Anda di halaman 1dari 1764

Tugas Farmakoepidemiologi

Kelas A-E Tahun ajaran 2015/2016

Terjemahan E-Book
Farmakoepidemiologi

APA ITU FARMAKOEPIDEMOLOGI ?

Dalam beberapa dekade terakhir, pengobatan modern telah diberkati dengan


armamentarium farmasi yang jauh lebih kuat daripada apa yang telah ada
sebelumnya. Meskipun penyedia layanan kesehatan telah memberikan
kemampuan memberikan perawatan medis yang lebih baik bagi pasien mereka,
namun menghasilkan kemampuan untuk melakukan kejahatan yang jauh lebih
besar. Hal ini juga dihasilkan oleh sejumlah besar kewajiban produk yang sesuai
terhadap produsen farmasi, beberapa yang sesuai dan ada yang tidak sesuai.
Bahkan, sejarah regulasi obat sejajar dengan riwayat reaksi obat yang
merugikan utama "bencana." Setiap perubahan dalam hukum farmasi adalah
reaksi politik untuk epidemi reaksi obat yang merugikan. Data terbaru
menunjukkan bahwa 100 000 orang Amerika meninggal setiap tahun dari reaksi
obat yang merugikan (ADR), dan 1,5 juta US rumah sakit setiap hasil tahun dari
ADR; Belum, 20-70% dari ADR mungkin preventable. Bahwa kerugian obat
juga dapat menyebabkan perkembangan dibidang pharmacoepidemiology, yang
merupakan fokus dari buku ini. Baru-baru ini, juga telah memperluas fokus
untuk mencakup banyak masalah selain efek samping.

Untuk memperjelas apa yang ada, dan apa yang tidak , termasuk dalam disiplin
pharmacoepidemiology , bab ini dimulai dengan mendefinisikan
pharmacoepidemiology , membedakan dari bidang lain yang terkait. Ulasan
sejarah regulasi obat akan secara singkat dan selektif, sebagai contoh fokus pada
pengalaman AS, baru ini menunjukkan bagaimana ia telah menyebabkan
pengembangan lapangan. Selanjutnya, proses regulasi - tory saat ini untuk
persetujuan obat baru akan ditinjau , dalam rangka untuk menempatkan
penggunaan pharmacoepidemiology dan pengawasan obat postmarketing dalam
perspektif yang tepat. Demikian, maka potensi kontribusi ilmiah dan klinis
pharmacoepidemiology akan dibahas.

DEFINITION OF PHARMACOEPIDEMIOLOGY

Pharmacoepidemiology adalah studi tentang penggunaan dan efek obat dalam


masyarakat dalam jumlah besar. The pharmacoepidemiology jelas mengandung
dua komponen : " pharmaco " dan " Epidemiologi " Dalam rangka untuk lebih
menghargai dan memahami apa dan apa yang tidak termasuk dalam bidang baru
ini , hal ini berguna untuk membandingkan ruang lingkup dengan bidang
lainnya yang terkait. Ruang lingkup pharmacoepidemiology pertama akan
dibandingkan dengan farmakologi klinis, dan kemudian itu epidemiologi.

PHARMACOEPIDEMIOLOGY VERSUS CLINICAL

PHARMACOLOGY

Farmakologi adalah studi tentang efek obat. Farmakologi klinis adalah studi
tentang efek obat pada manusia (lihat juga Bab 4). Pharmacoepidemiology jelas
dianggap, oleh karena itu, termasuk dalam Pharmacol-ogy klinis. . Dalam usaha
untuk mengoptimalkan penggunaan obat-obatan, salah satu prinsip utama
farmakologi klinis adalah bahwa terapi harus individual, atau disesuaikan
dengan kebutuhan pasien tertentu. Individualisasi terapi ini menghalangi-
mination dari rasio risiko / manfaat khusus untuk pasien. Melakukan hal ini
memerlukan prescriber untuk menyadari efek yang menguntungkan dan
bersangkutan dengan potensi obat yang merugikan dan untuk mengetahui
bagaimana elemen status klinis pasien dapat memodifikasi probabilitas hasil
terapi yang baik. Misalnya, mempertimbangkan pasien dengan infeksi serius,
kerusakan hati yang serius, dan gangguan ringan fungsi ginjal nya. Dalam
mempertimbangkan apakah akan menggunakan gentamisin untuk mengobati
infeksi, itu tidak cukup untuk mengetahui bahwa gentamisin memiliki
probabilitas kecil menyebabkan penyakit ginjal. Seorang dokter yang baik harus
menyadari bahwa seorang pasien yang telah memiliki gangguan fungsi hati
berada pada risiko yang lebih besar menderita efek samping ini dibandingkan
dengan yang memiliki fungsi hati normal. Pharma-coepidemiology dapat
berguna dalam memberikan informasi tentang efek menguntungkan dan
merugikan dari obat apapun, sehingga memungkinkan penilaian yang lebih baik
dari keseimbangan risiko / manfaat bagi penggunaan obat tertentu dalam setiap
pasien tertentu.

Farmakologi klinis secara tradisional dibagi menjadi dua dasar: farmakokinetik


dan farmakodinamik. Farmakokinetik adalah studi tentang hubungan antara
dosis obat yang diberikan dan serum atau tingkat yang dicapai oleh darah. Ini
berkaitan dengan penyerapan obat, distribusi, metabolisme, dan ekskresi.
Farmakodinamik adalah ilmu yang mempelajari hubungan antara kadar obat
dan efek obat. Bersama-sama, kedua bidang ini memungkinkan seseorang
untuk memprediksi dan mengamati efek yang mungkin terjadi pada pasien dari
pemberian rejimen obat tertentu. Pharmacoepidemiology mencakup unsur-unsur
dari kedua bidang tersebut, menjelajahi efek dicapai dengan pemberian rejimen
obat. Ini biasanya tidak melibatkan atau memerlukan pengukuran kadar obat.
Namun, pharmacoepidemiology dapat digunakan untuk menjelaskan
farmakokinetika obat, seperti menjelajahi apakah aminofilin lebih mungkin
menyebabkan mual ketika administrasi yang terjadi pada pasien secara
bersamaan saat menggunakan simetidin. Secara khusus, bidang
pharmacoepidemiology terutama bersangkutan dengan studi efek samping obat.
Reaksi merugikan secara tradisional diciptakan separ yang merupakan hasil
dari efek farmakologi berlebihan tetapi sebaliknya, kadang-kadang disebut
reaksi tipe A, dibandingkan dengan efek yang menyimpang yang disebut Tipe B
reactions.

Tipe A reaksi cenderung menjadi umum , berhubungan dengan dosis ,


diprediksi , dan kurang serius. Biasanya dapat diobati hanya dengan
mengurangi dosis obat, cenderung terjadi pada individu yang memiliki salah
satu dari tiga karakteristik. Pertama , individu mungkin telah menerima obat
lebih dari yang diperlukan. Kedua, mungkin mereka telah menerima sejumlah
konvensional obat, tetapi mungkin metabolisme atau eksresinya lambat. Ketiga ,
mungkin mereka memiliki tingkat obat yang normal , tapi untuk beberapa
alasan yang terlalu sensitif terhadap mereka.

Pendekatan yang biasa untuk mempelajari reaksi obat yang merugikan telah
menjadi koleksi laporan spontan morbiditas terkait obat atau kematian (lihat
Bab 9 dan 10). Namun, menentukan sebab-akibat dalam laporan kasus efek
samping dapat menjadi masalah (lihat Bab 36), seperti dapat mencoba untuk
membandingkan efek dari obat di kelas yang sama. Hal ini telah menyebabkan
peneliti akademis, industri, FDA, dan masyarakat hukum untuk beralih ke
bidang epidemiologi. Secara khusus, studi efek samping telah dilengkapi
dengan studi dari efek samping. Di bekas, peneliti examinecase laporan reaksi
obat yang merugikan diakui dan upaya untuk membuat penilaian klinis subjektif
secara individual tentang apakah hasil buruk itu sebenarnya disebabkan oleh
paparan obat. Dalam kedua, studi terkontrol yang dilakukan dengan memeriksa
apakah hasil yang merugikan diteliti lebih sering terjadi pada populasi terkena
daripada di populasi yang tidak terpapar. Dari bidang farmakologi klinis dan
epi-demiology telah menghasilkan pengembangan bidang baru:
pharmacoepidemiology.

PHARMACOEPIDEMIOLOGY VERSUS
EPIDEMIOLOGY

Dengan demikian, pharmacoepidemiology adalah bidang terapan yang relatif


baru, menjembatani antara farmakologi klinis dan epidemiologi. Dari
farmakologi klinis, pharmacoepi-demiology fokus penyelidikan. Dari
epidemiologi, pharmacoepidemiology meminjam metode-metode penyelidikan.
Dengan kata lain, itu berlaku metode epidemiologi untuk area konten
farmakologi klinis. Dalam proses ini, beberapa pendekatan logistik khusus telah
dikembangkan dan beberapa masalah metodelogi khusus telah muncul. Ini
adalah fokus utama buku ini. Sejarah regulasi obat di AS adalah mirip dengan
yang di sebagian besar negara maju, dan mencerminkan meningkatnya
keterlibatan pemerintah dalam upaya untuk memastikan bahwa hanya aman dan
efektif produk obat yang tersedia dan bahwa manufaktur dan pemasaran praktek
yang tepat digunakan. Hukum AS awal, Pure UU Obat dan Makanan, disahkan
pada tahun 1906, dalam menanggapi pemalsuan berlebihan dan misbranding
makanan dan obat-obatan yang tersedia pada saat itu. Tidak ada restric-tions
pada penjualan atau persyaratan untuk bukti kemanjuran atau keamanan obat
dipasarkan. Sebaliknya, hukum Pemerintah Federal hanya memberi kekuatan
untuk menghapus pasar produk yang dipalsukan atau misbranded. Beban
pembuktian ada di Pemerintah Federal.

Pada tahun 1937, lebih dari 100 orang meninggal akibat gagal ginjal sebagai
akibat dari pemasaran oleh Perusahaan Massengill dari obat mujarab
sulfanilamida dilarutkan dalam glycol.5 dietilen tanggapan, Makanan, Obat, dan
Kosmetik Act disahkan pada tahun 1938. praklinis pengujian toksisitas adalah
diperlukan untuk pertama kalinya. Selain itu, produsen diharuskan untuk
mengumpulkan data klinis tentang keamanan obat dan untuk mengirimkan data
ini ke FDA sebelum pemasaran obat. FDA memiliki 60 hari untuk mengajukan
keberatan marketing atau yang lain itu akan melanjutkan. Tidak ada bukti
khasiat yang diperlukan. Pada musim dingin tahun 1961, dunia mengalami
terkenal "bencana thalidomide." Thalidomide dipasarkan sebagai hipnosis
ringan, dan tidak memiliki keuntungan jelas atas obat lain di kelasnya. Tak lama
setelah pemasaran, peningkatan dramatis terlihat di frekuensi cacat lahir yang
sebelumnya jarang, phocomelia-tidak adanya anggota badan atau bagian
anggota badan, beberapa kali dengan kehadiran bukannya flippers.12 Studi
epidemiologi didirikan penyebabnya berada di utero paparan thalidomide. Di
Inggris, ini mengakibatkan pembentukan pada tahun 1968 dari Komite
Keselamatan Obat. Kemudian, Organisasi Kesehatan Dunia mendirikan biro
untuk mengumpulkan dan menyusun informasi dari ini dan organisasi
pemantauan obat nasional serupa lainnya (lihat Bab 10).

