional dan berambisi untuk
membubarkannya. Dengan menggunakan kekuaran militer dan dibantu oleh Rusia akhirnya
Syah dapat membekukan Majelis Nasional bahkan membunuh beberapa anggata Majelis
Nasional.
Kejadian tersebut membuat perlawanan rakyat meluas kembali dan menuntut agar
Majelis Nasional bentuk kembali. Pada tahun 1909 akhirnya Majelis Nasional dibentuk
kembali dan menuntut agar Muhammad Aki Syah Mundur dari jabatannya. Dan digantikan
oleh putranya.
7. Ahmad Syah (1909 – 1925)
Dinasti Qojar tidak mengalami kemajuan yang berarti di bawah pimpinan Ahmad
Syah. Bahkan sebaliknya, kesatuan kedaulatan Qojar terpecah-pecah, wilayah utara Iran di
bawah pengawasan Rusia, wilayah selatan di bawah pengawasan Inggris dan hanya wilayah
tengah yang sempit sebagai zona netral. Di tambah lagi selama perang dunia 1, Iran
digunakan sebagai salah satu medan pertempuran yang membuat Qojar semakin terpojok dan
mengalami kerusakan ekonomi yang parah.
Lemahnya kekuasaan pusat Dinasti Qojar dimanfaatkan oleh Reza Syah, seorang
militer karir, yang melakukan persiapan untuk mengambil alih kekuasaan. Dengan
menggalang aliansi bersama Kabinet Ziauddin dan Qawam as-Sultanah, posisi reza Syah
semakin kuat. Dengan dukungan militer yang terdidik secara modern dan terlatih, Reza Syah
kemudian mengontrol hamper seluruh birokrasi pemerintahan. Dan pada tahun 1925 Reza
berhasil mengahiri keberadaan Dinasti Qojar dengan memecat Ahmad Syah sebagai
penguasa terakhir. Sebagai gantinya, Reza memproklamirkan berdirinya Dinasti Pahlevi dan
ia sendiri menjadi raja yang pertama.
B. Kemajuan-Kemajuan Yang Dicapai Dinasti Qojar
Darul Funun didirikan di Teheran pada tahun 1851, Sekolah Politeknik yang
merupakan salah satu bagian dari modernisasi yang dicanangkan oleh Mirza Taqi Khan Amir
Kabir (Perdana Menteri Nassiruddin Qajar). Darul Funun merupakan lembaga pendidikan
yang cenderung sekuler, berbeda dengan lembaga-lembaga pendidikan yang dirikan
komunitas agama.
Darul Funun juga berfungsi sebagai pencetak tenaga militer yang baru dalam bidang
balistik (roket militer) dan teknik militer serta pegawai sipil. Demikian juga di bidang
pengobatan, ilmu pengetahuan dan matematika. Buku-buku Barat diterjemahkan ke dalam
Bahasa Persia, banyak pula majalah dan buku yang diterbitkan. Sekolah-sekolah missionaris
yang didirikan di Iran juga banyak mendatangkan teknik-teknik Barat ke Iran. Bahkan antara
tahun 1878 dan 1880 penasihat Rusia dan Austria turut membantu Iran dengan mengorganisir
kembali pasukan kaveleri dan membentuk Brigade Cossack (Kozak) .
C. Kemunduran Dan Keruntuhan Dinasti Qojar
Antara tahun 1891-1892 komunitas agama bersama dengan pedagang, intelektual
liberal serta para pegawai mengadakan demonstrasi besar-besaran dan memboikot monopoli
tembakau pada perusahaan Inggris. Para ulama memimpin demonstasi ini di berbagai kota
seperti Shiraz, Isfahan, Tabriz dan Mashad, yang terkenal dengan Pemberontakan Tembakau
(Tobacco Protest 1891-1892).
Peristiwa penting di Iran pada awal abad ke-20 selain ditemukannya sumber minyak
bumi adalah ”Revolusi Konstitusional". Peristiwa yang terjadi pada periode Dinasti Qajar ini
mengakhiri kekuasaan absolut raja. Revolusi ini merupakan bentuk gerakan nasionalisme
rakyat Iran pada abad ke-20.
Pada tahun 1925 Dinasti Qojar ditumbangkan oleh Dinasti Pahlevi. Terdapat faktor
internal dan eksternal yang menyebabkan hal ini terjadi. Faktor internal yang paling
menonjol adalah lemahnya pemerintahan pusat dan terjadinya pemberontakan-
pemberontakan lokal. Berbagai pemberontakan itu tidak mampu dibendung dan diredam oleh
pemerintahan pusat sebagai pengendali utama keamanan, semakin lama pemberontakan itu
menggerogoti kekuasaan Dinasti Qojar dan dimanfaatkan oleh kelompok-kelompok tertentu
untuk berlawanan dengan kekuasaan Dinasti Qojar.
Faktor eksternal yang muncul adalah pecahnya Perang Dunia I yang menjadikan Iran
sebagai arena pertempuran, walaupun secara politik posisi Iran dalam perang itu adalah
netral. Rusia ngotot untuk mempertahankan cadangan minyak di Baku dan Laut Kaspia.
Tentara Ru¬sia terlibat dalam pertempuran sengit dengan tentara Turki di Iran barat laut.
Imperialis Inggris, di pihak lain, mempertahankan kepentingan mereka di ladang minyak
Khuzistan. Situasi pelik dan kacau demikian itu menyulut Sayid Ziauddin Taba Tabai,
seorang politisi Iran, dan Reza Khan, seorang perwira kavaleri, memanfaatkan situasi untuk
melancarkan pemberontakan atas dinasti Qojar.