Di Negara US sudah pernah dizinkan untuk pemasaran thalidomide dan


untungnya terhindar dari epidemic ini. Namun obat thalidomide menjadi
masalah atau bencana yang begitu dramatis yang mengakibatkan perubahan
peraturan di Negara US juga. pada tahun 1962 amandemen Kefauver-Harris
telah dikeluarkan. ini mengubah kenyataan yang diperkuat dengan persyaratan
untuk bukti keamanan obat ini memerlukan uji praklinis toksikologi dan
farmakologi pengujian secara ekstensif sebelum obat dapat di uji di manusia.
Data studi ini di haruskan untuk disampaikan kepada FDA dalam penelitian
aplikasi obat baru (IND) sebelum studi klinis bisa di mulai, ada tiga fase
eksplisit uji klinis telah didefinisikan, dijelaskan secara lebih rinci dibawah ini,
selain itu caru memerlukan dan ditambahkan untuk uji klinis untuk bukti
substansial bahwa obat akan memiliki efek yang dimaksutkan atau mewakili
“bukti substansi” dapat didefinisikan sebagai untuk memadai dan dengan baik
di control penyelidikan termasuk penyelidikan atau penelitian secara klinis.
secara fungsional ini umumnya telah ditafrsirkan sebagai uji klinis acak untuk
khasiat obat dokumen sebelum pemasaran. prosedur baru ini juga tertendu
pemasarannya obat sampai FDA secara eksplisit meberikan persetujuan dengan
bebrapa modifikasi ini adalah persyaratan masih di tempatkan di Amerika
Serikat hari ini. selain itu amandemen diperlukan untuk tinjauan terhadap
semua obat yang disetujui antara di tahun 1938-1962 untuk menetukan jika obat
itu telah berkhasiat. Proses khasiat obat yaitu studi implemantasi (DESI),
dilakukan oleh National Academy of Sciences National Research Council
dengan dukungan dari kontrak FDA yang tidak selesai sampai baru-baru ini,
dana mengakibatkan penghapusan dari pasar AS banyak yang obat tidak efektif
dan kombinasi obat. Hasil dari semua perubahan ini adalah perpanjangan besar
proses persetujuan, dengan kenaikan biaya pengembangan obat, obat yang
disebut lag. 13 namun obat-obatn yang dipasarkan mungkin jauh lebih aman dan
lebih efektif.

14-18
Dipertengan tahun 1960-an juga melihat publikasi dari serangkain studi .
studi ini tentang pemanfaatan obat dengan menyediakan inforamsi deskriptif
pertama tentang bagaimana dokter menggunakan obat-obatan dan memulai
serangkaian penelitian frekuensi dan mencegah miskinnya peresepan (lihat juga
di bab 27-29).

Dengan semua perkembangan ini, di tahun 1960- an dapat diperkirakan telah


menandai awal dari bidang farmasi-coepidemiologi.

Meskipun proses yang lebih ketat untuk peraturan obat, akhir tahun
1960,1970,1980 an dan terutama pada tahun 1990 an dan tahun 2000 an ini
melihat serangkaian reaksi merugikan suatu obat. Subakut myelo-optik-
neuropati (SMON) ditemukan oleh clioquinol, obat yang dipasarkan di awal
tahun 1930-an tetapi tidak ditemukan reaksi yang meyebabkan menjadi parah
neurologis sampai di tahun 1970. Di tahun 1970-an , dibersikannya sel-sel
adenokarsinoma leher rahim dan vagina dan malformasi genital lain ditemukan
karena paparan dalam rahim selama dua dekade.
pertengahan tahun 1970-an melakukan penemuan sindrom oculomucocutaneous
disebabkan oleh protocol, lima tahun setelah obat di pasarkan. Dibagian dalam
menaggapi kekhawatiran tentang efek samping obat, pada awal tahun 1970
dilihatnya semakin berkembang obat epidemiologi unit, sekarang
Sloneepidemiologi pusat, yang diperpanjang dengan pendekatan berbasis rumah
sakit Boston kolaborasi obat program pengawasan (bab 35) dengan
mengumpulkan sejarah paparan obat seumur hidup dari pasien rawat inap dan
menggunakan ini untuk melakukan denga berbasis rumah sakit case-control
(lihat di bab 11). taun 1976 ada pembentukan komisi bersama pada penggunaan
obat resep, komite inter disipliner ahli untuk meninjau keadaan seni
farmakoepidemiolgi pada waktu itu, serta memberikan rekomendasi untuk
kedepannya. Terkomputerisasi Online Medical analisis dan system survey
pertama kali dikembangkan pada tahun 1977, menggunakan data medis untuk
melakukan penelitian pharmakoepidemiologi. Unit penelitian obat surveilans
sekarang disebut dengan keamanan obat penelitian ini dikembangkan di Inggris
pada tahun 1980 dengan system inovatif resep monitoring. masing-masing
mewakili kontribusi besar ke bidang pharmakoepidemilogi, ini dan lebih baru
dengan pendekatan ditinjau dalam bagian III dari buku ini.

Pada tahun 1980, obat ticrybafen tercatat menyebabkan kematian pada penyakit
hati. Pada tahun 1982, benoxaprofen tercatat untuk melakukan yang sama.
kemudian penggunaan zomepirac, obat antiinflamasi non steroid lain, tercatat
untuk menjadi asosiasi dengan peningkatan resiko reaksi anaphylactoid.
penyakit darah yang serius discrasias terkait dengan phenylbutazone. Perforisi
usus kecil disebabkan oleh pelepasan lambat tertentu dengan perumusan
indhomethasin. Bendectin, kombinasi obat ditujukan untuk mengobati mual dan
muntah pada kehamilan, dihapus dari pemasaran karena litigasi yang
mengklaim itu adalah teratogen, meskipun tidak adanya bukti ilmiah yang sah
untuk membenarkan klaim ini. panggul aku rasa sakit dan reversible gagal
ginjal akut disebabkan oleh suprofen. Isotretoin adalah hamper dihapus dari
pasar AS karean menyebabkan cacat kelahiran. Eosinofilia-mialgia dikaitkan
dengan merek tertentu L-triptophan. Triazolam, dianggap oleh Belanda pada
tahun 1979 untuk penyakit yang tidak proposional yang mempunyai efek
samping system saraf pusat, 36 ditemukan oleh seluruh dunia problematika
diawal 1990. 37-39 silikon implant payudara, dimasukkan oleh jutaan di AS
untuk tujuan kosmetika, yang menyebabkan kanker, penyakit rematologi dan
banyak masalah lain, dan dilarang untuk digunakan kecuali rekonstruksi
payudara setelah masektomi. insulin untuk manusia dipasarkan sebagai salah
satu yang pertama dari Bioteknologi baru obat-obatan, tetapi setelah itu
menyebabkan jumlah yang tidak proposional hypoglikemia. Fluxetine
dipasarkan sebagai pentingnya utama dan sukses secara komersial psikistrik
kotak produk baru, tapi kemudian kehilangan sebagian besar pemasaran karena
tuduhan tentang asoiasi dengan bunuh diri. Sebuah epidemic kematian asma di
selandia baru di telusuri untuk fenoterol, dan data itu kemudian menyarankan
yang sama meskipun kecil, resiko mungkin hadir dengan inhaler. beta-agonis
lain kemungkinan menyebabkan kanker dari depot-medroxyprogesterone,
mengakibatkan awal penolakan untuk memungkinkan para pemasaran untuk
kontrasepsi di AS, beberapa studi dan ultima persetujuan, aritmia terkait untuk
penggunaan antihistamin terfenadine dan astemizole . hipertensi dan stroke
diperhatikan dari post-partum penggunaan bromocriptine. beberapa reaksi
merugikan yang berbeda terkait dengan temafloxacin. contoh lain yang temasuk
toksistas hati dari amoxicillin-clavulanic acid; toksisitas hati dari bromfenac;
kanker , serangan jantung dan pendarahan gastrointestinal dari calcium channel
blocker aritmia dengan cisapride interaksi; pulmonary utama hipertensi dan
penyakit katup jantung dari dexfenfluramide dan fenfluramine; pencernaan
berdarah, pendarahan pasca bedah, kematian dan banyak reaksi yang
merugikan lainnya yang terkait dengan ketorolac; beberapa obat interaksi
dengan mibefradil; trobosis dari baru kontrasepsi oral; infark miokard dari
sildenafil; kejang dengan tramadol; reaksi anafikalsis dari vitamin K; toksisitas
hati dari troglitazone; dan intususepsi dari rotavirus vaccine. sejak edisi
sebelumnya buku ini, krisis obat telah terjadi dikarenakan dugaan tindak
ischemic colitis dari alosterol; rhabdomyolysis dari cerivastatin; bronkospasme
dari rapacuronium; torsade dari ziprasidone; stroke hemorogik
phenylpropalamine; artralgia, mialgia dan kondisi neurologis dari vaksin
antraks; myocarditis dan infark miokard dari vaksin cacar; jantung dan stroke
dari rofecoxib. 22 berbeda resep obat produk obat telah dihapus atau dicabut
dari pasaran AS sejak tahun 1980, alosteron tahun (2000), astemizole tahun
(1999), benoxaprofen tahun (1982), bromfenac tahun (1998), cerivastatin
tahun (2001), cisapride tahun (2000), dexfenfluramine tahun (1997), encainide
tahun (1991), fenfluramine tahun (1998), flosequinan tahun (1993), grepafloxin
tahun (1999), mibefradil tahun (1998), nomifensine tahun (1986),
phenylpropalamine tahun (2000), rapacuronium tahun (2001), rofecoxib tahun
(2004), suprofen tahun (1987), terfenadine tahun (1998), temafloxacin tahun
(1992), ticrynafen tahun (1980), troglitazone tahun (2000), dan zomepirac
tahun (1983).

Lisensi vaksin terhadap rotavirus dan lyme yang juga baru saja di cabut karena
suatu masalah keamanan. pada tahun 1990 dan 2004 sedikitnya 13 bebas obat
jantung yang patut untuk dilakukan tindakan regulasi yang signifikan karena
masalah penyakit jantung, termasuk astemizole,cisapride, droperidol,
grepafloxacin, halofantrine, pimozide, rofecoxib, sentindole, terfenadine,
terodiline, thioridazine, vevacetylmethadol, dan ziprasidone.

Dalam beberapa contoh obat yang tidak pernah meyakinkan dikaitkan dengan
reaksi merugikan, namun banyak penemuan ini menyebabkan penghapusan atau
pencabutan obat dari pasar, namun penarikan ini tidak selalu dilakukan di
semua Negara yang berbeda di mana masing-masing obat dipasarkan. sebagian
penemuan ini menyebabkan litigasi, seperti yang baik dan beberapa bahkan
menyebabkan tuntutan pidana terhadap produsen farmasi dan beberapa
karayawan. masing-masing adalah tentang keseriusan tentang efek obat, dan
efek serius tapi obat lain telah menyebabkan pencarian yang dipercepat untuk
metode baru untuk mempelajari efek obat dalam jumlah besar pasien. Hal ini
menyebabkan pergeseran dari efek buruk dari kejadian yang merugikan.

Tahun 1990-an dan terutama tahun 2000-an telah melihat pergeseran lain di
lapangan, jauh dari penekanan eksklusif pada pemanfaatan obat dan efek
samping, untuk masuknya kepentingan lain juga, seperti penggunaan
pharmacoepidemiology untuk mempelajari efek obat menguntungkan,
penerapan ekonomi kesehatan untuk mempelajari efek obat, kualitas-of-hidup
studi, meta-analisis, dll ini fokus baru dibahas secara lebih rinci dalam Bagian
IV dan V dari buku ini.

tahun terakhir telah melihat meningkatnya penggunaan sumber daya ini data
dan metodologi baru, dengan kekhawatiran lanjutan dan bahkan berkembang
tentang efek samping. The American Society Farmakologi Klinik dan Terapi
dikeluarkan, pada tahun 1990, sebuah makalah posisi pada penggunaan studi
pengawasan obat postmar-marketing diklaim untuk tujuan promosi, 107 dan
Masyarakat Internasional untuk Pharmacoepidemiology dikeluarkan, pada
tahun 1996, Pedoman Baik Epidemiologi Praktik untuk Obat , Device, dan riset
Vaksin di Amerika Serikat, yang baru-baru ini updated.108 pada akhir 1990-an,
penelitian pharmacoepidemiologic telah semakin terhambat oleh kekhawatiran
tentang confidentiality109-113 pasien (lihat juga Bab 38).

Secara organisasi, di AS, Resep Obat Biaya Pengguna Undang-Undang


(PDUFA) Tahun 1992 memungkinkan FDA AS untuk biaya produsen biaya
untuk meninjau aplikasi baru Drug. Ini tersedia sumber daya tambahan untuk
FDA, dan sangat mempercepat proses Aturan baru di AS, dan di beberapa
negara lain, sekarang mengizinkan langsung konsumen dapat mengiklankan
resep obat. Hasilnya adalah sebuah sistem di mana lebih dari 330 obat baru
telah disetujui oleh FDA pada 1990-an. Masing-masing obat biaya $ 300-500
juta untuk dikembangkan; pengembangan biaya obat industri farmasi total $ 24
milyar pada tahun 1999 dan $ 32 miliar pada tahun 2002.

Namun, dana dari PDUFA 1992 awalnya dilarang digunakan untuk regulasi
keamanan obat. Pada tahun 1998, dimana 1400 karyawan FDA bekerja dengan
proses persetujuan obat, hanya 52 dipantau aman; FDA hanya menghabiskan $
2,4 juta pada penelitian keamanan luar sekolah. Ini bertepatan dengan
meningkatnya jumlah krisis obat. Dengan berlalunya PDUFA III,
bagaimanapun, ini dengan jelas berubah (lihat Bab 8). Sebagai parameter lain
dari masalah keamanan obat, Program MedWatch FDA baru mengumpulkan
laporan spontan dari reaksi obat merugikan (Lihat Bab 9) sekarang isu
pemberitahuan bulanan dari perubahan label, dan pada pertengahan tahun 1999,
20-25 perubahan label yang berhubungan dengan keselamatan dilakukan setiap
bulan. Menurut sebuah studi di Dinas Pemerintahan Akuntan AS, 51% dari obat
yang disetujui memiliki efek samping serius yang belum terdeteksi sebelum
mendapat persetujuan dosis untuk direkomendasikan sebagai obat baru yang
dipasarkan seringkali salah, dan memerlukan monitoring dan modifikasi setelah
pemasaran.116,117

Baru-baru ini, dengan hasil publikasi dari Women’s Health Initiative


mengindikasi sebuah kombinasi.
Untuk lebih lanjut, ada pengakuan bahwa awal terapi penggantian hormon
menyebabkan peningkatan risiko infark miokard daripada penurunan risiko,
118.119

Telah terjadi peningkatan kekhawatiran tentang ketergantungan pada metode


nonexperimental untuk mempelajari keamanan obat setelah pemasaran, 120-123
dan kita mulai melihat penggunaan uji klinis acak besar sebagai bagian dari
pengawasan postmarketing (lihat Bab 39).

Ada juga peningkatan pengakuan bahwa sebagian besar risiko dari sebagian
obat-obatan untuk kebanyakan pasien terjadi dari reaksi yang diketahui untuk
obat lama. Namun, hampir semua upaya oleh FDA dan badan pengawas lainnya
yang dikhususkan untuk menemukan risiko yang tidak diketahui langka dari
obat baru. Sebagai tanggapan, ada kekhawatiran, di Kongres dan di antara
masyarakat AS setidaknya, bahwa mungkin FDA kini menyetujui obat terlalu
cepat.124 Ada juga menyerukan pengembangan independen papan keamanan
obat, analog dengan Dewan Keselamatan Transportasi Nasional, 125.126
dengan misi yang lebih luas dari misi peraturan FDA, untuk yang terakhir.
Misalnya, seperti papan bisa menyelidiki krisis keamanan obat seperti yang
dikutip di atas, mencari cara untuk mencegah mereka, dan bisa berurusan
dengan masalah-masalah seperti penyalahgunaan dokter terkait obat, kebutuhan
untuk pelatihan, dan pengembangan pendekatan baru untuk bidang
farmakoepidemiologi.

Sebagai upaya untuk mengatasi jenis pertanyaan yang sampai sekarang belum
ditangani,

Agency Kesehatan US Penelitian dan Kualitas (AHRQ) telah mendanai tujuh


Pusat Pendidikan dan Penelitian Therapeutics (CERT) 0,127 Dibahas lebih
dalam Bab 6, yang Program CERT berupaya untuk meningkatkan pelayanan
kesehatan dan keselamatan pasien. Ini telah mengidentifikasi peran tertentu
yang meliputi: (a) pengembangan dan memelihara kemitraan publik-swasta
untuk memfasilitasi penelitian tentang terapi; (B) dukungan dan dorongan dari
penelitian tentang terapi mungkin untuk mendapatkan kebijakan atau praktek
klinis; (C) pengembangan modul pendidikan dan strategi sosialisasi untuk
meningkatkan kesadaran tentang manfaat dan risiko dari obat-obatan; dan (d)
penciptaan sumber daya informasi nasional tentang penggunaan yang aman dan
terapi yang efektif. Kegiatan meliputi pelaksanaan penelitian pada terapi,
khususnya menjelajahi penggunaan baru dari obat-obatan, cara untuk
meningkatkan penggunaan efektif dari obat, dan risiko yang terkait dengan
penggunaan obat baru atau kombinasi obat. The CERT juga mengembangkan
modul pendidikan dan bahan untuk menyebarluaskan temuan dari penelitian
mereka, konsisten dengan misi menyeluruh mereka untuk menjadi sumber daya
nasional untuk orang yang mencari informasi tentang produk medis. The CERT
berusaha untuk mencari kerja sama sektor publik dan swasta untuk
memfasilitasi upaya ini. inisiatif baru lain yang terkait erat dengan
pharmacoepidemiolog adalah gerakan Keselamatan Pasien. Di Institut laporan
Kedokteran, Untuk Err adalah Manusia: Membangun Aman system kesehatan ,
para penulis mencatat bahwa: (a) "bahkan tampaknya singleevents atau
kesalahan adalah karena paling sering konvergensi beberapa kontribusi
faktor," (b) "mencegah kesalahan dan meningkatkan keselamatan
pasien memerlukan pendekatan sistem dalam rangka mengubah kondisi yang
berkontribusi terhadap kesalahan, "dan (c)" masalahnya bukan
orang jahat; masalahnya adalah bahwa sistem perlu dibuat lebih amanDalam
kerangka ini, kekhawatiran bukan tentang standarperawatan atau kelalaian,
melainkan, adalah tentang kesalahan yang dibuat bahkan oleh tenaga
profesional kesehatan terlatih, cerdas, dan paling kompeten dan / atau pasien.
Dari perspektif ini, pertanyaan-pertanyaan penelitian yang penting bertanya
tentang kondisi di mana orang membuat kesalahan, jenis kesalahan yang dibuat,
dan jenis sistem yang dapat dimasukkan ke dalam suatu daerah untuk mencegah
kemungkinan kesalahan seluruhnya. Kesalahan yang tidak dicegah harus
diidentifikasi dan diperbaiki efisien dan cepat, sebelum menimbulkan kerugian.
Beralih khusus untuk obat, dari 2,4% menjadi 6,5% dari pasien rawat inap
mengalami kejadian merugikan pada obat (ADES), rawat inap diperpanjang
selama 2 hari, dan meningkatkan biaya sebesar $ 2.000-2.600 per pasien.129-
132
Lebih dari 7000 kematian US dikaitkan dengan kesalahan pengobatan pada
tahun 1993. 133Tentu saja, surat CERT baru-baru ini adanya peninjauan sistem-
ATIC dari seluruh proses penilaian risiko obat, sebagai studi oleh US Institute
134
of Medicine. Pada saat bab ini dicetak, tampak bahwa studi akan dimulai,
sebagian kecil menanggapi keadaan sekitar pada penarikan rofecoxib.
Walaupun estimasi ini telah diperdebatkan, 135–140 secarakeseluruhan pentingnya
dalam mengurangi kesalahan ini belum dipertanyakan. Dalam pengakuan
masalah ini, AHRQ telah meluncurkan program baru utama lebih dari 100
proyek, dengan lebih dari $ 50 juta / tahun dari pendanaan. Sementara hanya
sebagian dari ini didedikasikan untuk kesalahan pengobatan, dengan jelas
mereka fokus dari banyaknya minat dan relevansi. Informasi lebih lanjut
diberikan dalam Bab 34.

. PERAN FARMAKODINAMIK DALAM PENENTUAN VARIABILITAS


RESPON OBAT

Dibandingkan dengan sebagian besar eksposur (paparan) berasal dari non-drug


(bukan obat), denganadanya pengetahuanyang cukup tentang efek obat pada
saat dipasarkan. Hal ini harus dimasukkan ke dalam desain studi barudalam
mencari untuk mendapatkan informasi lebih lanjut tentang aksi dari suatu obat.
Hal ini berlaku apakah desain studi baru adalah eksperimental atau non-
eksperimental. Selanjutnya, ada informasi yang cukup tentang faktor-faktor
penentu respon pasien terhadap obat pada umumnya. Pada bagian ini, kami
menyajikan efek genetika, Respon adaptif, usia, keadaan penyakit, dan obat-
obatan yang digunakan secara bersamaan dalam menentukan variabilitas respon
obat.

FAKTOR GENETIK MANUSIA

RESPONS TERHADAP OBAT

Ini adalah daerah yang paling cepat berkembang dari penelitian farmakologi
klinis (lihat juga Bab 37). Ilmu genomik membantu kita memahami (dan
mungkin memprediksi) yang akan merespon (atau tidak) untuk obat yang akan
mengalami toksisitas yang serius pada dosis biasanya padaefekterapeutik.
Penyelidikan dalam penentu genetik telah dipusatkan pada tiga bidang utama:
8
aksi obat, transporter obat, dan metabolisme obat. Yang terakhir dua topik
yang kemudian dibahas dalam aagian farmakokinetik. polimorfisme nukleosida
tunggal dalam gen adalah kode untuk reseptor obat yang dapat mengakibatkan
variabilitas respon terhadap obat tertentu. polimorfisme genetik berbeda dalam
urutan DNA terjadi dengan frekuensi 1% atau lebih, yang dapat menyebabkan
pembentukan protein yang tidak berfungsi dengan baik.Misalnya, poli-
morphism dari adrenoseptor β2 menyebabkan kurangnya respon terhadap
bronkodilator, dan variasi genetik dalam reseptor 5HT2a untuk ketahanan
terhadap agen anti-psikotik clozapine.9 Polimorfisme gen yang berbeda yang
mempengaruhi platelet dan fungsi sel endotel dapat dikaitkan dengan
peningkatan risiko trombosis, dan resistensi relatif terhadap efek anti-trombotik
dari aspirindengan dosis rendah.10
Akhirnya, inisiatif baru lain utama dari relevansi dekat dengan
pharmacoepidemiology adalah manajemen risiko. Ada peningkatan pengakuan
bahwa keseimbangan risiko / manfaat dari beberapa obat hanya dapat dianggap
diterima dengan manajemen aktif penggunaannya, untuk memaksimalkan
efektivitas mereka dan / atau meminimalkan risiko mereka.Sebagai tanggapan,
ada banyak inisiatif berlangsung, mulai dari persyaratan FDA baru untuk
rencana manajemen risiko, ke FDA Obat Keselamatan baru dan Komite
Penasihat Manajemen Risiko. Informasi lebih lanjut disediakan adalah Bab 8
dan 33

PROSES PERSETUJUAN OBAT

Proses persetujuan obat saat ini di AS dan sebagian besar negara-negara maju
lainnya termasuk pengujian hewan praklinis diikuti oleh tiga fase uji klinis.
Tahap I pengujian biasanya dilakukan hanya dalam beberapa relawan normal,
dan merupakan uji coba awal obat pada manusia. uji coba tahap I umumnya
dilakukan oleh ahli farmakologi klinis, untuk menentukan metabolisme obat dan
berbagai dosis aman pada manusia, dan untuk mengecualikan reaksi beracun
yang sangat umum yang unik untuk manusia pengujian tahap II juga umumnya
dilakukan oleh ahli farmakologi klinis, pada sejumlah kecil pasien yang
memiliki penyakit sasaran. pengujian tahap II biasanya pertama kalinya pasien
yang terkena obat. Pengecualian adalah obat yang sangat beracun yang biasanya
tidak dianggap etis untuk mengekspos individu yang sehat untuk mereka,
seperti obat sitotoksik. Untuk ini, pasien digunakan untuk Tahap I pengujian
juga. Tujuan dari pengujian Tahap II adalah untuk mendapatkan informasi lebih
lanjut tentang farmakokinetika obat dan pada setiap reaksi yang merugikan
relatif com-mon, dan untuk mendapatkan informasi awal tentang kemanjuran
kemungkinan obat. Secara khusus, Tahap II digunakan untuk menentukan dosis
harian dan regimen untuk diuji lebih ketat pada Tahap III.