PERADABAN ISLAM DI ANAK BENUA INDIA DARI AWAL MASUKNUA ISLAM


HINGGA RUNTUHNYA DINASTI MUGHAL
A. Islam Masuk ke India.
Ketika umat islam dipimpin khalifah Umar bin al-Khattab, Islam telah masuk ke India.
Kesuksesan umat islam mencapai India ditandai dengan keberhasilan Muawiyah I merebut
lembah Sind di bawah pimpinan Muhallab bin Abi Sufrah yang maju dengan pasukan
besarnya dari Basrah pada tahun 663 M. Ekspedisi pasukan Islam ke India berikutnya terjadi
pada zaman al-Walid, di mana muhammad al-Qasim al-Tsaqaf (705 M), pada waktu itu atas
nama wali negeri Irak meneruskan ekspedisi Islam sebelumnya. Ada yang menyebutkan
bahwa tujuan al-Qasim ke India untuk membebaskan pedagang muslim yang dirampok oleh
kawanan perampok India yang waktu itu berada dalam perlindungan raja Dahar. Tetapi ada
juga yang menyebutkan bahwa ia ke India waktu itu adalah karena diutus oleh khalifah di
Damaskus (al-Walid) untuk memadamkan pemberontakan yang dilakukan oleh Zahir bin
Shasha, wali negeri Sind. Setelah al-Qasim berhasil memadamkan kudeta yang dilancarkan
oleh Zahir bin Shasha, al-Qasim kemudian diangkat menjadi wali negeri Sind.
Ketika pemerintahan umat Islam berpindah ke dinasti Abbasiyah, Khalifah al-Mansur
(760 M) juga melakukan ekspansi ke India, dia mengutus panglima Hisyam bin Amru al-
Tighlabi bersama pasukan dari Baghdad untuk memadamkan pemberontakan wali negeri
Sind, yaitu Uyainah bin Musa. Hal yang sama juga dilakukan oleh laksamana Abdul Malik
bin Syihab al-Masmai pada masa pemerinytahan khalifah al-Mahdi, ia berhasil merebut
bandar Veraval, Khatiawar. Sedang angkatan daratnya merebut bandar Gujarat, bandar
Broaeh dan menumbangkan dinasti Maitraka (766 H). Meskipun sudah dilakukan beberapa
kali ekspansi oleh umat Islam tetapi hal tersebut belum mampu mencapai pusat kekuasaan
negeri India tersebut.
B. Era Mughal di India.
1. Para Penguasa kerajaan Mughal.
a. Babur (1526-1530).
Secara umum babur dari pendapat sejarawan dapat dikatakan bahwa Babur
adalah pendiri dinasti Mughal. Babur adalah seorang Turki Chagahai yang masih
memiliki hubungan darah atau keturunan Timur Lenk. Pada tahun 1500, Babur
menjadi penguasa Farghanah yaitu menggantikan Ayahnya Umar mirza bin Abu
Said. Babur memiliki keinginan besar menguasai seluruh wilayah Asia tengah, namun
sempat terhalang oleh kekuasaan Syaibani di Uzbekistan, bahkan pada tahun 1504 ia
sempat kehilangan Farghanah. Itulah sebabnya ia kemudian menguasai Kabul.
Sebagai kompensasi atas kegagalannya menguasai tanah airnya sendiri, ia menerima
tawaran dari sebuah kelompok yang tidak puas terhadap Ibrahim Lodi. Sehingga pada
pertempuran Panipath (1525), ia memperoleh kemenangan atas Ibrahim Lodi dan
berhasil merebut Delhi.
Setelah berkuasa di wilayah Delhi, kemenangan demi kemenangan ekspansi
didapatkan oleh pasukan Babur. Selanjutnya pasukan Babur dapat menguasai Gogra
dan Bihar dari tangan Mahmud Lodi (saudara Ibrahim Lodi) pada 1529. Babur
meninggal dunia pada tahun 1530. Konon Babur kurang menyukai India dan sering
rindu kampung halamannya.
b. Shah Jahan (1627-1658).
Dalam catatan sejarah, Shah Jahan atau yang dikenal dengan Khurram adalah
seorang sultan yang suka bidang puisi dan arsitektur. Karenanya, hingga akhir
hayatnya ia dikenal sebagai seorang sultan yang romantis. Ia mengabadikan namanya
dan nama permaisurinya, yaitu Muntaz Mahal dalam makam Taz Mahal di Agra.
Pada masa pemerintahan Shah Jahan ini, sudah ada orang Portugis di India. Para
pemukim Portugis banyak yang telah menyalahgunakan kebaikan yang diberikan oleh
penguasa Mughal. Akhirnya Shah Jahan marah dan mengusir mereka, serta merebut
kembali tempat pemukiman mereka di Hughli Benggala (1632). Sayang sekali pada
masa akhir-akhir kekuasaanya, timbul fitnah antara kedua orang putera Shah Jah
c. Aurangzeb (1658-1707).
Dua bersaudara anak dari Shah Jahan, Aurangzeb dan Dara Shikah,
merupakan dua orang yang memiliki kepribadian dan pandangan yang berbeda dalam
beragama. Dari keduanya, Aurangzeb yang dianggap banyak tampil dan berperan
dalam perjalanan sejarah dinasti Mughal. Tetapi pada kondisi politik di abad ke-17
dengan berbagai faktor yang mempengaruhinya mulai mengurangi kebesaran dinasti
Mughal.
Aurangzeb tampaknya harus menyeleseikan banyak tugas berat yang melanda
dinasti Mughal. Meskipun wilayah kekuasaan dinasti Mughal sangat luas dan
pendapatan negara semakin meningkat, namun pada abad ke-17 itu menandai awal
dari berakhirnya kekuasaan muslim di India. Hal tersebut dipengaruhi pula oleh
dinamika politik yang terjadi di India yang secara realistik mengalami perubahan-
perubahan.
C. Kemajuan Yang Dicapai.
1. Bidang Administrasi.
Pemerintahan Mughal di India membagi wilayahnya menjadi 20 provinsi. Yang
setiap-setiap provinsi dikepalai oleh seorang gubernur yang bertanggung jawab kepada
sultan, pemerintahan Mughal juga memiliki tata cara administrasi, gelar resmi serta tata
mata uang yang seragam. Bahasa resmi di tingkat birokrasi pemerintahan dan dalam
dokumen-dokumen resmi kenegaraan memakai bahasa Persia. Sistem pemerintahan
Mughal sudah relatif tertata, itu adalah perjalanan yang bagus untuk pemerintahan yang
maju.
2. Bidang Ekonomi.
Pemerintahan Mughal di India juga memajukan bidang ekonomi, di mana saat itu
kerajaan Mughal berhasil mengembangkan program pertanian serta program yang
lainya, sehingga sumber keuangan negara lebih banyak bertumpu pada sektor pertanian.
Dari hasil pertanian ini yang kemudian menjadi komoditi ekspor Mughal ke berbagai
kawasan seperti, Eropa, Afrika, Arabia dan Asia Tenggara. Ensiklopedi Islam
menyebutkan bahwa, sejumlah komoditas andalan tersebut di antaranya adalah kain,
rempah-rempah, opium, gula, garam, wol dan parfum.
3. Bidang Keagamaan
Di kerajaan Mughal india saat itu berkembang dua model keagamaan, yang
pertama keagamaan yang bersifat legalistic, ortodoks, dan formal, yang di wakili oleh
Dara Shikah. Bila di cermati kedua model keagamaan ini muncul sebagai respon dari
adanya kekuatan eksternal Hinduisme, yang merupakan keyakinan masyarakat India
sebelum kedatangan Islam.
D. Periode Kemunduran Mughal
Terdapat beberapa factor penyebab kemunduran dinasti ini, yaitu:
a. Faktor Internal
Pada tahun 1707 M, Sultan Aurangzeb meninggal dunia,dia termasuk sultan yang
terakhir yangmasih memiliki pengaruh di dinasti Mughal di india. Setelah itu Muazzam
sebagai putra sulung dari Aurangzeb yang menggantikan posisi ayahnya sebagai
penguasa baru dinasti Mughal. Sebelum hanya dia sebagai penguasa di Kabul. Muazzam
bergelar Bahadur Syah (1707-1712M). muazzam yang berpaham Syi’ah,mendapatkan
tantangan dari penduduk Lahore disebabkan memaksakan penduduknya untuk berpaham
seperti dirinya.
Kenyataan menjadi lain ketika Aurangzeb meninggal dunia, putra sulung
Aurangzeb,Muazzam mempunyai ambisi besar untuk menguasai seluruh daerah
kekuasaan ayahnya. Ini ia terbukti dengan Muazzam mulai merebut daerah yang sudah
diberikan kepada adiknya, tanpa mempertimbangkan wasiat dari ayahnya. Muazzam
menghimpun kekuatan dengan jumlah yang besar untuk menghadapi kedua saudaranya,
perang saudarapun tidak bias di elakkan. Sehingga perpecahan keluarga istana Mughal
yang semula dihindari oleh Aurangzeb justru menjadi kenyataan dengan peperangan ini.
Muazzam juga mendapatkan tantangan dari kalangan Hindu yang tidak menyukai
pemerintahan Muazzam. Dan setelah Muazzam yang bergelar Bahadur Syah meninggal,
terjadi pula perebutan kekuasaan dari kalangan istana. Bahadur Syah di gantikan oleh
Azimus Syah,putranya sendiri.
Pada masa pemerintahan Azimus Syah ini,ia mendapatkan tantangan dari Zulfikar
Khan, putra Azad Khan,wazir Aurangzeb. Ketika Azimus Syah meninggal dunia,dia di
gantikan oleh putranya Jihandar Syah. Jihandar Syah pun mendapatkan tantangan dari
adiknya yang bernama Farukh Siyar. Farukh bahkan dapat mengalahkan kakaknya.
Farukh Siyar memerintah dengan dukungan kelompok sayyid. Akan tetapi dia pun harus
tewas ditangan pendukungnya sendiri tahun 1719 M. Sebagai gantinya di angkat
Muhammad Syah ( 1719-1748 M ), yang akhirnya di usir oleh Nadir Syah dari Persia.
Ini merupakan gambaran riil bahwa kemunduran dalam dinasti ini tidak
seluruhnya di sebabkan peperangan dengan musuh, tetapi nuansa pertikaian internal
cukup kental.
Dalam kondisi demikian,Akbar lalu dengan sigap menyusun kekuatan yang
tangguh, sehimgga satu persatu pemberontakan dapat di padamkan, termasuk
menghancurkan Hemu pada tahun 1556 M. Sehingga meskipun banyak tantangan,
pemerintahan Akbar terbilang sukses secara politis.
Pengganti Akbar adalah Jahangir ( 1605-1627 M ),ia termasuk peguasa yang
terkenal lemah ,lembut dan penyantun,sikapnya itu mendorong isterinya yang terkenal
cantik ikut berperan dalam mengatur dan megendalikan pemerintahan. Kelemahan ini di
manfaatkan oleh anaknya sendiri yang bernama Khurram memberontak kepada ayahnya
dengan di bantu oleh panglima perang Mubahat Khan. Mereka menangkap Jahangir dan
memenjarakannya dalam kamar tahanan di istana dan kemudian di damaikan oleh
permaisurinya sendiri.
Generasi penerus Jahangir adalah Shah Jahan ( 1628-1658 M ). Sebagaimana
pada pemerintahan sebelumnya, ia juga mendapatkan tantangan politik dari pihak lain. Di
awal dia memerintah, raja Jukhar Singh Bundella telah menunjukkan sikap memberontak,
inilah sebabnya Shah Jahan segera membuangnya seumur hidup. Bukan hanya itu
saja,pada tahun kedua pemerintahannya, Shah Jahan mendapat tantangan dari Afgan Pir
Lodi, tetapi perlawanannya dapat di padamkan, dan pimpinan pemberontak mati terbunuh
pada tahun 1631 M di Tel Sehon.sehingga sebagian masalah dapat diselesaikan.
Tampaknya Shah Jahan harus bekerja keras lagi, karena di zaman
pemerintahannya juga muncul pula kelompok pengacau portugis di benggala ( 1632 M ).
Kelompok ini dapat diusir dari dataran India pada tahun yang sama. Kondisi politik
semakin tidak stabil setelah Shah Jahan meninggal dunia, dimana semua anak laki-
lakinya terlibat dalam perebutan kekuasaan yang di tinggalkan ayahnya.
Kondisi politik terasa stabil di zaman Aurangzeb menjadi raja yang berjalan
sekitar 50 tahun. Tetapi setelah ia meninggal dunia kerajaan Mughal memasuki masa
kemundurannya,dengan problema politik yang terus berkelanjutan sebagaimana
dijelaskan di depan. Pertikaian politik internal keluarga istana dan pemberontakan seolah
tak pernah sepi dari kehidupan pemerintahan dinasti Mughal di India. Sebagai akibat dari
pertikaian di atas menyebabkan control terhadap wilayah kekuasaan daerah menjadi
terabaikan. Wilayah kekuasaan di daerah kerajaan Mughal satu persatu melepaskan
loyalitasnya dari pemerintahan pusat, bahkan cenderung memperkuat posisi
pemerintahannya masing-masing. Ia tentu sangat merugikan dinasti Mughal secara
politis.
Di samping faktor politik di atas, kemunduran dinasti Mughal di India juga di
sebabkan faktor agama. Orang-orang India mayoritas beragama Hindu, sedangkan Islam
agama minoritas pemeluknya,tetapi Islam di anut oleh para penguasa dan elitnya,
walaupun penduduk biasa juga ada yang beragama Islam, tetapi secara kuantitatif tetap
kalah jumlah dengan yang memeluk agama hindu. Faktor agama seringkali menjadi salah
satu penyebab keretakkan pemerintahan Akbar I.
b. Faktor Eksternal
Apabila di perhatikan sesungguhnya factor eksternal ini tidak bias di lepaskan
sama sekali dengan konflik yang terjadi di kalangan istana. Pertikaian dalam keluarga
istana menjadi salah satu alasan yang menyebabkan pihak luar untuk terlibat dalam
urusan istana. Pihak luar terkadang bersedia membantu tokoh yang mereka sukai untuk
menjatuhkan lawan politiknya. Sehingga terkadang terjadi ada raja yang di angkat
kemudian di turunkan.
Kondisi demikian kemudian di manfaatkan oleh golongan Hindu untuk
melepaskandiri dari pemerintahan Mughal. Ketika Aurangzeb berkuasa saja mereka
berani menentang pemerintah,apalagi pada masa kemunduran dinasti Mughal. Mereka
pernah melakukan pemberontakan di bawah kepemimpinan Tegh Bahadur dan Gobind
Singh dari golongan Sikh. Golongan Rajput memberontak pula di bawah pimpinan raja
Undaipur Kaum Mahratas memberontak pula di bawah pimpinan Sivaji dan puteranya
Simbaji. Pada masa pemerintahan Aurangzeb,mereka masih bias di tumpas,karena
pasukannya masih tangguh. Tetapi ini berbeda situasinya setelah Aurangzeb sudah tidak
berkuasa lagi dan di gantikan anak keturunannya.
Orang-orang Hindu melakukan pemberontakan kembali ketika Mughal dalam
pimpinan Bahadur Syah (Muazzam). Di bawah pimpinan yang bernama Banda,dan
mereka berhasilmerampas kota Sadhapura di sebelah utara Delhi. Bukan itu saja,mereka
juga berusaha merebut kota Sirhin dan melakuakan penjarahan serta perampokan
terhadap penduduk yang beragama Islam. Demikian juga golongan Maratha di bawah
pimpinan Baji Rao dapat merampas sebagian daerah Gujarat tahun 1732 M. ketika orang-
orang hindu bangkit,justru umat Islam Mughal mulai pada fase kemundurannya.
E. Periode Kehancuran Mughal
Penguasa terakhir Mughal adalah Bahadur Syah II. Bahadur Syah II menyadari
bahwa wilayahnya sudah di duduki Inggris. Pada saat yang kurang lebih bersamaan
kalangan Hindu juga merindukan pentingnya kebebasan, dan pada saat itu pula terjadi
kebangkitan gerakan Mujahidin di bawah pimpina Sayid Ahmad. Inilah kemudian
mereka sepakat untuk bekerjasama menentang Inggris dan mengembalikan Bahadur Syah
ke tahta kerajaan Mughal yang sebenarnya menjadi raja India. Ini berarti bahwa
kedatangan Inggris ke India pun membawa kesengsaraan bagi masyarakat India pula.
Kesepakatan di atas kemudian di wujudkan dengan penyerangan terhadap
pasukan Inggris. Pada tanggal 10 Mei 1857 M, pasukan Hindu menyerang Inggris di
Meerut 60 km sebelah Utra Delhi, dengan di bantu dengan gerakan Mujahidn. Dalam
penyerangan itu banyak perwira Inggris yang terbunuh. Penyerangan di teruskan ke Delhi
dan mereka berhasil menguasai kota dan serta memantapkan posisi Bahadur Syah sebagai
raja India, dan untuk sementara kerja sama ini membuahkan hasil gemilang.
Akan tetapi dalam babak berikutnya, dalam waktu yang tidak terlalu lama Inggris
berusaha kembali untuk melumpuhkan gerakan tersebut. Akhirnya Inggris mengerahkan
pasukan dalam jumlah yang besar. Inggris pun berhasil memukul mundur pasukan Hindu
dan Mujahidin. Dan sebagai efek dari pemberontakan itu, Inggris kemudian
memberlakukan hukuman yang kejam baik terhadap umat Islam maupun terhadap orang
Hindu.
Oleh karena gerakan tersebut merupakan gerakan kerja sama antara orang Islam
dan Orang Hindu di India, maka pihak Inggris kemudian menangkap pimpinan
pemberontak baik dari Hindu maupun dari Mujahidin dan dieksodus keluar India,
sementara pemberontak lainnya di usirdari Delhi. Tempat-tempatibadah dan gedung-
gedung di hancurkan, kemegahan Mughal yang telah di bangun dalam masa
pemerintahan Islam kemudian hancur tinggal puing-puing yang berantakan. Akhirnya
kekuasaan Islam di bawah dinasti Mughal di Indiayang telah berkuasa selama lebih dari
tiga abad itu berakhir di tangan orang-orang Inggris yang menduduki India.