KONTRIBUSI POTENSIpharmacoepidemiology

Kontribusi potensi pharmacoepidemiology hanya mulai direalisasikan, seperti


lapangan baru. Namun, beberapa kontribusi yang sudah jelas (lihat Tabel 1.1).
Bahkan, sejak awal 1970-an FDA telah diperlukan postmar-marketing
penelitian pada saat persetujuan untuk sekitar sepertiga dari drugs.141 Pada
bagian ini kita akan meninjau potensi untuk studi pharmacoepidemiology untuk
melengkapi infor-masi tersedia sebelum pemasaran , dan kemudian meninjau
jenis informasi baru diperoleh dari studi pharmacoepidemiology postmarketing
tetapi tidak mungkin diperoleh sebelum pemasaran obat. Akhirnya, kita akan
meninjau umum, dan mungkin yang paling penting, potensi kontribusi
penelitian tersebut dapat membuat. Dalam setiap kasus, informasi yang relevan
tersedia dari premarketing studi akan diperiksa secara singkat pertama, untuk
menjelaskan bagaimana penelitian postmarketing dapat melengkapi informasi
ini.

INFORMASI TAMBAHAN

Studi Premarketing efek obat harus terbatas dalam ukuran. Setelah pemasaran,
studi epidemiologi nonexperimental dapat dilakukan, mengevaluasi dampak
dari obat yang diberikan sebagai bagian dari perawatan medis yang sedang
berlangsung. Ini memungkinkan penelitian surveilans di AS menduga jumlah
insiden yang lebih precisely.23 Dalam beberapa tahun terakhir, ada bahkan
telah upaya, dalam kasus khusus yang dipilih, untuk melepaskan dipilih kritis
obat penting lebih cepat,dengan mengambil keuntungan dari pekerjaan yang
dapat dilakukan setelah pemasaran. Mungkin contoh yang paling terkenal
adalah zidovudine.144,145 Seperti disebutkan di atas,
ukuran sampel meningkat tersedia setelah pemasaran juga memungkinkan
penentuan yang lebih tepat dari dosis yang benar untuk digunakan.

Tabel 1.1 Potensi kontribusi dari pharmacoepidemiology

(A) Suplemen informasi yang informasi yang tersedia dari premarketing


mempelajari lebih baik kuantisasi dari tingkat kejadian efek merugikan dan
bermanfaat

(a) presisi tinggi

(b) Pada pasien tidak belajar sebelum pemasaran, misalnya, orang tua, anak-
anak, pada wanita hamil

(c) sebagai modifikasi oleh obat lain dan penyakit lainnya

(d) Sehubungan dengan obat lain yang digunakan untuk indikasi yang sama

(B) Jenis baru dari informasi yang tidak tersedia dari stude premarketing

(1) Penemuan sebelumnya tidak terdeteksi efek samping dan efek


menguntungkan

(1) efek tidak biasa

(2) efek tertunda

(2) Pola pemanfaatan obat


(3) Efek dari overdosis obat

(4) implikasi ekonomi dari penggunaan narkoba

(c) Konstribusi jendral pharmacoepidemiology

(1) Jaminan tentang keamanan obat

(2) Pemenuhan kewajiban etika dan hukum

Penelitian sebelum pemasaran (premarketing) juga sering dibuat-buat. Sub-


kelompok pasien yang penting biasanya tidak disertakan dalam penelitian yang
dilakukan sebelum pemasaran obat, biasanya untuk alasan etika. Seperti
manula, anak-anak, dan wanita hamil. Penelitian efek obat pada populasi ini
umumnya harus menunggu penelitian yang dilakukan setelah pemasaran obat.

Sebagai tambahan, untuk alasan efisiensi statistik, uji klinis premarketing pada
umumnya mencari subyek yang sehomogen mungkin, untuk mengurangi
variable yang tidak dapat dijelaskan dalam hasil variable yang diukur dan
meingkatkan kemungkinan mendeteksi perbedaan antara kelompok-kelompok
penelitian, jika memang ada. Karena sebab itu, beberapa pasien tertentu sering
dikeluarkan, termasuk mereka yang memiliki penyakit lain atau mereka yang
menerima obat lain. Penelitian setelah pemasaran (postmarketing) dapat
menyelidiki bagaimana faktor seperti penyakit lain dan obat lain
memungkinkan memodifikasi efek obat, dan juga mencari efek dari perbedaan
rejimen obat, kepatuhan, dll. Contohnya, setelah pemasaran, persiapan
ophthalmic timolol tercatat menyebabkan beberapa episode serius penyumbatan
jantung dan asma, menyebabkan kematian lebih dari 10 orang. Efek tersebut
tidak terdeteksi sebelum pemasaran, karena pasien dengan penyakit
cardiovascular atau respiratory dikeluarkan dari penelitian premarketing.

Akhirnya, untuk mendapatkan persetujuan untuk memasarkan obat, pabrik


harus mengevaluasi kemanan keseluruhan dan kemanjuran, tetapi tidak
membutuhkan evaluasi keamanan dan kemanjurannya yang berhubungan
dengan obat lain yang tersedia untuk indikasi yang sama. Bertentangan dengan
hal tersebut, dengan pengecualian penyakit yang tidak dapat diobati secara etik
dengan placebo seperti infeksi serius dan malignancy, pada umumnya dianggap
lebih disukai, atau bahkan dibutuhkan, untuk memiliki penelitian dengan
placebo kontrol. Ada banyak alasan untuk pilihan ini. pertama, lebih mudah
untuk menunjukkan bahwa obat baru lebih efektif dari placebo dibandingkan
untuk menunjukkan bahwa lebih efektif dari obat efektif lainnya. Kedua, tidak
ada yang benar-benar membuktikan bahwa obat baru sama efektifnya dengan
obat standar. Sebuah penelitian yang menunjukkan obat baru lebih buruk dari
obat efektif yang lain tidak memberi kepastian bahwa obat tersebut lebih baik
dari placebo: karena bisa saja gagal dalam mendeteksi bahwa memang lebih
buruk dari obat standar. Satu obat dapat membutuhkan demonstrasi bahwa obat
baru lebih efektif dari yang lain, tetapi ini adalah standar yang tidak dan
seharusnya tidak dipenuhi. Tetapi, penangan medis yang optimal membutuhkan
informasi efek obat sehubungan dengan alternative yang tersedia untuk indikasi
yang sama. Informasi ini sering kali harus menunggu penelitian yang dilakukan
setelah pemasaran obat.

Tipe baru informasi yang tidak tersedia dari penelitian premarketing

Seperti yang dikatakan diatas, ukuran penelitian premarketing terbatas. Ukuran


sampek tambahan tersedia dalam penelitian postmarketing mengijinkan
penelitian efek obat yang munkin tidak umum, tetapi penting, seperti
agranulocytosis yang diinduksi obat.
Penelitian premarketing juga terbatas pada waktu; mereka harus segera selesai,
atau obat tidak akan pernah dipasarkan! Sebaliknya, penelitian postmarketing
mengijinkan penelitian tentang efek obat yang terlambat, seperti sel jernih luar
biasa adenocarcinoma pada vagina dan serviks, yang terjadi dua dekade
selanjutnya pada wanita yang terlihat sebelum melahirkan hingga
diethylstilbestrol.

Pola resep dokter dan pemanfaatan obat pasien sering tidak dapat dipredisi
sebelum pemasaran, meskipun pabrik farmasi mencoba memprediksi dalam
perencanaan pemasaran obat. Penelitian tentang bagaimana sebenarnya obat
digunakan, dan faktor penentu perubahan pada perubahan pola ini, hanya dapat
dilakukan setelah pemasaran obat (lihat bab 27 dan 28).

Pada kebanyakan kasus, penelitian premarketing dilakukan menggunakan


pasien terpilih yang diobservasi dengan cermat. Sangat jarang ditemukan
overdosis yang signifikan pada populasi ini. sehingga, penelitian tentang efek
obat ketika ditelan pada dosis yang sangat tinggi hampir tidak mungkin sebelum
pemasaran obat. Lagi, hal ini harus menunggu penelitian
pharmacoepidemiology postmarketing.

Akhirnya, hanya pada satu atau dua dekade terakhir masyarakat kita menjadi
lebih sensitive terhadap akibat dari penanganan medis, dan teknik ekonomi
kesehat telah diterapkan untuk mengevaluasi implikasi biaya penggunaan obat.
Jelas bahwa penjelahjahan biaya penggunaan obat membutuhkan pertimbangan
lebih dari hanya biaya obat tersebut. Biaya dari dampak negatif obat dapat lebih
besar dari biaya obat itu sendiri, jika dampak negatif mengakibatkan
penanganan medis tambahan dan bahkan rawat inap. Sebaliknya, efek positif
obat dapat mengurangi kebutuhan penanganan medis, yang berakhir pada
pengurangan biaya yang mungkin lebih besar dari biaya obat itu sendiri. Untuk
penelitian tentang pemanfaatan obat, implikasi ekonomi obat dapat diprediksi
sebelum pemasaran, tetapi hanya dapat diteliti secara ketat setelah pemasaran
(lihat bab 41).

Kontribusi umum pharmacoepidemiology

Terakhir, penting untuk meninjau kontribusi umum yang dapat dilakukan


pharmacoepidemiology. Sebagai akademis atau seorang dokter, yang paling
tertarik dalam informasi baru tentang efek obat dan biaya obat yang dapat
didapatkan dari pharmacoepidemiology. Tentu, ini adalah temuan yang
mendapatkan perhatian public dan politik. Namun, seringkali tidak ada
informasi yang didapat, terlebih tentang efek negatif baru obat. Ini bukan hasil
yang mengecewakan, tetapi nyatanya, sangat meyakinkan, dan keyakinan
tentang keamanan obat adalah salah satu kontribusi penting yang dapat
dihasilkan oleh penelitian pharmacoepidemiology. Terkait dengan keyakinan
yang sponsor penelitian, entah pabrik atau regulator, memenuhi tugas
organisasional dengan etis dan tanggung jawab dengan mencari masalah yang
belum diketahui yang mungkin ada. Dalam era product liability litigation, hal
ini adalah jaminan yang penting. Hal itu tidak bisa berubah meskipun obat
mengakibatkan reaksi negatif, dan fakta bahwa akan menjadi bukti. Yang dapat
dirubah adalah persepsi tentang apakah pabrik melakukan segalanya yang
memungkinkan untuk mendeteksinya dan apakah lengah dalam perlakuanyna.

Desain studi Tersedia untuk Studi Pharmacoepidemiology

BRIAN L. STROM University of Pennsylvania School of Medicine,


Philadelphia, Pennsylvania, USA.