PERADABAN ISLAM KONTEMPORER DI WILAYAH ARAB


A. Pusat Dan Aspek-Aspek Peradaban Islam Kontemporer Di Wilayah Arab
Banyak aspek-aspek pendukung peradaban Islam kontemporer di kawasan timur tengah,
serta kawasan timur di antaranya adalah aspek budaya, aspek sosial, aspek ekonomi, dan aspek
politik. Di antara negara-negara yang mengalami perkembangan peradaban dalam kategori
kontemporer adalah Turki, India, Iran dan kawasan sekitarnya.
1. Kota Baghdad
Kota bagdad didirikan oleh khalifah kedua Daulah Abbasiah, Almanshur (754-755
M) pada tahun 762 M., setelah mencari-cari daerah yang strategis untuk ibukotanya, pilihan
jatuh pada daerah yang sekarang dinamakan Baghdad terletak di sungai tigris. Ia
menugaslan beberapa orang ahli untuk meneliti dan mempalajari lokasi. Setelah penelitian
seksama itulah daerah ini ditetapkan sebagai ibukota dan pembangunan dimulai. Menurut
cerita rakyat, daerah ini adalah sebagai tempat peristirahatan Kisra Anusyirwan, raja Persia
yang mashur, di musim panas. Bagdad berarti ”taman keadilan” taman itu lenyap bersama
kerajaan Persia, akan tetapi, nama itu tetap menjadi kenagan rakyat. Dalam membangun
kota ini khalifah memperkerjakan ahli bangunan yang terdiri dari arsitektur-arsitektur,
tukang batu, tukang kayu, ahli lukis, dan lain-lain. Mereka didatangkan dari Syiria, Mosul,
Basyrah dan Kuffah yang berjumlah sekitar 100 ribu orang.
Sejak awal berdirinya, kota ini sudah menjadi pusat peradaban dan kebangkitan ilmu
pengetahuan dalam islam. Itulah sebabnya, Philip K.Hitti menyebutnya sebagai kota
intelektual. Setelah masa Al-manshur, kota bagdad menjadi lebih masyhur lagi karena
perannya sebagai pusat perkembangan peradaban dan kebudayaan islam. Banyak para
ilmuan dari berbagai daerah datang ke kota ini untuk mendalami ilmu pengetahuan yang
ingin dituntutnya. Masa keemasan kota bagdad terjadi pada zaman pemerintahan khalifah
Harun Al-Rasyid (786-809) dan anaknya Al-makmun (813-833 M). dari kota inilah
memancar sinar kebudayaan dan peradaban Islam ke seluruh dunia. Prestise politik,
supremasi ekonomi, dan aktifitas intelektual merupakan tiga keistemewaan kota ini.
Kebesaranya yang tidak terbatas pada negeri arab, tetapi meliputi seluruh negeri islam.
Bagdad ketika itu menjadi pusat peradaban islam dan kebudayaan yang tertinggi di dunia.
Ilmu pengetahuan dan sastra berkembang sangat pesat. Banyak buku filsafat yang
sebelumnya dipandang sudah “mati” dihidupkan kembali dengan diterjemahkan ke dalam
bahasa arab. Khalifah al-ma’mun memiliki perpustakaan yang dipenuhi dengan beribu-ribu
buku ilmu pengetahuan. Perpustakaan itu bernama Bait al-hikmah.
1. Penguasa Pada Masa Awal
Populasi Bagdad berada pada jumlah sekitar 300.000 dan 500.000 pada abad ke-9.
Pertumbuhan pesat Bagdad pada awal telah melambat akibat dari masalah dalam
Kekhalifah an, termasuk pemindahan ibu kota ke Samarra (antara 808–819 dan 836–
892), hilangnya provinsi-provinsi barat dan paling timur, dan masa dominasi politik
oleh para Buwayhid Iran (945–1055) dan bangsa Turki Seljuk (1055–1135). Panen
yang rusak dan perselisihan intern membuatnya runtuh. Meskipun begitu, kota ini
tetap merupakan satu daripada pusat kebudayaan dan perdagangan dunia Islam hingga
10 Februari 1258 ketika ia dirusak bangsa Mongol di bawah Hulagu Khan. Para suku
Mongol membunuh 800.000 penduduk kota, termasuk Kalifah Abbasiyah Al-
Musta'sim, dan merusak sebagian besar kota. Kanal dan tanggul-tanggul yang
membentuk sistem irigasi kota juga turut hancur. Perebutan Bagdad mengakhiri era
Kekhalifah an Abbasiyah, sebuah pukulan keras yang tak pernah dipulihkan peradaban
Arab.
Bagdad pun dipimpin oleh al-Khanid, penguasa Iran berbangsa Mongol. Pada
1401, Bagdad dirusak kembali oleh bangsa Mongol di bawah pimpinan Timur
("Tamerlane"). Ia menjadi ibu kota provinsi yang dipimpin dinasti-dinasti Jalayirid
(1400–1411), Qara Quyunlu (1411–1469), Aq Quyunlu (1469–1508), dan Safavid
(1508–1534). Pada 1534, Bagdad direbut bangsa Turki Ottoman. Di bawah kekuasaan
mereka, Bagdad mengalami masa-masa suram, di antaranya karena perselisihan antara
penguasanya dengan Persia. Untuk suatu saat, Bagdad merupakan kota terbesar di
Timur Tengah sebelum posisinya diambil alih Konstantinopel pada abad ke-16.
a. Kemerdekaan
Bagdad tetap dikuasai Kerajaan Ottoman hingga terbentuknya kerajaan Irak di
bawah kekuasaan Britania Raya pada 1921, yang kemudian dilanjutkan dengan
kemerdekaan resmi pada 1932 dan kemerdekaan penuh pada 1946. Pengaruh Eropa
ini juga mengubah wajah kota. Pada tahun 1920, Bagdad - yang tumbuh dari lokasi
tertutup seluas 254 mil persegi (657 km²) - menjadi ibu kota negara baru Irak.
Populasi kota tumbuh dari sekitar 145.000 pada 1900 menjadi 580.000 pada
1950. Pada tahun 1970-an, Bagdad mengalami masa kemakmuran dan pertumbuhan
karena tajamnya kenaikan harga minyak, ekspor utama Irak. Infrastruktur baru
dibangun pada saat ini termasuk saluran pembuangan modern, air, dan jalan tol.
Namun Perang Iran-Irak pada tahun 1980-an merupakan masa yang sulit bagi
Bagdad karena uang digunakan untuk membiayai pasukan tentara dan ribuan
penduduk kota meninggal. Iran melancarkan beberapa serangan rudal terhadap
Bagdad, meski serangan tersebut hanya menyebabkan kerusakan kecil dan sedikit
korban saja.
b. Konflik dengan Amerika
Perang Teluk Persia pada 1991 mengakibatkan kerusakan parah terhadap
Bagdad, khususnya infrastruktur transportasi, energi dan kebersihannya. Meskipun
begitu, Presiden AS George H. W. Bush memutuskan agar pasukan AS tidak
memasuki Bagdad dan merebutnya – dan dengan itu meninggalkan Saddam Hussein
dalam tonggak kekuasaan – hal ini mungkin disebabkan kemungkinan akan adanya
korban sipil yang besar dari melakukan serangan ke kota tersebut.
Bagdad dibom secara besar-besaran pada Maret dan April 2003 dalam invasi
AS terhadap Irak 2003, dan jatuh di bawah kekuasaan Amerika Serikat pada sekitar
tanggal 7 April-9 April. Kerusakan tambahan juga disebabkan penjarahan besar-
besaran pada beberapa hari setelah berakhirnya perang. Setelah jatuhnya rezim
Saddam, kota ini pun dikuasai oleh pasukan AS. Akhirnya kekuasaan berpindah
kepada pemerintah sementara pada akhir Juni 2004.
Hingga kini Bagdad masih termasuk berbahaya bagi penduduknya karena
kriminalitas merajalela di kota tersebut. Selain itu, aliran listrik juga masih terbatas
dan menyebabkan warga menjadi tidak sabar dengan invasi AS terhadap Irak.
Bagdad telah lama memainkan peranan penting dalam kehidupan kebudayaan
Arab dan sejak dulu merupakan kampung halaman penulis-penulis, musisi dan artis
visual terkenal.
c. Pemandangan yang menarik dan monumen-monumen penting
Tempat-tempat yang menarik termasuk Museum Nasional Irak, di mana
koleksi artifak-artidak yang tak ternilai dijarah pada saat invasi pada 2003, gerbang
Tangan Kemenangan, dan Kebun binatang Bagdad. Ribuan manuskrip kuno di
Perpustakaan negara rusak ketika bangunan tersebut dibakar pada masa Perang Teluk
Persia kedua. Mesjid Al Khadimiya di barat laut Bagdad adalah salah satu bangunan
keagamaan Syiah terpenting di Irak. Ia selesai dibangun pada 1515 dan Imam ke-7
(Musa ibn Jafar al-Kazim) dan ke-9 (Mohammad al-Taqi) dimakamkan di sini. Salah
satu bangunan tertua adalah Istana Abbasiyah yang dibangun pada abad ke-12 atau
abad ke-13.
Pada abad ke-8 dan 9, Bagdad dianggap sebagai kota terkaya di dunia. Para
pedagang Tiongkok, India, dan Afrika Timur bertemu di sini, bertukaran benda-
benda kebudayaannya dan melambungkan Bagdad menjadi renaisans intelektual.
Rumah sakit dan observatorium dibangun; para penyair dan seniman dibina; dan
karya besar Yunani) diterjemahkan ke (bahasa Arab).
Bagdad adalah salah satu dari kota terbesar dan paling kosmopolitan di dunia
dan menjadi rumah bagi umat Muslim, (Kristen|Kristiani), (Yahudi) dan penganut
(paganism) dari seluruh (Timur Tengah) dan (Asia Tengah). Di samping itu, banyak
berdiri akademi, sekolah tinggi, dan sekolah biasa yang memenuhi kota itu. Dua di
antaranya yang terpenting adalah perguruan Nizhamiyyah, didirikan olah nizham al-
mulk, wazir sultan Seljuk, pada abad ke-5 H dan perguruan mustanshiriyah, didirikan
dua abad kemudian olah khalifah al-mustansyir billah.
Dalam bidang sastra, kota bagdad terkenal dengan hasil karya yang indah dan
digemari orang. Diantara karya sastra yang terkenal ialah Alf lailah wa lailah, atau
kisah seribu satu malam. Di kota bagdad ini, lahir dan muncul para saintis, ulama,
filosof, dan sastrawan Islam yang terkenal, seperti al-khawariz (ahli astronomi dan
matematika, penemu ilmu aljabar), al-kindi (filosof arab pertama), al-razi (filosof,
ahli fisika dan kedokteran), al-farabi (filosof besar yang dijuluki dengan al-mu’allim
al-tsani, guru kedua setelah aristoteles.
Dalam bidang ekonomi, perkembanganya berjalan seiring dengan
perkembangan politik. Pada zaman harun al-rasyid dan al-makmun, perdagangan dan
industry berkembang pesat. Kehidupan ekonomi kota ini didukung oleh tiga buah
pelabuhan yang ramai dikunjungi para kafilah dengan internasional (cina, india, asia
tengah, syiria, Persia, mesir, dan negeri afrika lainnya), dua di basrah dan sirat di
teluk Persia
2. Kota Kairo (Mesir)
Kota kairo di bangun pada tanggal 17 sya’ban 358 H/969 M oleh panglima
perang dinasti fathimiah yang beraliran syi’ah, jawhar al-siqili, atas perintah khalifah
fathimiah, al-mu’izz lidinillah (953-975 M), sebagai ibukota kerajaan dinasti tersebut.
Wilayah kekuasaan dinasti fathimiah meliputi afrika utara, sicilia, dan syiria. Berdirinya
kota kairo sebagai ibu kota kerajaan dinasti ini membuat bagdad mendapat saingan.
Setelah pembangunan kota kairo rampung lengkap dengan istananya, al-siqili mendirikan
masjid al-azhar, 17 Ramadhan 359 H (970 M). masjid ini berkembang menjadi sebuah
universitas besar yang sampai sekarang masih berdiri megah. Nama Al-Azhar diambil dari
al-Zahra’, julukan fathimiah, puteri Nabi Muhammad saw dan istri ‘ali ibn abi thalib,
Imam pertama syiah.
Kota yang terletak di tepi sungai Nil ini mengalami tiga kali masa kejayaan, yaitu
pada masa dinasti fathimiah, dimasa shalah Al-Din Al- Ayyubi dan dibawah baybars dan
al-nasyir pada masa dinasti mamalik. Periode fathimiah ini dimulai dengan al-mu’izz dan
puncaknya terjadi pada masa pemerintahan anaknya, al-aziz. Al- muizz lidinillah dan aziz
di mesir dapat disejajarkan dengan harun al-rasyid di bagdad. Selama pemerintahan
mu’izz dan tiga orang pengganti pertamanya, seni dan ilmu mengalami kemajuan besar.
Al–mu’izz melaksanakan tiga kebijakan besar, yaitu pembaharuan dalam bidang
administrasi,pembangunan ekonomi, dan toleransi beragama (juga aliran). Dalam bidang
administrasi, ia mengangkat seorang wazir (menteri) untuk melaksanakan tugas-tugas
kenegaraan. Dalam bidang ekonomi, ia member gaji khusus kepda tentara, personalia
istana, dan pejabat pemerintahan lainnya. Dalam bidang agama, di mesir diadakan empat
lembaga peradilan, dua untuk mazdhab syi’ah dan dua untuk mazdhab sunni. Al-azis
kemudian mengadakan program baru dengan mendirikan masjid-masjid, istana, jembatan,
dan kanal-kanal baru.
Pada zaman aziz billah dan hakim biamrillah, terdapat seorang mahaguru
bernama ibn yunus yang menemukan pendulum dan ukuran waktu dengan ayunannya.
Karyannya zij al-akbar al-hakimi diterjemahkan ke dalam berbagai bahasa. Dia meninggal
pada tahun 1009 M dan penemuan-penemuannya diteruskan oleh ibn al-nabdi(1040) dan
hasan ibn haitham, seorang astronom dan ahli optika. Yang disebut terakhir menemukan
sinar cahaya datang dari objek ke mata dan bukan keluar dari mata lalu mengenai benda
luar.
Pada masa pemerintahan al-hakim, didirikan bait al-hikamah, terisnpirasi dari
lembaga yang sama yang didirikan oleh al-makmun di bagdad. Di lembaga ini banyak
sekali koleksi buku-buku. Lembaga ini juga merupakan pusat pengkajian astronomi,
kedokteran dan ajaran-ajaran Islam terutama syia’ah.
Pada masa-masa selanjutnya, dinasti fathimiah mulai mendapat gangguan –
gangguan politik. Akan tetapi, kaoro tetap menjadi sebuah kota besar dan penting. Ketika
jayanya, di kairo terdapat lebih kurang 20.000 toko milik khalifah, penuh dengan barang-
barang dari dalam dan luar negeri. Kafilah-kafilah, tempat-tempat pemandian, dan sarana
umum lainnya banyak sekali didirikan oleh penguasa. Istana khalifah dihuni oleh 30.000
orang, 12.000 diantaranya adalah pembantu, 1000 pengawal berkuda.
Dinasti fathimiah ditumbangkan oleh dinsti ayyubiah yang didirikan oleh shalah
al-din, seorang pahlawan islam terkenal dalam perang salib. Ia tetap mempertahankan
lembaga-lembaga ilmiah yang didirikan oleh dinasti fathimiah tetapi mengubah orientasi
keagamaanya dari syi’ah kepada sunni. Ia juga mendirikan lembaga-lembaga ilmiah baru,
terutama masjid yang dilengkpi dengan tempat belajar teologi dan hokum. Karya-karya
ilmiah yang muncul pada masanya dan sesudahnya adalah kamus-kamus biografi,
compendium sejarah, manual hokum, dan komentar-komentar teologi. Ilmu kedokteran
diajarkan di rumah-rumah sakit. Prestasinya yang lain adalah didirikannya sebuah rumah
sakit bagi orang cacat pikiran.