Pharmacoepidemiology menerapkan metode epidemiologi untuk area konten


farmakologi klinis. Oleh karena itu, dalam rangka untuk memahami pendekatan
dan isu-isu metodologis khusus untuk bidang pharmacoepidemiology, prinsip-
prinsip dasar bidang epidemiologi harus dipahami. Untuk tujuan ini, bab ini
akan mulai dengan gambaran dari metode ilmiah, pada umumnya. Ini akan
diikuti dengan diskusi dari berbagai jenis kesalahan seseorang dapat membuat
dalam merancang sebuah penelitian. Berikutnya bab ini akan meninjau "Kriteria
untuk sifat kausal dari asosiasi," yang adalah bagaimana seseorang dapat
memutuskan apakah asosiasi dibuktikan dalam sebuah studi tertentu, pada
kenyataannya, hubungan sebab akibat. Akhirnya, desain studi tertentu yang
tersedia untuk studi epidemiologi, atau bahkan untuk setiap studi klinis, akan
ditinjau. Bab berikutnya membahas isu metodelogi tertentu yang perlu ditangani
dalam penelitian apapun, tapi yang sangat penting terutama untuk studi
pharmacoepidemiology: masalah ukuran sampel. Kedua bab dimaksudkan
untuk menjadi intro-duction untuk bidang epidemiologi untuk orang baru.
Informasi lebih lanjut tentang prinsip-prinsip ini dapat diperoleh dari setiap
buku teks epidemiologi atau epidemiology.1-23 klinis

Akhirnya , Bab 4 akan meninjau prinsip-prinsip dasar farmakologi klinis ,


wilayah konten pharmacoepidemiology , dengan cara yang sama

GAMBARAN METODE ILMIAH

Metode ilmiah adalah proses tiga tahap ( lihat Gambar 2.1 ) . Dalam

Setiap studi yang diberikan dilakukan pada pilihan individu , yang mewakili
subyek penelitian . subyek penelitian ini secara teoritis merupakan sampel acak
dari beberapa populasi tertentu . Sebagai contoh , seseorang mungkin
melakukan uji klinis secara acak dari khasiat enalapril dalam menurunkan
tekanan darah , secara acak mengalokasikan total
sampel penelitian

inferensi statistik

Kesimpulan tentang populasi (asosiasi)

inferensi biologi

Kesimpulan tentang teori ilmiah (sebab-akibat)

Gambar 2.1.Overview dari metode ilmiah.

40 orang hipertensi setengah baya untuk menerima enalapril atau plasebo dan
mengamati tekanan darah mereka enam minggu kemudian. Orang mungkin
mengharapkan untuk melihat tekanan darah 20 orang diobati dengan obat aktif
menurun lebih dari tekanan darah 20 orang diobati dengan plasebo. Dalam
contoh ini, 40 subyek penelitian akan mewakili sampel penelitian, secara teoritis
sampel acak dari pria hipertensi setengah baya. Pada kenyataannya, sampel
penelitian adalah hampir tidak pernah sampel acak sebenarnya dari populasi
sasaran yang mendasarinya, karena logistik tidak mungkin untuk
mengidentifikasi setiap individu yang termasuk dalam populasi target dan
kemudian secara acak memilih dari antara mereka. Namun, sampel penelitian
biasanya diperlakukan seolah-olah itu adalah sampel acak dari populasi sasaran.

Pada titik ini, orang akan tergoda untuk membuat generalisasi yang enalapril
menurunkan tekanan darah pada hyperten-sive pria paruh baya. Namun, salah
satu harus menyelidiki apakah pengamatan ini bisa terjadi hanya secara
kebetulan, yaitu, karena variasi acak. Jika hasil yang diamati dalam penelitian
itu hanya kejadian kesempatan maka pengamatan yang sama mungkin belum
terlihat jika salah satu telah memilih sampel yang berbeda dari 40 subyek
penelitian. Mungkin yang lebih penting, mungkin tidak ada jika mampu
mempelajari seluruh penduduk teoritis semua orang hipertensi setengah baya.
Dalam rangka untuk mengevaluasi kemungkinan ini, seseorang dapat
melakukan uji statistik, yang memungkinkan seorang penyelidik menduga
jumlah probabilitas bahwa hasil yang diamati dalam penelitian ini (yaitu,
perbedaan yang terlihat antara dua kelompok belajar) bisa terjadi hanya secara
kebetulan. Ada aturan eksplisit dan prosedur untuk bagaimana seseorang harus
benar membuat penentuan ini: ilmu statistik. Jika hasil penelitian setiap
dipertimbangkan menunjukkan "perbedaan yang signifikan," maka salah satu
yang dikatakan memiliki hubungan. Proses menilai apakah variasi acak bisa
menyebabkan temuan studi ini disebut inferensi sebagai statistik, dan
merupakan peran utama untuk pengujian statistik dalam metode ilmiah.

Mungkin mekanisme lain untuk menciptakan sebuah asosiasi artifactual bias .


penggunaan epidemiologi ' dari bias jangka berbeda dari masyarakat awam .
Untuk seorang ahli epidemiologi , bias variasi sistematis , dengan cara yang
konsisten dalam kelompok belajar whichtwo diperlakukan atau dievaluasi
secara berbeda .
Jika tidak ada perbedaan yang signifikan secara statistik, maka proses dalam
Gambar 2.1 berhenti. Jika ada hubungan, maka seseorang tergoda untuk
menggeneralisasi hasil penelitian lebih jauh, untuk menyatakan bahwa enalapril
adalah obat antihipertensi, pada umumnya. Hal ini disebut sebagai ilmiah atau
biologicalinference, dan hasilnya adalah kesimpulan tentang penyebab, bahwa
obat benar-benar menurunkan tekanan darah pada populasi pasien yang diobati.
Untuk menggambar jenis kesimpulan, bagaimana-pernah, memerlukan satu
untuk menggeneralisasi untuk populasi selain yang termasuk dalam studi,
termasuk jenis orang yang tidak terwakili dalam sampel penelitian, seperti
perempuan, anak-anak, dan orang tua. Meskipun mungkin jelas dalam contoh
ini bahwa ini sebenarnya tepat, yang mungkin tidak selalu menjadi kasus. Tidak
seperti inferensi statistik, tidak ada aturan kuantitatif yang tepat untuk inferensi
biologis. Sebaliknya, salah satu kebutuhan untuk memeriksa data di tangan
dalam terang semua data terkait lainnya di seluruh literatur ilmiah, dan
membuat penilaian subjektif. Untuk membantu dalam membuat keputusan itu,
bagaimanapun, seseorang dapat menggunakan "Kriteria untuk sifat kausal dari
asosiasi," dijelaskan di bawah. Pertama, bagaimanapun, kita akan menempatkan
asosiasi kausal dalam perspektif yang tepat, dengan menggambarkan berbagai
jenis kesalahan yang dapat dibuat dalam melakukan studi dan berbagai jenis
asosiasi yang masing-masing menghasilkan. JENIS KESALAHAN YANG
SATU DAPAT MEMBUAT IN MELAKUKAN STUDI Ada empat tipe dasar
dari asosiasi yang dapat diamati dalam studi (Tabel 2.1). Tujuan dasar dari
penelitian ini adalah untuk membedakan antara mereka. Pertama, tentu saja,
orang bisa tidak memiliki hubungan. Kedua, orang bisa memiliki hubungan
artifactual, yaitu, sebuah asosiasi palsu atau salah. Hal ini dapat terjadi dengan
salah satu dari dua mekanisme: kebetulan atau Bias. Kesempatan tidak
sistematis, atau berlari-dom, variasi. Tujuan dari uji statistik dalam ilmu adalah
untuk mengevaluasi ini, memperkirakan probabilitas bahwa hasil yang diamati
dalam studi bisa terjadi murni secara kebetulan.

Tabel 2.1 . Jenis hubungan antara faktor-faktor yang diteliti

( 1 ) Tidak ada ( independen )

( 2 ) artifactual ( palsu atau false )

( A) Kesempatan ( variasi sistematis )

( B ) Bias ( variasi sistematis )

( 3 ) langsung ( terkutuk )

( 4 ) kausal ( langsung atau benar )

. Perbedaan yang konsisten ini dapat membuat hubungan yang jelas di mana
yang benar-benar tidak ada. Tentu saja , hal itu juga dapat menutupi hubungan
yang benar .

Ada berbagai jenis biases.24 potensi Misalnya , pertimbangkan sebuah studi


wawancara di mana asisten penelitian menyadari hipotesis penyidik . mencoba

untuk menyenangkan bos, asisten penelitian mungkin menyelidiki lebih hati-


hati dalam wawancara dengan satu kelompok studi dari selama wawancara
dengan lainnya. Perbedaan ini dalam cara hati-hati probe pewawancara bisa
membuat hubungan yang jelas tapi palsu, yang disebut sebagai bias yang
pewawancara. Contoh lain akan menjadi studi cacat lahir akibat obat yang
membandingkan anak-anak dengan cacat lahir untuk anak-anak tanpa cacat
lahir. Seorang ibu dari seorang anak dengan cacat lahir, ketika diwawancarai
mengenai obat dia mengambil selama kehamilannya, mungkin cenderung
mengingat konsumsi obat selama kehamilan dengan akurasi yang lebih besar
daripada ibu dari anak yang sehat, karena pengalaman malang dia telah
mengalami. Penarikan kembali membaik pada ibu dari anak-anak dengan cacat
lahir dapat mengakibatkan asosiasi jelas palsu antara paparan obat dan cacat
lahir. Perbedaan yang sistematis ini di recall disebut sebagai bias.25 recall

Perhatikan bahwa bias, sekali ini, tidak dapat diperbaiki. Mereka mewakili
kesalahan dalam desain penelitian yang dapat menghasilkan hasil yang salah
dalam penelitian ini. Penting untuk dicatat bahwa hasil statisticallysignificant
ada perlindungan terhadap bias; satu canhave pengukuran yang sangat tepat dari
jawaban yang salah! Satu-satunya perlindungan terhadap bias adalah desain
studi yang tepat. (Lihat Bab 47 untuk diskusi lebih lanjut tentang bias dalam
studi pharmacoepidemiology.)

Ketiga, seseorang dapat memiliki langsung, atau bingung, asosiasi. Sebuah


variabel pengganggu, atau perancu, adalah variabel selain faktor risiko dan hasil
yang diteliti yang berhubungan secara independen untuk kedua faktor risiko dan
variabel hasil dan yang dapat menciptakan hubungan yang jelas atau masker
yang nyata. Sebagai contoh, sebuah studi tentang faktor risiko untuk kanker
paru-paru bisa menemukan hubungan yang sangat kuat antara memiliki ujung
jari kuning dan kanker paru-paru. Ini jelas bukan hubungan sebab akibat, namun
sebuah asosiasi tidak langsung, dikacaukan oleh merokok. Secara khusus,
merokok menyebabkan kedua ujung jari kuning dan kanker paru-paru.
Meskipun contoh ini adalah transparan, sebagian contoh pengganggu tidak.
Dalam

Tabel 2.2. Pendekatan untuk mengendalikan pembaur

(1) alokasi acak

(2) pilihan Subjek

(A) Pengecualian

(B) Matching

(3) analisis data

(A) Stratifikasi

(B) pemodelan matematika

Untuk berencana untuk menghadapinya sebagai variabel pengganggu potensial.


Lebih disukai, satu akan dapat secara khusus mengontrol variabel,
menggunakan salah satu teknik yang tercantum pada Tabel 2.2. (Lihat Bab 40
dan 47 untuk diskusi lebih lanjut tentang pengganggu dalam studi
pharmacoepidemiology.)
Keempat, dan akhirnya, ada benar, asosiasi kausal. Dengan demikian, ada tiga
kemungkinan jenis kesalahan yang dapat

diproduksi dalam studi: kesalahan acak, bias, dan membingungkan. Probabilitas


kesalahan acak dapat kuantitatif menilai menggunakan statistik. Bias perlu
dicegah dengan merancang penelitian benar. Pembaur dapat dikontrol baik
dalam desain penelitian atau dalam analisisnya. Jika ketiga jenis kesalahan
dapat dikecualikan, maka salah satu yang tersisa dengan benar, hubungan
sebab-akibat.

KRITERIA UNTUK PENYEBAB SIFAT AN

ASOSIASI

"Kriteria untuk sifat kausal dari asosiasi" pertama kali dikemukakan oleh Sir
Austin Bradford Hill, 26 tetapi telah dijelaskan dalam berbagai bentuk sejak,
masing-masing dengan beberapa modifi-kation. Mungkin deskripsi paling
terkenal dari mereka adalah dalam Laporan pertama Surgeon General Rokok
dan Kesehatan, 27 diterbitkan pada tahun 1964. Kriteria ini disajikan pada
Tabel 2.3, tanpa urutan tertentu. Tidak ada salah satu dari mereka adalah mutlak
diperlukan untuk sebuah asosiasi menjadi hubungan sebab akibat. Analog, tidak
ada dari mereka adalah cukup untuk sebuah asosiasi untuk dianggap sebagai
hubungan sebab akibat. Pada dasarnya, semakin kriteria yang hadir, semakin
besar kemungkinan itu adalah bahwa asosiasi adalah asosiasi kausal. Semakin
sedikit kriteria yang terpenuhi, semakin kecil kemungkinan itu adalah bahwa
asosiasi adalah asosiasi kausal. Masing-masing akan dibahas pada gilirannya.