3. Kota Isfahan (Persia)


Isfahan adalah kota terkenal di Persia, pernah menjadi ibu kota kerajaan syafawi.
Kota ini merupakan gabungan dari dua kota sebelumnya, yaitu jay, tempat berdirinya
syahrastan dan yahudiyyah yang didirikan oleh buchtanashar atau yazdajir 1 atas anjuran
istrinya yang beragama yahudi. Kota Persia ini sebagai ibu kota provinsi dan pusat
industry dan perdagangan.
Persia memiliki kebudayann dan perdaban yang mempunai ciri menggunakan
bahasa indo irannya dan cirri etnik arya serta domonasi bahasa Persia. Pengaruh
kebudayaannya mampu mempengaruhi negara-negara di india, asia tenggara khususnya
melayu maupun daratan cina. Persia memiliki cirri-ciri kebudayaan seperti arsitektur dan
kesenian yang sangat khas sehingga mampu digunakan sebagai alat dalam penyebaran
serta pengembangan agama islam pada periode islam modern dan
kontemporer.Pemgelompokkan keagamaan di Persia banyak mendapat perhatian dari
pihak arab karena sistematis pengelompokanya sangat baik dan praktis dengan
menggunakan dua corak kehidupan syiah dan suni.
Ketika raja safawi, Abbas 1, menjadikan Isfahan sebagai ibu kota kerajaanya, kota
ini menjadi kota yang luas dan ramai dengan penduduk. Kota ini terletak di atas sungai
zandah. Di atas sungai ini terbentang tiga buah jembatan yang megah dan indah, satu
diantaranya terletak di tengah kota. Sementara dua lainnya di pinggiran kota. Kota ini,
ketika berada di bawah kekuasaan kerajaan syafawi, dikelilingi oleh tembok yang terbuat
dari tanah dengan delapan buah pintu . di dalam kota banyak berdiri bangunan, sperti
istana-istana, sekolah-sekolah, masjid-masjid, menara-menara, pasar, dan rumah-rumah
yang indah, terukir rapi dengan warna-warna yang menarik. Masjid syah yang masih ada
sampai sekarang yang didirikan oleh Abbas 1, merupakan salah satu masjid terindah di
dunia. Pintunya di lapisi dengan perak. Di samping itu, juga ada lapangan dan tanaman
yang terawatt baik dan menawan.
4. Kota Isntanbul (Turki)
Pada tahun 2000 muncul cendikiawan yang bernama Harun Yahya yang mampu
melakukan perlawanan terhadap sekularisme melalui beberapa pemikiran dan dalam
bidang yang lain. Ini merupakan fenomena baru bagi penduduk Turki dalam adad modern
dan kontemporer.
Dalam Aspek budaya dan sosialnya kawasan turki banyak dihuni oleh suku Kurdi
yang sering melakukan pemberontakan dengan kebijakan publik karena adanya perbedaan
pemahaman dalam bidang agama. Dalam aspek agamanya masyarakat Turki mampu
berkembang dan mengembangkan ajaran Islam karena memiliki dua madzhab dalam
memahami ajaran Islam yaitu madzhab Sunni dan syi’ah. Masing masing dari madzhab
tersebut memiliki pemimpin dan bergerak dalam bidangnya masing-masing tanpa
menggangku aktivitas diantara keduanya. Hal ini dikarenakan adanya kebijakan dari
kaisar Turki yang membagi daerah penyebaran masing-masing.
Dalam arsitektur, masjid-masjid yang dibangun disana membuktikan
kemajuannya. Masjid memang merupakan suatu ciri dari sebuah kota Islam, tempat kaum
muslimin mendapat fasilitas lengkap untuk menjalankan kewajiban agamanya. Gereja Aya
Sophia, setelah penakhlukan diubah menjadi sebuah masjid agung yang terpenting di
istambul. Gambar–gambar makhluk hidup yang sebelumnya ditutup, mihrab, didirikan,
dindingnya dihiasi dengan kaligrafi yang indah, dan menara- menara dibangun. Masjid-
masjid penting lainnya adalah masjid Agung Al-Muhammadi atau masjid Agung Sultan
Muhammad Al-fatih, Masjid Abu Ayyub Al-anshari (tempat pelantikan para sultan
usmani), masjid bayazid dengan gaya Persia, dan msjid sulaiman Al-qanuni.
5. Kota Delhi (India)
Pusat peradaban Lembah Sungai Gangga terletak antara Pegunungan Himalaya
dan Pegunungan Windya-Kedna. Pendukung peradaban Lembah Sungai Gangga adalah
bangsa Arya yang termasuk bangsa Indo-Jerman. Mereka datang dari daerah Kaukasus
dan menyebar ke arah timur. Bangsa Arya memasuki wilayah India antara tahun 200-1500
SM, melalui Celah Kaibar di Pegunungan Hirnalaya. Peradaban Lembah Sungai Gangga.
Pusat peradaban Lembah Sungai Gangga terletak antara Pegunungan Himalaya dan
Pegunungan Windya-Kedna. Pendukung peradaban Lembah Sungai Gangga adalah
bangsa Arya yang termasuk bangsa Indo-Jerman. Mereka datang dari daerah Kaukasus
dan menyebar ke arah timur. Bangsa Arya memasuki wilayah India antara tahun 200-1500
SM, melalui Celah Kaibar di Pegunungan Hirnalaya. Bangsa Arya adalah bangsa
peternak dengan kehidupan yang terus mengembara. Setelah berhasil mengalahkan bangsa
Dravida di Lembah Sungai Indus dan menguasai daerah yang subur, akhirnya mereka
hidup menetap. Selanjutnya, mereka menduduki Lembah Sungai Gangga dan terus
mengembangkan kebudayaannya. Kebudayaan campuran antara kebudayaan bangsa Arya
dengan bangsa Dravida dikenal dengan sebutan kebudayaan Hindu.
Perkembangan sistem pemerintahan di Lembah Sungai Gangga merupakan
kelanjutan ~an sistem pemerintahan masyarakat di daerah Lembah Sungai Indus.
Runtuhnya Kerajaan Maurya menjadikan keadaan kerajaan menjadi kacau dikarenakan
peperangan antara kerajaan-kerajaan kecil yang ingin berkuasa. Keadaan yang kacau,
mulai aman kembali setelah munculnya kerajaan-kerajaan baru.
Kebudayaan Lembah Sungai Gangga merupakan campuran antara kebudayaan
bangsa Arya dengan kebudayaan bangsa Dravida. Kebudayaan ini lebih dikenal dengan
kebudayaan Hindu. Daerah-daerah yang diduduki oleh bangsa Indo-Arya sering disebut
dengan Arya Varta.
Di Lembah Sungai Gangga inilah kebudayaan Hindu berkembang, baik di wilayah
India maupun di luar India. Masyarakat Hindu memuja banyak dewa (Politeisme). Dewa-
dewa tersebut, antara lain, Dewa Bayu (Dewa Angin), Dewa Baruna (Dewa Laut), Dewa
Agni (Dewa Api), dan lain sebagainya. Dalam agama Hindu dikenal dengan sistem kasta,
yaitu pembagian kelas sosial berdasarkan warna dan kewajiban sosial. Dalam
perkembangan selanjutnya, sistem kasta inilah yang menyebabkan munculnya agama
Buddha. Hal ini dipelopori oleh Sidharta Gautama.
Agama Buddha mulai menyebar ke masyarakat India setelah Sidharta Gautama
mencapai tahap menjadi Sang Buddha. Agama Buddha terbagi menjadi dua aliran, yaitu
Buddha Mahayana dan Buddha Hinayana. Peradaban Sungai Gangga meninggalkan
beberapa bentuk kebudayaan yang tinggi seperti kesusastraan, seni pahat, dan seni patung.
6. Kota Islamabad (Pakistan)
Dalam bidang politik Pakistan masih menyandang tradisi kerajaan abbasiyah yakni
dengan memperhatikan beberapa hal diantaranya yaitu kestuan dan integritas umat islam
sebagai komunitas agama universal, implemntasi syariat dibawa pengawasan ulama’,
pelestarian dan penyebaran ilmu agama di bawah bimbingan ulama’. Sebagai fungsional,
mereka meng -organisasi memim[pin solat berjamaah ,mengawasi perayaan acara dan hari
raya islam serta melakukan upacara pernikahan dan pemakaman.untuk mewujudkan yangt
lebih modern mereka mengupayakannya melalui pendirian negara islam dengan alquran
dan sunnah sebagai konstitusinya dan syariat sebagai hukumnya.
PERABAPAN ISLAM DI INDONESIA SEBELUM
KEMERDEKAAN
a. Perkembangan Islam di Indonesia sebelum Kemerdekaan
Pesatnya perkembangan Islam di Indonesia didukung oleh beberapa faktor, yaitu:
1) Syarat untuk memeluk agama Islam sangat mudah.
2) Kewajiban berdakwah merupakan tugas setiap muslim.
3) Para saudagar maupun ulama dalam menyampaikan Islam menggunakan pendekatan
yang persuasif dan cara dakwah yang simpatik.
4) Para ulama juga memiliki kelebihan rohaniah melalui ajaran tasawwuf.