Tabel 2.3. Kriteria sifat kausal dari asosiasi

(1) Coherence dengan informasi (masuk akal secara biologis) yang ada

(2) Konsistensi asosiasi

(3) urut Waktu

(4) Kekhususan asosiasi

(5) Kekuatan asosiasi

(A) kekuatan Kuantitatif

(B) hubungan Dosis-respon

(C) desain program

Kriteriapertama yang tercantumpadaTabel 2.3 adalahkoherensidenganinformasi


yang adaataumasukakalsecarabiologis. Hal inimengacupadaasosiasi,
mengingatjenisinformasi yang tersediadalamliteratur.
Inijenisinformasilainnyayang dapatmencakup data daristudimanusialainnya,
data daristudipertanyaanterkaitlainnya, data daristudihewan, atau data
daripenelitian in vitro, sertateoriilmiahataupatofisiologis.
Untukmenggunakancontoh yang diberikan di atas,
jelastidakbiologisatautidakmasukakalbahwaujungjarikuningbisamenyebabkanka
nkerparu-paru, daninimemberikanpetunjuk yang membingungkan.
DenganMenggunakancontohhubunganantararokokdankankerparu-paru, asap
rokokdikenalsebagaikarsinogen,berdasarkan data hewan. Padamanusia,
halitudiketahuimenyebabkankankerkepaladanleher, pankreas,
dankandungkemih. Asaprokokjugaturunkeparu-paru,
langsungmengeksposjaringan yang bersangkutan. Dengandemikian,
tentusecarabiologismasukakalbahwarokokbisamenyebabkankankerparu-
paru.Halinijauhlebihmeyakinkanjikasebuahasosiasi yang
ditemukandalamstuditertentumasukakal, berdasarkaninformasi yang
tersediasebelumnya, daninisalahsatu yang
membuatnyamanbahwaitumungkinasosiasikausal -ciation. Jelas,
namunbisa,salahsatutidakmengharuskankriteriainiselaludipenuhi,
atausalahsatutidakakanpernahmemilikiterobosanbesardalamilmupengetahuan.

Kriteriakedua yang tercantumdalamTabel 2.3 adalahkonsistensidariasosiasi.


Sebuahtandadariilmureproduksi: jikatemuannyata,
salahsatuharusmampumereproduksidalampengaturan yang berbeda. Hal ini
yangdapatmencakuppengaturan yang berbeda :geografis, desainstudi yang
berbeda, populasi yang berbeda, dll. Sebagaicontoh,
dalamkasusrokokdankankerparu-paru, asosiasikinitelahdireproduksi di
banyakstudi yang berbeda, di lokasigeografis yang berbeda, menggunakan
designs.29 Studi yang
berbedakebutuhanreproduktifitasadalahsedemikianrupasehinggaseseorangharus
percayatemuandilaporkanhanyasekali: mungkinadakesalahan yang
dilakukandalampenelitian, yang tidakjelasbaikpenyidik ataupembaca.

Kriteriaketiga yang tercantumadalahbahwawaktu sequence-


sebabharusmendahuluiefek. Meskipuninimungkintampakjelas, adadesainstudi
yang initidakdapatditentukan. Misalnya, jikasatu orang untukmelakukansurvei
di kelas 200 mahasiswakedokteran, memintamasing-
masingjikadiasaatinisedangmengambil diazepam danjugaapakahiacemas, orang
akanmenemukanhubungan yang kuatantarapenggunaan diazepam
dankecemasan , tapiinitidakberartibahwa diazepam
menyebabkankecemasan.Meskipuninijelas, karenatidakinterpretasibiologis,
masukakalseseorangtidakbisamembedakandarijenisstudi cross-sectional yang
variabeldatangpertamadan yang datangkedua. Padacontohrokokdankankerparu-
paru, jelasmerokokbiasanyamendahuluikankerparu-paru,
sebagaipasientidakakanbertahancukup lama
untukmerokokbanyakjikasebaliknya yang terjadi.

KriteriakeempattercantumdalamTabel 2.3 adalahkekhususan. Hal


inimengacupadapertanyaanapakahpenyebabnyapernahterjadidengan-out
efekdugaandanapakahefeknyapernahterjaditanpapenyebabdiduga.
Kriteriainihampirtidakpernahditemukandalambiologi,
denganpengecualiansesekalipenyakitmenular. Campaktidakpernahterjaditanpa
virus campak, tetapibahkandalamcontohini, tidaksemua orang yang
terinfeksidengan virus campakmengembangkankliniscampak. Tentusaja,
tidaksemua orang yang merokokmengembangkankankerparu-paru,
dantidaksemua orang yang mengembangkankankerparu-paruadalahperokok.
Iniadalahsalahsatupoinutamaindustritembakaumenekankanketikamencobauntuk
membuatklaimbahwamerokokbelumterbuktimenyebabkankankerparu-paru.
Beberapapenulisbahkanmenghilangkaninisebagaikriteria, seperti yang
sangatjarangdijumpai.

KriteriakelimatercantumdalamTabel 2.3 adalahkekuatanasosiasi.


Inimencakuptigakonsep: kekuatankuantitatif, dosis-respons,
danrancanganpenelitian. Masing-masingakandibahaspadagilirannya.
Kekuatankuantitatifasosiasimengacupadaukuranefek. Untukmengevaluasiini,
salahsatumenanyakanapakahbesarnyaperbedaandiamatiantaraduakelompokbelaj
arbesar.
Sebuahasosiasikuantitatifbesarhanyadapatdibuatolehasosiasikausalataukesalaha
nbesar, yang harusjelasdalammengevaluasimetodologipenelitian.
Sebuahasosiasikecilquanti-tativelymungkinmasihkausal,
tetapibisadibuatdengankesalahan yang halus, yang
tidakakanjelasdalammengevaluasipenelitian. Konvensional,
ahliepidemiologimenganggaphubungandenganrisikorelatifkurangdari
2,0hubungan yang lemah. Tentusaja, hubunganantaramerokokdankankerparu-
paruadalahasosiasi yang kuat: studimenunjukkanrisikorelatifberkisarantara
10,0dan 30.0.29

Sebuahhubungandosis-responsadalahsebuahkonsep yang
sangatpentingdanumumdigunakandalamfarmakologiklinisdandigunakansamadal
amepidemiologi.HubunganSebuahdosis-
responsadaketikapeningkatanintensitassuatuhasilpaparan di
peningkatanrisikopenyakit yang diteliti. Setaradenganiniadalahhubungandurasi-
respon, yang adasaatpaparan yangmenyebabkanpeningkatanrisikopenyakit.
hubunganbaikdosis-responsatauhubungandurasi-
responsangatmenyiratkanbahwaasosiasiini, , hubungansebabakibat.
Tentusajadalamcontohmerokokdankankerparu-paru, telahmenunjukkanberulang
kali bahwapeningkatanbaikjumlahrokok yang
dihisapsetiaphariataudalamjumlahtahunmerokokmeningkatkanrisikomengemba
ngkan cancerparu.

Akhirnya, desainstudimengacupadaduakonsep:
apakahstudiinidirancangdenganbaik, dan yang studidesain yang
digunakandalamstuditersebut.
Mengacupadaapakahstudiiniadalahsalahsatudaritigakesalahandijelaskansebelum
nyadalambabini, yaitukesalahanacak, bias, danmembingungkan. Tabel 2.4
menyajikandesainstudibiasanyadigunakanuntukstudiepidemiologi,
ataubahkanuntuksetiapstudiklinis.

DESAIGN STUDY UNTUK STUDY PHARMACOEPIDEMIOLOGY

Tabel 2.4 Keuntungandankerugiandaridesaign study Pharmacopidemiology

Desaign Study Keuntungan Kerugian


Rancomizedclnical Desaignyameyakinkan Paling mahal
trial
Experimental Hanyamengontrolsajauntukdiketahui Logistiknyasulit
Study Etiknyasulit
Study cohort -Dapatmempelajaribeberapa -hasilmemungkinkan bias
Hasil data -jarang, lebihmahal
-Bisamempelajarieksposur -jikadilakukansecara
-Data paparanberisi Prospektifmungkinbutuh
-Data kejadiantersedia Waktubertahununtuk
menyelesaikan
Case control -Dapatmempelajaribeberapaeksposur -pilihandapatbermasalah
-dapatmempelajaripenyakit -mudahterjadi bias
-logistiklebihmudahdancepat
Analysis of trends -dapatmemberikanjawaban yang tepat Dapatterjadi bias
Case series Kasuskuantitasmudahadakelompokkontrol Sehinggatidakdigunakanunt
Case report -mudahuntukmeghasilkanhipotesis Tidakdigunakanuntukpengu

Sebagaisalahsatukemajuandarimejadesain di bagianbawahuntuk orang-orang di


atas, penelitianbisasemakinsulituntukmelakukan,
tetapisemakinlebihmeyakinkan. Dengan kata lain, asosiasi yang
ditunjukkanolehstudimenggunakandesain di
bagianatasdaftaradalahlebihmungkinasosiasikausaldariasosiasi yang
ditunjukkanolehstudimenggunakandesain di bagianbawahdaftar.
Hubunganantaramerokokdankankerparu-
parutelahdireproduksidalambeberapastudi yang dirancangdenganbaik,
menggunakananalisistrensekuler, studikasus-kontrol, danstudikohort. Namun,
belumterbuktimenggunakanujiklinissecaraacak, yang merupakan "Cadillac"
daridesainstudi, seperti yang akandibahas di bawah. Iniadalahpertahananutama
lain yang digunakanolehindustritembakau.
Tentusaja,halitutidakakanadaetikaataulogistiklayakuntuksecaraacakmengalokasi
kanindividuuntukmerokokatautidakmerokokdanmengharapkanmerekauntukmen
gikutiselama 20 tahununtukmengamatihasildalamsetiapkelompok.

Masalahpenyebabdibahaslebihdalam Bab 9 dan 10 yang berkaitandengan proses


pelaporanspontanreaksiobat yang merugikan, dandalam Bab 36 yang
berkaitandenganmenentukansebab-akibatdalamkasuslaporan.

AINI

Analisis tren sekuler yang berguna untuk mendapatkan bukti cepat pro-masi
terhadap hipotesis. Namun, penelitian ini tidak memiliki data tentang individu;
mereka hanya memanfaatkan kumpulan-kumpulan data (misalnya, data tahunan
penjualan di wilayah geografis tertentu dalam kaitannya dengan kematian
tahunan penyebab spesifik di wilayah yang sama). Dengan demikian, mereka
tidak mampu untuk mengontrol variabel con-founding. Dengan demikian, di
antara eksposur yang tren terhadap penyakit, analisis tren sekuler tidak dapat
membedakan faktor yang mungkin menjadi penyebab sebenarnya. Misalnya,
tingkat kematian kanker paru-paru di AS telah meningkat pada wanita, sehingga
kanker paru-paru merupakan penyebab kematian utama kanker pada HIV. Ini
tentunya sejalan dengan meningkatnya tingkat merokok yang diamati pada
wanita sampai pertengahan 1960, dan tampaknya mendukung hubungan antara
merokok dan kanker paru-paru. Namun, juga akan konsisten dengan hubungan
antara pekerjaan tertentu dan kanker paru-paru, karena lebih banyak perempuan
di AS sekarang bekerja di luar rumah.