5) Ajaran Islam tidak mengenal pembedaan derajat manusia berdasarkan kasta/gelar.
6) Ajaran Islam dipandang sesuai dengan kepribadian bangsa Indonesia.
a. Bukti-bukti penyebaran Islam di Indonesia
1. Makam Fatimah binti Maimun
Berdasarkan penelitian sejarah telah ditemukan sebuah makam Islam di Leran,
Gresik. Pada batu nisan tertulis nama seorang wanita yang bernama Fatimah binti
Maimun dan angka tahun 1082 (475 H). Artinya dapat dipastikan bahwa pada akhir
abad XI Islam telah masuk ke Indonesia.
2. Makam Sultan Malik Al-Saleh
Makam Sultan Malik Al-Saleh yang berangka tahun 1297 merupakan bukti bahwa
Islam telah masuk dan berkembang di daerah Aceh pada abad XIII. Mengingat Malik
Al-Saleh adalah seorang Sultan, maka dapat diperkirakan bahwa Islam telah masuk ke
daerah Aceh jauh sebelum Malik Al-Saleh mendirikan Kesultanan Samudera Pasai.
3. Sumber berita Ma-Huan
Penemuan puluhan batu nisan di Troloyo, Trowulan Gresik yang berasal dari
abad ke-13. Sumber berita dari Ma-Huan (1416) yang menyebutkan bahwa pada abad
ke-13 telah banyak orang-orang muslim di Gresik.
4. Sumber berita Marco Polo
Marco Polo menceritakan bahwa pada abad XIII, Islam telah berkembang di
Sumatera Utara dan Jawa.
5. Ceritera Ibn. Battuta
Pada tahun 1345, Ibn Battuta mengunjungi Samudera Pasai. Ia menceritakan
bahwa Sultan Samudera Pasai sangat baik terhadap ulama dan rakyatnya.
6. Sumber Dinasti Tang
Islam masuk ke Indonesia sejak abad ke-7 dan 8 M. Hal itu dibuktikan, dengan
ramainya Selat Malaka dari aktivitas pedagang-pedagang Muslim.
7. Sumber berita Tome Pires
Sumber berita Tome Pires dalam Suma Orienta, yang menyebutkan bahwa
daerah-daerah sekitar pesisir Utara Sumatera telah banyak masyarakat dan kerajaan
Islam.
b. Perkembangan tradisi Islam di berbagai daerah
1. Tradisi Ziarah
Tradisi ziarah atau mengunjungi makam para wali sudah menyebar luas di Jawa.
Para peziarah memiliki kepercayaan bahwa berziarah merupakan tindakan ibadah
yang membawa berkah dan merupakan suatu cara untuk menghormati orang yang
telah meninggal dunia dan di akhirat.
2. Tradisi Maulud
Tradisi maulud merupakan tradisi perayaan keagamaan yang berkembang dalam
masyarakat Islam untuk memperingati hari kelahiran nabi Muhammad s.a.w yang
jatuh pada tanggal 12 Rabiul Awal bulan Khomariah ketiga menurut penanggalan
Islam.
3. Tradisi Tajdid
Tajdid atau pembaharuan merupakan tradisi yang muncul secara periodik dalam
dunia Islam.
4. Tradisi Daur Kehidupan dalam Ajaran Islam
Ada 4 jenis upacara yang biasa dilakukan oleh umat Islam di Indonesia, yaitu
kelahiran, masa memasuki dewasa, menikah, dan meninggal.
c. Perkembangan pendidikan, kesenian dan kesusastraan bercorak Islam
a) Perkembangan Pendidikan Islam
1. Perkembangan pendidikan Islam di Sumatera
Di wilayah Barat kepulauan Indonesia, Aceh dan Minangkabau bisa
disebut sebagai puat muncul dan berkembangnya pendidikan dan ilmu
pengetahuan Islam hingga ke Malaka dan Filiphina. Syekh Abdurrauf berhasil
menterjemahkan tafsir Alquran ke dalam bahasa Melayu.
2. Perkembangan pendidikan Islam di Jawa
Agama Islam berkembang di Jawa Timur, Jawa Tengah dan Jawa Barat,
terutama kota-kota pesisir pantai seperti Gresik, Surabaya, Demak dan Banten.
Pendidikan Islam di Jawa tidak lepas dari keberadaan kerajaan Islam, para
Walisanga, Kyai dan ulama lokal.
3. Perkembangan pendidikan Islam di Kalimantan
Perkembangan pendidikan Islam ini berasal dari masjid, pesantren dan
madrasah.
4. Perkembangan pendidikan Islam di Sulawesi
Perkembangan pendidikan Islam di wilayah ini tidak lepas dari peran para
ulama dan mubalig seperti syekh As’ad Rasyid. Pendidikan Islam ini diajarkan
melalui masjid, pesantren dan madrasah.
b) Perkembangan Kesenian Islam
a. Perkembangan seni pertunjukan
Contohnya seni tari Seudati, seperti yang berkembang di daerah Aceh. Tari ini
dilakukan oleh delapan penari sambil menyanyikan lagu tertentu yang isinya
tentang salawat Nabi.
b. Perkembangan bidang seni rupa
Contohnya seni kaligrafi, yaitu seni tulis indah dengan menggunakan huruf
Arab.
c. Perkembangan bidang seni bangunan
Contohnya bangunan masjid dan keraton.
d. Perkembangan kesusastraan Islam
Contohnya hikayat, syair bernuansa Islam dan suluk.
e. Sastra Islam berbentuk hikayat
Contohnya babad tanah Jawi yang menceritakan berbagai hal yang berkaitan
dengan kerajaan-kerajaan di Jawa.
f. Sastra Islam berbentuk syair
Contohnya syair karya Ali Haji, yang berisi nasehat bagi para pemimpin,
pegawai dan rakyat biasa agar dihormati dan disegani oleh orang lain.
g. Sastra Islam berbentuk suluk
Mengacu pada hidup dengan cara sufi atau mengikuti aturan sufi. Dalam
kesusastraan Jawa tradisi suluk dikategorikan sebagai ajaran spiritual orang
Islam Jawa yang ditulis dalam bentuk puisi.
b. Peradaban Islam Pra Kemerdekaan
1. Birokrasi keagamaan
Penyebaran islam pertama kali di Indonesia di mulai dari pesisir.
Tumbuh di berbagai pelabuhan di antaranya : Sumatra Pasai, Sumatra Barat,
Palembang, Sunda Kelapa(Jakarta), Jepara, Tuban, Gresik, Madura, dan
Ambon. Dan islam semakin menyebar luas dan akhirnya menyebar
diantaranya adalah Samudra Pasai, Aceh, Demak, Banten, Cirebon, Ternate,
Tidore dan sebagainya.Ibu kota di samping pusat politik dan perdagangan
pusat perkumpulan para ulama’ dan mubaligh islam. Raja- raja Aceh
mengangkat para ulama’ menjadi penasehat dan pejabat di bidang keagamaan.
Sultan Iskandar muda ( 1607-1636 ) mengangkat Syekh Nuruddin ar-Raniri
menjadi mufti kerajaan dan Sultan Saefuddin Syah mengangkat Syekh Abdur
Rauf Singkel.
Kedudukan ulama sebagai penasehat raja, di Demak penasehat Raden
Fatah, raja pertama Demak, Sunan Ampel dan Sunan Kalijaga. Sunan Gunung
Jati (Syarif Hidayatullah) yang berperan sebagi guru agama dan mubalig saat
di ternate di bantu sebuah penasehat. Kesimpulan nya selain menjadi
penasehat badan peradilan juga member nasehat kepada raja apabila
melanggar
2. Ulama dan ilmu keagamaan
Ulama sangat berperan sebagai penyebar agama juga berpartisipasi
dalam bidang pendidikan ,ada dua cara yang di lakukan sebagai berikut :
a. Membentuk karder-karder ulama yang bertugas sebagai muballig ke
daerah-daerah yang luas.
b. Karya-karya yang tersebar dan dibaca di berbagai tempat yang jauh. Karya-karya tersebut
mencerminkan pemikiran dan ilmu keagamaan di Indonesia pada masa itu.
Syekh Muhammad Naqub al-Attas menyatakan menyaksikan suatu kesuburan dalam
penulisan sastra ,filsafat, metafisika, dan teologi rasional yang tidak ada tolok banding di
zaman apapun di Asia. Diantara ilmuan muslim pertama di Indonesia sebagai berikut :
a. Hamzah Fansuri
Seorang sufi terkemuka berasal dari Fansur (barus) Sumatra Utara. Karya nya yang
terkenal Asrarul Arifin fi Bayan ila Suluk wa at-tauhid, tentang ilmu kalam menurut
teologi islam.
b) Syamsuddin as- Sumatrani
Murid dari Hamzah Fansuri, mengrang buku yang berjudul Miratul Mu’minin ( cermin
orang beriman) tentang ilmu kalam.
c) Nuruddin ar-Raniri
Berasal dari India keturunan Arab Quraisy Hadramaut. Dikenal sebgai orang yang
membela ajaran Ahlusunnah wal jama’ah. Kaya nya Al-lanah fi tafkir msn qala bi khalq
al-Qur’an.
d) Abdur Rauf Singkel
Mendalami ilmu pengetahuan di Makkah dan Madinah. Menghidupkan kembali ajaran
tassawuf yang sebelumnya di kembangkan oleh Hamzah Fansuri.
3. Politik
Peran umat islam dalam politik pemerintah tidaklah berhenti. Secara formal terdapat
kaum muslimin yang ada dalam jajaran pegawai. Di antaranya sebagai berikut:

a. Serikat Dagang Islam (SDI)


Pada tanggal 10 desember 1911 M Serikat Dagang Islam (SDI) berubah menjadi Syarikat
Islam (SI). Cokro Aminoto pada tahun 1927 menjadi Partai Syarikat Islam Hindia Timur
dan pada tahun 1930 berubah lagi menjadi Partai Syarikat Islam Indonesia (PSII)
ketuanya H. Samanhudi dan Cokro Aminoto.
b. Partai Arab Indonesia
Berdiri tanggal 4 oktober 1953, turunan bangsa arab yang berjuang bagi tanah air dan
bangsa Indonesia Oleh al-Baswedan.
c. Majelis Islam A’la Indonesia (MIAI)
Kumpulan islam atas inisiatif KH.Mas Mansur dan KH.Ahmad Dahlan.
4. Seni dan Arsitektur
Hasil seni bangunan yang mempunyai nilai sejarah di antaranya adalah Masjid Kuno
Demak, Sendang Duwur Agung kesepuhan di Cirebon, Masjid Agung Banten,
Baiturrahman di Aceh dan lain-lain. Beberapa masjid kuno mengingatkan pada seni candi
menyerupai bangunan meru pada zaman Indonesia Hindu. Selain itu nisan kubur di
daerah Tralaya, Tuban, Madura, Demak, Kudus.

PERADABAN ISLAM DI INDONESIA SESUDAH KEMERDEKAAN

A. Pemerintahan Soekarno-Hatta (1945-1966)


Seteleh diproklamirkannya kemerdekaan Indonesia, masa tersebut disebutsebagai Orde
lama, dimana Soekarno bertindak sebagai kepala negara.Pada awal kemerdekan, Indonesia
menghadapi sebuah pertanyaan besar,apakah pemerintahan akan dijalankan berlandaskan ajaran
agama Islam ataukahsecara sekuler? Hal ini dipicu oleh tindakan dimentahkannya kembali
PiagamJakarta sehingga kedudukan golongan Islam merosot dan dianggap tidak bisamewakili
jumlah keseluruhan umat Islam yang merupakan mayoritas. Contohnya darikeseluruhan anggota
Komite Nasional Indonesia Pusat (KNIP) yang berjumlah 137 anggotanya, umat Islamhanya
diwakili oleh 20 orang, di BPKNIP yang beranggotakan 15 orang hanya 2 orang tokoh Islam
yang dilibatkan. Belum lagi dalam kabinet, hanya MenteriPekerjaan umun dan Menteri Negara
yang dipercayakan kepada tokoh Islam.Padahal Umat Islam mencapai 90% di Indonesia. Dalam
usaha untukmenyelesaikan masalah perdebatan ideologi diambillah beberapa
keputusan,salahsatunya adalah dengan mendirikan Kementrian Agama.
Pembentukan Kementrian Agama ini tidak lepas dari keputusan KomiteNasional Indonesia
Pusat (KNIP) dalam sidangnya pada tanggal 25-26 Agustus 1945 yang membahas tentang soal-
soal keagamaan digarap oleh suatu kementrian tersendiri, tidak lagi bagian tanggung jawab
kementrian Pendidikan. KementrianAgama resmi berdiri 3 Januari 1946 dengan Menteri Agama
pertama M. Rasyidiyang diangkat pada 12 Maret 1946. Dalam kementrian Agama ini terdiri dari
empat seksi masing-masing mewakili kaum Muslimin, Potestan, Katolik Roma,dan Hindu-
Budha.
Tujuan dan Fungsi Kementrian Agama:
1.Mengurus serta mengatur pendidikan agama di sekolah-sekolah sertamembimbing perguruan-
perguruan agama.
2. Mengikuti dan memperhatikan hal yang bersangkutan dengan Agama dan keagamaan.
3. Memberi penerangan dan penyuluhan agama.
4.Mengurus dan mengatur Peradilan Agama serta menyelesaikan masalah yang berhubungan
dengan hukum agama.
5. Mengurus dan mengembangkan IAIN, perguruan tinggi agama swasta dan pesantren luhur,
serta mengurus dan mengawasi pendidikan agama pada perguruan-perguruan tinggi.
6. Mengatur, mengurus dan mengawasi penyelenggaraan ibadah haji.
Meskipun Departemen Agama dibentuk, namun tidak meredakan konflik ideologi pada
masa sesudahnya.
Setelah Wakil Presiden mengeluarkan maklumat No.X pada 3 November 1945 tentang
diperbolehkannya pendirian partai-partai politik.Munculah antara lain Masyumi, Partai Sosialis
dan Partai Nasionalis Indonesia. Dalam kurun waktu 1950-1955 peranan parpol Islam
mengalami pasang surut.Padakabinet SoekarnoHattainimempunyaiempat masalah krusial yang
harus dselesaikan sepertigerakan Darul Islam,konsekuensi Perjanjian Renville, penyerahan
kedaulatan melalui KMB danpenanganan pemberontakan PKI pada 1948 di Madiun.
Setelah pemilu 1955 dimana terpilihnya Kabinet Ali Sostroamidjoyo II yang merupakan
koalisi PNI, Masyumi dan NU. Kabinet ini kemudian jatuh pada 1957 karena ingin ikut serta
dalam kekuasaan pemerintahan, selain itu PertidanMasyumi pun keluar dari kabinet karena
kurang setuju dengan kebijakan dalam menangani krisis di beberapa daerah. Pemerintahan pun
diambil alih oleh Presiden. Pada 1959, dikeluarkanlah Dekrit Presiden tentang
pembubarankonstituante dan sekaligus pemberlakuan kembali Undang-undang Dasar tahun
1945.DekritinisebenarnyainginmengambiljalantengahuntukmenyatakanbahwaPiagam Jakarta
terkandungdalam UUD 1945,
namuntampaknyakemudianmenjadiawalbergantinyasistemdemokrasi Liberal
bergantimenjadidemokrasiterpimpin.
Setelah dikeluarkannya Dekrit Presiden Pada
1959,sejumlahParpoldikebirikarenadianggapmenciptakanpemerintahan yang tidakefektif.
Beberapatindakansepertikristalisasi NU dan PSII, (namunPerti yang
dianggapwakilkelompokNASAKOM dibiarkantetapada), sedangkan yang terjadipadaMasyumi,
beberapapemimpinnya yang dianggappendukungsejatinegara Islam danoposisi yang
takberkesudahandipenjarakandanMasyumi di bubarkanpada 1960.Partaiislam yang tersisa (NU,
Pertidll) melakukanpenyesuaiandiridengankeinginanSoekarno yang didukungoleh ABRI dan
PKI. BeberapabentukpenyesuaiannyasepertipemberiangelarWaly Al-Amr al-Dahruri bi al-
SyaukahkepadaSoekarnooleh NU, danDoktorHonorisCausadari IAIN denganpromotor K.H.
SaifudinZuhri (salahsatupimpinan NU).
PascadibubarkannyaMasyumi, NU menjadiPartai Islam
terbesarpadawaktuitu.Beberapapihakmenganggap NU
sebagaipartaioportuniskarenasikapproaktifnya.Anggapaninikemudiandibantaholehpetinggi-
petinggiNU, merkaberalasanhalinisebagaibentukpengimbanganterhadapkekuatan
PKI.Namuntetapsajasecarakeseluruhanperananpartai Islam
mengalamiKemerosotan.Takadajabatanmenteripenting yang dipercayakankepadatokoh Islam
dalammasaDemokrasiTerpimpinini.Satu-satunyakepentingan Islam yang
diluruskanadalahkeputusan MPRS tahun 1960 yangmemberlakukanpengajaran agama di
Universitasdanperguruantinggi.Legislasi Islam
sebagaiideologinegaradianggapmepmberipengaruhnegatifterhadappemerintahan.
Akhirnyamasakejatuhankekuasaannya pun tiba.Kondisinegaraberkebalikandengan slogan-
slogan Soekarno yang padawaktuituiagembar-gemborkan. Denganinflasikeuangannegarasebesar
600 persen, maka era Soekarno pun berakhir, dengangagalnyaGeakan 30 September PKI tahun
1965, dimanaumat Islam bersama ABRI dangolongan lain bekerjasamamenumpasnya.1
B. Pemerintahan Soeharto (1967-1998)
Setelah berhasil melengserkan Sorkarno pada tahun1967, Soeharto mengukuhkan
kekuasaannya dan ia menjanjikan pemilihan umum pada 1967, namun pemilu dapat
dilaksanakan pada 1971yang diikuti 9 partai dan Golkar keluar sebagai pemenang dalam pemilu