CASE–CONTROL STUDIES

studi kasus-kontrol adalah studi yang membandingkan kasus dengan penyakit


untuk kontrol tanpa penyakit , mencari perbedaan eksposur. Sebagai contoh ,
salah satu bisa dipilih kasus perempuan muda dengan tromboemboli vena dan
membandingkannya dengan kontrol tanpa tromboemboli vena , mencari
perbedaan dalam penggunaan kontrasepsi oral. Beberapa penelitian tersebut
telah dilakukan , umumnya hubungan yang kuat antara penggunaan kontrasepsi
oral dan tromboemboli vena .

studi kasus-kontrol dapat sangat berguna ketika seseorang ingin mempelajari


beberapa kemungkinan penyebab dari penyakit tunggal, salah satu dapat
menggunakan kasus dan kontrol yang sama untuk memeriksa sejumlah
eksposur sebagai faktor risiko potensial. Desain ini juga sangat berguna ketika
seseorang mempelajari penyakit yang relatif jarang, karena menjamin jumlah
yang memadai kasus dengan penyakit. Penggunakan studi kasus-kontrol,
seseorang dapat mempelajari penyakit langka dengan ukuran sampel nyata lebih
kecil dari yang diperlukan untuk studi kohort (lihat Bab 3). Misalnya, studi
klasik dietilstilbestrol dan sel adenokarsinoma vagina diperlukan hanya 8 kasus
dan 40 kontrol, daripada ribuan subyek yang terpapar yang akan diperlukan
untuk studi kohort pertanyaan ini.

studi kasus-kontrol umumnya mendapatkan informas pada eksposur secara


retrospektif, yaitu, dengan menciptakan peristiwa yang terjadi di masa lalu.
Informasi tentang paparan masa lalu untuk faktor risiko potensial umumnya
diperoleh dengan catatan medis abstrak atau dengan pemberian kuesioner atau
wawancara. Dengan demikian, studi kasus-kontrol memiliki keterbatasan dalam
validitas informasi paparan retrospektif yang dikumpulkan. Selain itu, pilihan
yang tepat pada kontrol dapat menjadi tugas yang menantang, dan tidak pantas
kontrol yang pilihan dapat menyebabkan seleksi bias, yang dapat menyebabkan
kesimpulan yang salah. Namun demikian, ketika studi kasus-kontrol dilakukan
dengan baik, selanjutnya dilakukan dengan baik pada penelitian kohort atau uji
klinis secara acak, jika ada, umumnya akan mengkonfirmasi hasil mereka.
Dengan demikian, desain kasus kontrol adalah pendekatan yang sangat berguna
untuk studi pharmacoepidemiology.

COHORT STUDIES

penelitian kohort studi yang mengidentifikasi subset dari populasi tertentu dan
mengikuti mereka dari waktu ke waktu, mencari perbedaan dalam hasil mereka.
penelitian kohort umumnya digunakan untuk membandingkan pasien terkena
pada pasien yang tidak terpapar, meskipun mereka juga dapat digunakan untuk
membandingkan satu paparan lain. Misalnya, salah satunya membandingkan
wanita usia reproduksi yang menggunakan kontrasepsi oral terhadap pengguna
metode kontrasepsi lain, mencari perbedaan frekuensi tromboemboli vena.
Ketika studi tersebut dilakukan, mereka sebenarnya mengkonfirmasi hubungan
antara kontrasepsi dan tromboemboli, yang telah mencatat menggunakan
analisis tren sekuler dan studi kasus-kontrol. Studi kohort dapat dilakukan
secara prospektif, yang simultan dengan peristiwa yang diteliti, atau
retrospektif, yaitu setelah hasil yang diteliti sudah terjadi, dengan menciptakan
peristiwa-peristiwa masa lalu menggunakan catatan medis, kuesioner, atau
wawancara.
Perbedaan utama antara penelitian kohort dan kasus-kontrol adalah atas dasar
mana pasien direkrut ke dalam studi (lihat Gambar 2.2). Pasien direkrut ke
dalam studi kasus kontrol berdasarkan ada atau tidak adanya penyakit, dan
eksposur yg mereka dapatkan kemudian dipelajari. Pasien direkrut ke dalam
penelitian kohort berdasarkan ada atau tidak adanya eksposur, dan tentu saja
penyakit selanjutnya kemudian dipelajari.

penelitian kohort memiliki keuntungan besar dari masalah besar yang


mengganggu studi kasus - kontrol : proses seleksi yang sulit terhadap pemilihan
subjek yang tidak sakit sebagai grup kontrol. Selain itu, studi kohort prospektif
bebas dari masalah validitas data secara retrospektif yang dikumpulkan . Untuk
alasan ini , sebuah asosiasi yang ditunjukkan oleh studi kohort lebih mungkin
untuk menjadi hubungan sebab akibat dari satu studi kasus - kontrol .
Selanjutnya , penelitian kohort sangat berguna ketika seseorang mempelajari
beberapa kemungkinan hasil dari eksposur tunggal , terutama eksposur yang
relatif jarang . Dengan demikian , mereka sangat berguna dalam penelitian
surveilans obat postmarketing , yang melihat efek yang mungkin didapatkan
dari obat baru dipasarkan . Namun, penelitian kohort dapat memerlukan ukuran
sampel yang sangat besar untuk mempelajari hasil yang relatif jarang ( lihat Bab
3 ) . Selain itu, studi kohort prospektif dapat memerlukan jangka waktu yang
lama untuk mempelajari efek obat yang tertunda .

ANALYSIS OF CASE–CONTROL AND COHORT STUDIES

Seperti dapat dilihat pada Gambar 2.2, kedua studi kasus-kontrol dan kohort
dimaksudkan untuk memberikan informasi dasar yang sama; perbedaannya
adalah bagaimana informasi ini dikumpulkan. Kunci Statistik yang dilaporkan
dari studi ini adalah risiko relatif. Risiko relatif adalah rasio tingkat kejadian
suatu hasil dari tingkat kejadian kelompok yang terkena dengan hasil pada
kelompok tidak terpapar. Sebuah risiko relatif lebih besar dari 1,0 berarti subjek
yang terkena memiliki risiko lebih besar terkena penyakit yang diteliti dari
subyek terpajan, atau paparan yang muncul untuk menyebabkan penyakit.
Sebuah risiko relatif kurang dari 1,0 berarti subjek yang terkena memiliki risiko
lebih rendah dari penyakit daripada subyek terpajan, atau bahwa paparan
tampaknya melindungi terhadap penyakit. Sebuah risiko relatif 1,0 berarti
terkena paparan dan yang tidak terpapar memiliki risiko yang sama terserang
penyakit, atau bahwa paparan dan terkait penyakit yang muncul.

Salah satu dapat menghitung risiko relatif langsung dari hasil studi kohort.
Namun, dalam studi kasus-kontrol seseorang tidak dapat menentukan ukuran
baik populasi yang terpapar atau populasi terpajan bahwa diambil dari kasus
yang sakit dan kontrol tanpa penyakit. Hasil studi kasus kontrol tidak
memberikan informasi tentang tingkat insiden penyakit pada individu yang
terpapar dan tidak terpapar. Oleh karena itu, risiko relatif tidak dapat dihitung
langsung dari studi kasus-kontrol. Sebaliknya, dalam melaporkan hasil dari
studi kasus-kontrol umumnya melaporkan rasio odds, yang merupakan
perkiraan dekat dari risiko relatif ketika penyakit yang diteliti relatif jarang.
Sejak studi kasus-kontrol digunakan untuk mempelajari penyakit langka,
biasanya ada kesepakatan sangat dekat antara rasio odds dan risiko relatif, dan
hasil dari studi kasus-kontrol sering longgar disebut risiko sebagai relatif,
meskipun mereka sebenarnya rasio odds.

Kedua risiko relatif dan rasio odds dapat dilaporkan dengan nilai p. Nilai p ini
memungkinkan seseorang untuk menentukan apakah risiko relative signifikan
secara statistik berbeda dari 1.0, yaitu apakah perbedaan antara kedua kelompok
belajar cenderung karena variasi acak atau kemungkinan untuk mewakili
asosiasi nyata.
Atau, dan mungkin lebih, risiko relatif dan rasio odds dapat dilaporkan dengan
interval kepercayaan, yang merupakan indikasi dari berbagai risiko relatif di
mana risiko relatif berlaku untuk seluruh populasi teoritis yang paling mungkin
untuk berbohong. Sebagai perkiraan, interval kepercayaan 95% sekitar risiko
relatif berarti bahwa kita dapat 95% yakin bahwa risiko relatif benar terletak
pada kisaran antara batas bawah dan atas dari interval ini. Jika interval
kepercayaan 95% sekitar risiko relatif tidak termasuk 1.0, maka temuan ini
signifikan secara statistik dengan p-nilai kurang dari 0,05. Sebuah selang
kepercayaan memberikan lebih banyak informasi dari p-nilai, namun. Sebagai
contoh, sebuah penelitian yang menghasilkan risiko relatif (95% Interval con-
fidence) dari 1,0 (0,9-1,1) jelas menunjukkan bahwa asosiasi sangat tidak
mungkin. Sebuah studi yang menghasilkan risiko relatif (95% confidence
interval) dari 1,0 (0,1-100) memberikan sedikit bukti untuk atau terhadap
sebuah asosiasi. Namun, keduanya bisa dilaporkan sebagai risiko relatif 1,0 dan
p-value lebih besar dari 0,05. Sebagai contoh lain, sebuah penelitian yang
menghasilkan risiko relatif (95% confidence interval) dari 10,0 (9,8-10,2)
tepatnya mengkuantifikasi peningkatan sepuluh kali lipat risiko yang juga
signifikan secara statistik. Sebuah studi yang menghasilkan risiko relatif (95%
confidence interval) dari 10,0 (1,1-100) mengatakan sedikit, selain peningkatan
risiko kemungkinan. Namun, keduanya bisa dilaporkan sebagai risiko relatif
10,0 (p <0,05). Sebagai contoh terakhir, sebuah penelitian menghasilkan risiko
relatif (95% confidence interval) dari 3,0 (0,98-5,0) sangat sugestif dari asosiasi,
sedangkan studi melaporkan risiko relatif (95% confidence interval) dari 3,0
(0,1-30 ) tidak akan. Namun, keduanya bisa dilaporkan sebagai risiko relatif 3,0
(p> 0,05).

Akhirnya, statistik lain yang satu dapat menghitung dari penelitian kohort
adalah risiko kelebihan, juga disebut perbedaan resiko atau, kadang-kadang,
risiko yang timbul. Sedangkan risiko relatif adalah rasio tingkat insiden pada
kelompok terpapar versus kelompok terpajan, kelebihan risiko adalah perbedaan
aritmatika antara tingkat insiden. Risiko relatif lebih penting dalam
mempertimbangkan pertanyaan sebab-akibat. Risiko kelebihan yang lebih
penting dalam mempertimbangkan dampak kesehatan masyarakat dari asosiasi,
karena mewakili tingkat peningkatan penyakit akibat paparan. Misalnya,
kontrasepsi oral sangat terkait dengan perkembangan infark miokard di wanita
muda. Namun, risiko infark miokard pada wanita non-merokok di usia 20-an
sangat rendah, bahkan peningkatan lima kali lipat risiko yang akan masih tidak
penting kesehatan masyarakat. Sebaliknya, wanita di usia 40-an memiliki risiko
lebih tinggi, terutama jika mereka perokok juga. Dengan demikian, kontrasepsi
oral tidak harus mudah digunakan pada wanita ini

Seperti risiko relatif, risiko kelebihan tidak dapat dihitung dari studi kasus-
kontrol, seperti tingkat insiden tidak tersedia. Seperti dengan statistik lainnya, p-
nilai dapat dihitung untuk menentukan apakah perbedaan antara kedua
kelompok belajar bisa terjadi hanya kebetulan. interval kepercayaan dapat
dihitung sekitar risiko kelebihan juga, dan akan ditafsirkan analog.