1
http://wokalcharles.blogspot.com/2012/06/perkembangan-islam-setelah-kemerdekaan.html
tersebut. Diantara partai-partai Islam NU merupakan partai yang paling keras mengkritik Golkar.
NU menganggap bahwa pemilu yang diselenggarakan tidak demokratis, karena menggiring
rakyat dengan intimidasi dan ancaman agar memilih Golkar.
Pada 13 Juli 1975 telah disampaikan rancangan undang-undang partai politik dan golongan
karya oleh pemerintah kepada parlemen yang disetujui pada 14 Agustus 1975, tujuannya agar
penyelenggaraan pemilu berikutnya berlangsung pada 1977 hanya ada tiga partai: Golkar (partai
pemerintah), PPP (gabungan partai islam), PDI (peleburan dari partai nasional dan non-
islam).Selain itu, kebijakan orde baru tentang modernisasi (pembangunan) juga membawa
dampak positif bagi umat islam. Berkat pembangunan ekonomi, Indonesia berhasil
melaksanakan “Revolusi Pendidikan”. Hal ini menyebabkan semakin meningkatnya jumlah kelas
santri baru di Indonesia.
Berdasarkantekaddansemangattersebut, kehidupanberagamadanpendidikan agama
khususnya, makinmemperolehtempat yang
kuatdalamstrukturorganisasipemerintahandandalammasyarakatpadaumumnya.Dalamsidang-
sidang MPR yang menyusun GBHN sejaktahun 1973 hinggasekrang,
selaluditegaskanbahwapendidikan agama menjadimatapelajaran di sekolah-
sekolahnegeridalamsemuajenjangpendidikan, bahkanpendidikan agama
sudahdikembangkansejak Taman Kanak-Kanak.
C. Pemerintahan Bacharuddin Jusuf Habibie (1998-1999)
Dibawah pimpinan Presiden Habibie, 21 mei 1998 hingga 20 oktober 1999. Padasaatini pula
Indonesia harusmelepaskan TimorTimor. Pada sisi lain, dalam waktu relatifsingkat masa
pemerintahannya,Habibie menunjukkan prestasi kerjanya yang sangatmenakjubkan.
Beliauberhasil menyelamatkan krisis moneter dan melengkapi lahirnyaBank Muamalah dan
Bank Syariah. Hal ini sebagai pertanda bahwaPresiden habibie, tidakdapat diragukan lagi
kedekatannya dengan Ulama dan santri, apalagi iamenjadipendiri Ikatan Cendekiawan Muslim
Se-Indonesia ICMI yang pertama DiMalang.2
D. Pemerintahan Abdurrahman Wahid (1999-2001)
Dibawah pimpinan K.H Abdurrahman wahid, 23 oktober 1999hingga 22 juli 2001terjadi
goncangan situasi nasional diberbagai bidang tak dapat dielakkan.Dampaknya masa
pemerintahan K.H Abdurrahman Wahid sangat pendek.kesediaan K.H Abdurrahman Wahid

2
http://id.wikipedia.org/wiki/Ikatan_Cendekiawan_Muslim_Indonesia.
merupakan desakan dari Prof. Dr. Amin Raisyakni Ketua MPR dari Partai Amanat Nasional
yang menyatakanbahwa perlu adanya pergantian presiden jangan hanya dari perserikatan
Muhammadiyah saja.Sekarang waktunya presiden dari Nahdathul Ulama.Pada saat
menjelangpemilihan oleh MPR, calon Presiden Prof. Dr. Yusril Mahendra dari Partai Bulan
Bintang mengundurkan diri. Dengan tujuan agar suara Islam hanya untuk K.H Abdurrahman
Wahid.
Latar belakang proses pengangkatan K.H Abdurrahman Wahid sebagai Presiden RI ke-4 itu
menjadikan alumni pesantren untuk pertama kalinya, terpilih oleh MPR sebagai Presiden RI.
Dalam memanfaatkan masa keprsidennya, K.H. Abdurrahman Wahid banyak melakukan
kunjungan di berbagai negara. Presiden Abdurrahman Wahid membangun hubungan diplomatik
dan menumbuhkan kesan Indonesia tetap eksis pasca reformasi. Berita-berita dari Barat
merupakan news imperialism-penjajahan berita, bernuansa menegatifkan indonesia.
Digambarkan sebagai negara dan bangsa dengan mayoritas komunitas Islamnya sedang terpuruk.
Untuk melawannya, Presiden K.H. Abdurrahman Wahid dengan rombongan muhibahnya
memperlihatkan Indonesia tidak sebagaimana yang diberitakan oleh sumber berita barat yang
tidak bertanggung jawab.
Selain itu, dibawah presiden K.H. Abdurrahman Wahid, dalam upayanya menarik kembali
wiraniagawan cina yang eksodus dari Indonesia, dengan cara menghidupkan kembali Kong hu
Tsu. Dengan cara ini, diharapkan proses pembaruan bangsa atau hubungan etnis cinaNon
Pribumi dengan etnis Indonesia- Pribumi lainnya, akan semakin akrab.3
Namun, dalammasakepemerintahannyaAgama Islam seakanterseok-
seokdenganbanyaknyaFenomenakepemimpinan yang uniksehinggamasyarakatmuslim di
Indonesia bertanya-tanyadansangatmeragukanakankepemimpinannya.
Hal-halunik yang terjadipada Era K.H Abdurrahman Wahid diantaranya:
1. Mengatakan al-Qur’an sebagai kitab paling porno di dunia
2. Memperjuangkan pluralisme
3. Mengakui semua agama benar
4. Menjalin kerjasama dengan Israel
5. Mendukung gerakan kristenisasi
6. Membela Ahmadiyah

3
Ahmad Mansyur Suryanegara, 2010, Api Sejarah 2, (Bandung: Salamadani), hlm.532.
7. Ingin mengganti ucapan assalamu alaikum dengan selamat siang.
8. Tidak bersimpati terhadap korban Muslim pada perang Ambon.
9. Di dalam RUU Sisdiknas, Gus Dur lebih membela aspirasi kaum kafirin untuk
mentiadakan/mencabut pasal memasukkan pelajaran agama di sekolah-sekolah, dan justru
menentang aspirasi kaum Muslim agar pasal pelajaran agama di sekolah-sekolah
dimasukkan di dalam UU Sisdiknas. Di dalam hal ini, kaum Kristen menuntut supaya pasal
pendidikan agama dicabut dari sistem Sisdiknas, karena dengan demikian supaya kaum
Kristen semakin mudah mengkafirkan generasi Muslim di Indonesia.
10. Menginginkan Indonesia menjadi sekuler.
11. Di dalam RUU Pornografi, kembali Gus Dur lebih membela aspirasi kaum kafirin agar DPR
tidak mensahkan RUU Anti Pornografi menjadi undang-undang, dan justru menentang
aspirasi kaum Muslim supaya Indonesia / DPR mensahkan UU Anti Pornografi demi
menjaga moral bangsa. Pada moment inilah Gus Dur menyatakan bahwa Alquran adalah
kitab paling porno se-Dunia!
12. Gus Dur ikut bersama kaum kafirin merangsek untuk menuntut Pemerintah mencabut pasal
penodaan agama. Padahal pasal itu amat sentral demi terjaminnya kerukunan umat
beragama. Yang dibidik Gusdur adalah kaum Muslim, supaya kaum Muslim tidak berkutik
ketika agama nya dihina.
13. Gusdur ikut bersama kaum kafirin merangsek untuk menuntut Pemerintah mencabut pasal
pendirian rumah ibadah melalui Judicial Review ke Mahkamah Konstitusi. Padahal pasal itu
amat sentral demi terjaminnya kerukunan umat beragama. Yang dibidik Gusdur adalah
kaum Muslim, supaya kaum Muslim tidak berkutik ketika kaum kafirin membangun Gereja
di mana-mana.
14. Dibaptis. Ini pertanda bahwa Gus Dur adalah munafik. Kalau memang ia benar-benar
murtad dari Islam, maka hal itu tidak masalah sama sekali. Namun belakangan ia masih juga
mengaku Muslim, dan pembaptisannya itu ia gunakan untuk menyerang Islam.
15. Pemberian Raja Brunei untuk rakyat Indonesia yang kala itu sedang kelaparan, dimakan
sendiri oleh Gus Dur. Dia bilang bahwa pemberian Raja Brunei itu adalah untuk pribadinya
saja.
16. Menyerukan supaya MUI (Majelis Ulama Indonesia) dibubarkan.
17. Merestui dan membela Inul dengan goyang ngebornya, padahal semua Ulama sudah
mengutuknya.
18. Menghadiri dan mendukung kontes kecantikan ala WARIA.
19. Ziarah dan berdo’a di salah satu Gereja di Jakarta.
20. Ziarah dan berdo’a di Watu Pinabentengan di kakas MINAHASA atas saran seorang
pendeta Kristen yang katanya bisa meramal masa depan.4
E. Pemerintahan Megawati soekarno Putri (2001-2004)
Pembaharuan yang dilaksanakan secara drastis, menimbulkan kesulitan yang besar.
Berakhirlah masa kepresidenan K.H. Abdurrahman Wahid. Akhirnya, sidang DPR-MPR
memutuskan, mengangkat wakil Presiden Megawati menjadi Presiden, 23 Juli 2001hingga 20
Oktober 2004. Terpilihnya Megawati menjadi Presiden ini merupakan catatan buram Peradaban
Islam di Indonesia yang mana mayoritas umat Islam harus dipimpin oleh seorang pemimpin
wanita, padahal jelas sekali dalam Al-Qur’an dan
Haditsbahwasanyamenyerahkankekuasaankepemimpinan suatu negeri yang cakupannya sangat
luaskepadaperempuantidakakanberbahagia.
PadamasaPresiden Megawati beliaumenerimatamuutusanPresidenAmerikaSerikat, Menteri
Negara UrusanKeamananDalamNegeriAmerikaserikat Tom Ridge, 10 Maret 2004,
menyampaikanpesankepadaPresidenMegawati Soekarnopoetri, agar Abu
BakarBa’asyirditangkapdandipenjarakandengandiadiliulang.PesantrenNgruki Surakarta
sebenarnyakampusnyakecil, tidaksehebatkantor CIA, danorganisasitatakerjanya pun
tidaksecanggih CIA AmerikaSerikat, dan K.H. Abu
BakarBa’asyirsudahberusialanjutnamunmengapasangatdiperhitungkandanditakutikeberadaannya
olehAmerikaSerikat.
F. Pemerintahan Susilo Bambang Yudhoyono (2004-2014)
Pada masa pemerintahannya, beliau banyak memfokuskan pada tatanan perekonomian,
social, dan pendidikan masyarakat Indonesia. Program-program yang
dicanangkanpadamasakepemerintahannyadiantaranyaadalah:
1. BantuanKesejahteraan Guru yangDitingkatkan
2. BantuanOperasionalSekolah

4
http://www.voa-islam.com/read/indonesiana/2013/12/25/28333/wahai-muslim-belajarlah-dengan-akhir-hidup-
gus-dur-sesudah-di-baptis/
3. Upah Minimum GajiBuruh yang mulaidinaikkan
4. BantuanKesehatan
5.BantuanLangsungTunai
G. Pemerintahan Jokowi (2014-Sekarang)
Tahun 2014 tepatnya tanggal 20 Oktober Indonesia memasuki tahun dimana masa
pergantian kepemimpinan Negara Republik Indonesia yang sebelumnya dipimpin oleh Susilo
Bambang Yudhoyono selama 2 Periode. Dalam masa pergantian kepemimpinan banyak
peristiwa terjadi yang cukup menghebohkan suasana politik di Indonesia antara pendukung
mayoritas ormas Islam dengan pendukung partai Nasionalis yang berkoalisi dengan beberapa
partai Islam. Setelah melewati fase-fase pemilihan demokratis terpilihlah Presiden RI Indonesia
yang ke- 7 beliau adalah Ir. Joko widodo, hubungan kedekatan beliau dengan Megawati, partai
Nasionalis serta NegaraNegara Adidaya membuat namanya menjulang tinggi dalam kursi
kepemimpinan.
Diawal Pemerintahannya beliau berani menaikkan harga BBM sehingga membuat
masyarakat menjadi resah, banyak kabinet kepemerintahan yang dibentuk sangat menghambat
kemajuan Islam di Indonesia karena didalamnya terdapat Orang Non Islam dan Liberal yang
tidak Pro kebijakan Islamcontohmasalah yang sedanggencar-
gencarnyadisepertilamabatnyapenanganankasusdugaanpenistaan agama islam yang di
lakukanolehbasukitjahyapurnama.
H. Bentuk Hasil Peradaban Islam Di Indonesia Setelah Kemerdekaan-Sekarang
1. Departemen Agama
Padamasakemerdekaanmasalah-masalah agama
secararesmidiurussatulembagayaituDepartemen Agama.KeberadaanDepartemen Agama
dalamstrukturpemerintahRepublik Indonesia melalui proses panjang.
SebagaibagiandaripemerintahnegaraRepublik Indonesia; Kementerian Agama didirikanpada 3
Januari 1946
tepatnyapadamasapemerintahanSoekarno.DasarhukumpendirianiniadalahPenetapanPemerinta
htahun 1946 Nomor I/SD tertanggal 3 Januari 1946.
2. Bidang Lembaga Pendidikanseperti:
Madrasah Ibtida`iyyahNegeri (MIN) setingkat SD dengan lama belajar 6 tahun,
Madrasah TsanawiyyahNegeri (MTsN) setingkat SMP lama belajar 3 tahun, dan Madrasah
‘AliyahNegeri (MAN) setingkat SMA lama belajar 3
tahun.Selainitutuntutanuntukmendirikanperguruantinggijugameningkat.Sebelumkemerdekaan
sebenarnyasudahberdiriperguruantinggipertama, yaituSekolahTinggi Islam
didirikanolehPersatuan Guru-guru Agama Islam (PGAI) di Padang.Di Jakarta didirikan STI
(SekolahTinggi Islam) padaJuli 1945 olehbeberapapemimpin Islam, yaituHattadan M.
Natsir.Karenapergolakankemerdekaan, STI dipindahke Yogyakarta danpada 22 Maret 1945
STI berubahmenjadi UII (Universitas Islam Indonesia).Setelahkemerdekaan di
Yogyajugadibuka UGM (UniversitasGadjahMada).
Pemerintahkemudianmenawarkanuntukmenegerikan UII dan UGM.UII
menerimadengansyarat di bawahnaunganDepartemen Agama.Akhirnyahanyasatufakultas
yang dinegerikan, yaituFakultas Agama.KemudianFakultas Agama UII berubahmenjadi
PTAIN (PerguruanTinggi Agama Islam Negeri). Di Jakarta dibuka ADIA (
AkademiDinasIlmu Agama), yang pada Mei 1960 digabungkandengan PTAIN
olehDepartemen Agama menjadilah IAIN yang berkedudukan di Yogyadanbercabang di
Jakarta. SetelahbeberapatahunDepartemen Agama memisahkan IAIN menjadidua yang
masing-masingberdirisendiri, yaitu IAIN Yogyadan IAIN Jakarta.
Sejalandenganperkembangannya, IAIN bertambahpesatdanmelahirkancabang-cabangnya
di pelbagaiwilayah.Selainitu, perguruantinggiswastajugabermunculan di antaranya UNJ, UM,
UNISBA, dan UNISMA.Padatahun 2002, IAIN SyarifHidayatullahberubahmenjadi UIN
(Universitas Islam Negeri) SyarifHidayatullah yang di
dalamnyamenyelenggarakanpendidikanselainfakultas-fakultas agama -
sepertiFakultasIlmuTarbiyahdanKeguruan, FakultasAdab, danIlmuHumaniora,
FakultasUshuluddindanFalsafah, FakultasSyari’ahdanHukum,
FakultasDakwahdanKomunikasi- jugamembukaFakultasPsikologi,
FakultasEkonomidanSosal, FakultasSainsdanTekhnologi, dan program pascasarjana.
JugasedangdirancangpendirianFakultasKedokterandanIlmuKesehatan.5
3. BidangIlmuPengetahuan
Indonesia memiliki banyak para ilmuwan-ilmuwan, namun penghargaan terhadap para
ilmuwan tersebut di Negara sendiri masih kurang diperhatikan, banyak para ilmuwan
Indonesia malah berkarir di Negara luar dikarenakan mereka lebih di hargai dan di hormati,

5
http://annahdhahmuslimahhidayatullah.blogspot.com/2012/01/perkembangan-seni-budaya-islam-dan.html
dengan latar belakang tersebut maka para ilmuwan di Indonesia melakukan suatu konferensi
yang menghasilkan Ikatan Cendekiawan Muslim se-Indonesia ( ICMI)
4. BidangEkonomi
DalampermasalahanekonomipemerintahmembuatBazis (badanamil zakat infaqshodaqoh)
kemudiandibentukjugakoperasi-koperasiumatdan bank perkreditanrakyat, seperti NU
mendirikan bank NusumadanMuhammadiyahmendirikan bank Matahari.
Selanjutnyaberdirilah bank islampertamatanpabunga, yakni bank Muamalat.Sejarah bank
syariah di Indonesia, pertama kali dipeloporioleh Bank Muamalat Indonesia yang
berdiripadatahun 1991. Bank inipadaawalberdirinyadiprakarsaiolehMajelisUlama Indonesia
(MUI) danpemerintahsertamendapatdukungandariIkatanCendekiawan Muslim Indonesia
(ICMI) danbeberapapengusahamuslim. Padasaatkrisismoneter yang terjadipadaakhirtahun
1990, bank inimengalamikesulitansehinggaekuitasnyahanyatersisasepertigadari modal awal.
IDB kemudianmemberikansuntikandanakepada bank inidanpadaperiode 1999-sekarang.
5. Bidang Politik dan Sosial
Organisasi islam setelah kemerdekaan semakin berkembang terlihat dengan
bermunculannya organisasi kemasyarakatan baik yang ruang lingkupnya mikro maupun
makro. Dengan bermunculannya Ormas-Ormas Islam tersebut, Negara Indonesia zhahirnya
telah menampakkan kemayoritasan agama yang mayoritas agama yang dipeluk oleh warga
Indonesia adalah agama Islam. Banyak Ormas Islam yang tersebar di wilayah Indonesia,
diantaranya:
a. Muhammadiyah
b. NU
c. Persis
d. PKS
e. MUI
f. PUIdan lain-lain.