RANDOMIZED CLINICAL TRIALS

Pada akhirnya , penelitian studi eksperimental di mana investigator mengontrol


terapi yang akan diterima oleh masing-masing peserta . Umumnya, penggunaan
penyidik yang mengontrol secara acak mengalokasikan antara pasien atau di
antara kelompok-kelompok studi , melakukan uji coba klinis secara acak .
Misalnya , orang bisa secara teoritis secara acak mengalokasikan wanita yang
aktif secara seksual untuk menggunakan kontrasepsi oral atau tidak ada
kontrasepsi , memeriksa apakah mereka berbeda dalam insiden dari
tromboemboli vena . Kekuatan utama dari pendekatan ini adalah tugas acak ,
yang merupakan satu-satunya cara untuk membuatnya mungkin bahwa
kelompok studi sebanding dalam variabel potensial yang tidak diketahui atau
terukur . Untuk alasan ini , asosiasi ditunjukkan dalam uji klinis acak lebih
mungkin menjadi penyebab asosiasi daripada yang ditunjukkan menggunakan
salah satu studi desain lain yang diulas di atas .

Namun, uji klinis yang dilakukan acak tidak tanpa masalah. Uji klinis secara
acak yang diuraikan di atas, mengalokasikan perempuan untuk menerima
kontrasepsi atau tidak ada kontrasepsi, menunjukkan potensi masalah utama
yang melekat dalam penggunaan desain penelitian ini. Ini jelas tidak mungkin
untuk melakukan etis dan logistik. Selain itu, uji klinis acak yang mahal dan
buatan. Karena mereka telah dilakukan sebelum pemasaran untuk menunjukkan
khasiat masing-masing obat, mereka cenderung tidak perlu setelah pemasaran.
Mereka mungkin digunakan dalam studi pharmacoepidemiology terutama untuk
studi kelayakan dari efficacy. bagaimanapun obat, mereka tetap "standar emas"
dimana desain lainnya harus dinilai. Memang, dengan publikasi hasil dari
Perempuan Health Initiative menunjukkan bahwa terapi kombinasi hormon
pengganti menyebabkan peningkatan risiko infark miokard daripada penurunan
risiko, telah terjadi peningkatan kekhawatiran tentang ketergantungan hanya
pada metode non-experimental untuk mempelajari keamanan obat setelah
dipasarkan, dan kita mulai melihat penggunaan besar-besaran uji klinis acak
sebagai bagian dari pengawasan setelah pemasaran (lihat Bab 39).

DIO

Bab 1 menunjukkan bahwa antara 500 dan 3.000 subjek biasanya terpapar obat
sebelum pemasaran, untuk mendeteksi 95% dari efek samping tertentu yang
terjadi di antara satu dan enam ribu orang terkena. Sementara ini tampaknya
seperti tujuan yang masuk akal, itu menimbulkan beberapa masalah penting
yang harus diperhitungkan ketika merencanakan studi pharmacoepidemiology.
Secara khusus, studi ini harus umumnya termasuk dalam jumlah yang memadai
sub-jects untuk menambahkan signifikan terhadap pengalaman premarketing,
dan persyaratan ini untuk ukuran sampel yang besar menimbulkan hambatan
logistik studi hemat biaya. Ini kebutuhan khusus pusat untuk ukuran sampel
yang besar adalah apa yang telah menyebabkan pendekatan inovatif untuk
mengumpulkan pharmacoepidemiologic data yang dijelaskan dalam Bagian III
buku ini.

Pendekatan untuk mempertimbangkan implikasi dari ukuran sampel penelitian


ini agak berbeda tergantung pada apakah studi telah selesai atau sedang
direncanakan. Setelah penelitian selesai, jika temuan nyata secara statistik
signifikan, maka penelitian ini memiliki ukuran sampel yang cukup untuk
mendeteksi itu, menurut definisi. Jika temuan itu tidak signifikan secara
statistik, maka salah satu dapat menggunakan salah satu dari dua pendekatan.
Pertama, satu Mei ujian ine interval kepercayaan yang dihasilkan untuk
menentukan perbedaan terkecil antara dua kelompok belajar bahwa studi ini
memiliki ukuran sampel yang cukup untuk exclude.1 Alter-native, salah satu
bisa mendekati pertanyaan dengan cara yang mirip dengan cara yang akan
pendekatan jika studi perencanaan de novo. Nomogram dapat digunakan untuk
membantu pembaca dalam menafsirkan uji klinis negatif di way

Dalam bab ini sebaiknya kita akan membahas secara lebih rinci bagaimana
menentukan studi ukuran sampel yang sesuai, dari perspektif orang-orang yang
merancang studi de novo. Secara khusus, kami akan mulai dengan membahas
bagaimana seseorang menghitung ukuran sampel minimum yang diperlukan
untuk studi pharmacoepidemi-ology, untuk menghindari masalah dengan
ukuran sampel penelitian adalah terlalu kecil. Kami pertama akan menyajikan
pendekatan untuk studi kohort, kemudian studi kasus-kontrol, dan kemudian ke
seri kasus. Untuk setiap desain, satu atau lebih tabel akan disajikan untuk
membantu pembaca dalam melakukan perhitungan ini.
PERHITUNGAN CONTOH UKURAN UNTUK KOHOR

STUDI

Ukuran sampel yang dibutuhkan untuk penelitian kohort tergantung pada apa
yang Anda harapkan dari penelitian. Untuk menghitung ukuran sampel untuk
kohort studi, salah satu kebutuhan untuk menentukan lima variabel (lihat Tabel
3.1) .3,4

Variabel pertama untuk menentukan adalah alpha (α) atau ketik Ierror yang satu
bersedia untuk mentolerir dalam penelitian ini. Tipe I erroris probabilitas
menyimpulkan tidak ada perbedaan antara kelompok dibandingkan ketika
benar-benar tidak ada dif-ference. Menggunakan tes diagnostik sebagai analogi,
kesalahan tipe I adalah palsu temuan penelitian yang positif. Lebih toleran
bersedia menjadi tipe I kesalahan, semakin kecil ukuran sampel yang
diperlukan. Kurang toleran bersedia menjadi tipe I error, yang lebih kecil akan
mengatur α, dan semakin besar ukuran sampel akan diperlukan. α konvensional
ditetapkan pada 0,05, meskipun ini tentu saja tidak harus terjadi. Perhatikan
bahwa α harus ditentukan baik sebagai ekor atau dua ekor. Jika hanya satu
kelompok studi dibayangkan bisa lebih mungkin untuk mengembangkan
penyakit ini dan mereka yang tertarik dalam mendeteksi hasil ini saja, maka
orang akan menentukan α yang menjadi ekor. Jika salah satu dari kelompok
belajar mungkin mungkin untuk mengembangkan penyakit, dan semakin baik
hasilnya akan menarik, maka orang akan menentukan α menjadi dua ekor.
Untuk memutuskan apakah α harus menjadi salah satu-ekor atau dua ekor,
penyidik harus mempertimbangkan apa reaksinya akan hasil yang signifikan
secara statistik dalam arah yang berlawanan dengan yang diharapkan. Misalnya,
bagaimana jika salah satu mengamati bahwa obat meningkatkan frekuensi
kematian dari penyakit arteri koroner bukannya menurun itu, seperti yang
diharapkan? Jika respon penyidik untuk ini akan menjadi: "Boy, apa kejutan,
tapi saya percaya itu," tes dua ekor harus dilakukan. Jika respon penyidik akan:
"Saya tidak percaya itu, dan aku akan menganggapnya hanya sebagai studi yang
tidak menunjukkan penurunan yang diharapkan dari penyakit arteri koroner
pada kelompok yang diobati dengan obat studi," tes satu sisi harus dilakukan.
Lebih Opsi konservatif adalah uji dua sisi, dengan asumsi bahwa hasil bisa
berubah di kedua arah. Ini adalah pilihan yang biasanya, meskipun tidak selalu,
digunakan.

Variabel kedua yang perlu ditentukan kal-culate ukuran sampel untuk studi
kohort adalah beta (β) atau kesalahan typeII yang bersedia untuk mentolerir
dalam penelitian ini. Jenis IIerror adalah probabilitas menyimpulkan tidak ada
perbedaan antara kelompok dibandingkan padahal sebenarnya perbedaan
memang ada. Dengan kata lain, kesalahan tipe II adalah probabilitas hilang
perbedaan nyata. Menggunakan tes diagnostik sebagai analogi, kesalahan tipe II
adalah palsu temuan studi negatif. Komplemen dari β adalah kekuatan
penelitian, yaitu, probabilitas mendeteksi perbedaan jika perbedaan itu benar-
benar ada. Listrik dihitung sebagai (1 -β). Sekali lagi, lebih toleran bersedia
menjadi kesalahan tipe II, yaitu, β tinggi, semakin kecil ukuran sampel yang
diperlukan. β secara konvensional ditetapkan pada 0,1 (yaitu, 90% power) atau
0,2 (yaitu, 80% daya), meskipun lagi ini tidak perlu terjadi. β selalu satu ekor.

Perlu menentukan variabel ketiga untuk menghitung ukuran sampel untuk efek
ukuran penelitian kohort adalah salah minimal ingin dapat mendeteksi. Untuk
studi kohort, ini dinyatakan sebagai risiko relatif. Semakin kecil risiko relatif
yang satu ingin mendeteksi, semakin besar ukuran sampel yang diperlukan.
Perhatikan bahwa risiko relatif sering digunakan oleh para peneliti dalam
perhitungan ini adalah risiko relatif dari studi peneliti berharap. Hal ini tidak
benar, karena akan menyebabkan daya INAD-menyamakan untuk mendeteksi
risiko relatif yang lebih kecil dari yang diharapkan, tapi masih klinis penting
kepada penyidik. Dengan kata lain, jika seseorang memilih ukuran sampel yang
dirancang untuk mendeteksi risiko relatif 2,5, seseorang harus nyaman dengan
pikiran bahwa, jika risiko relatif benar-benar berubah menjadi 2,2, salah satu
mungkin tidak dapat mendeteksi itu sebagai temuan signifikan secara statistik.

Variabel keempat orang perlu untuk menentukan adalah kejadian yang


diharapkan dari kepentingan pada kelompok kontrol yang tidak terpajan. Sekali
lagi, semakin banyak Anda bertanya penelitian, semakin besar ukuran sampel
yang dibutuhkan. Secara khusus, jarang hasil dari bunga, semakin besar ukuran
sampel diperlukan

Tabel 3.1 . Informasi yang diperlukan untuk menghitung ukuran sampel


penelitian

Untuk penelitian kohort Untuk penelitian case-control (kasus-


kontrol)
(1)α atau tipe I terjadi kesalahan dianggap (1)α atau tipe I terjadi kesalahan dianggap
ditoleransi, dan apakah itu termasuk satu- ditoleransi, dan apakah itu termasuk satu-
ekor atau dua-ekor. ekor atau dua-ekor.
(2)β atau jenis kesalahan tipe II dianggap (2)β atau jenis kesalahan tipe II dianggap
ditoleransi. ditoleransi.
(3)Risiko relatif Minimum untuk (3)Risiko relatif Minimum untuk
dideteksi. dideteksi.
(4)Insiden penyakit pada kelompok (4)Prevalensi paparan yang tidak sakit
kontrol tidak tersedia. dalam kontrol kelompok.
(5)Rasio kontrol tidak terpapar dengan (5)Rasio kontrol tidak sakit untuk subyek
penelitian subyek yang terkena. penelitian yang sakit.
PERTIMBANGAN CONTOH UKURAN UNTUK STUDI
FARMAKOEPIDEMOLOGI

Variabel kelima orang perlu untuk menentukan jumlah subyek kontrol untuk
dimasukkan dalam masing-masing subjek studi yang terkena. Sebuah studi
memiliki daya statistikuntuk sejumlah studi pelajaran tertentu jika
memilikijumlah yang sama kontrol sebagai subyek yang terkena.
Namun,kadang-kadang jumlah subyek yang terpapar terbatas. Oleh karena itu,
tidak memadai untuk memberikan daya yang cukup untuk mendeteksi risiko
yang relatif menarik. Dalam hal ini, daya tambahan dapatdiperoleh dengan
meningkatkan jumlah kontrol saja. Menggandakanjumlah kontrol, yang
termasuk dua kontrol untukmasing-masing subjek terkena, menyebabkan sedikit
peningkatan dalamkekuatan statistik, tetapi itu tidak ganda. Termasuk
tigakontrol untuk setiap mata pelajaran yang terkena meningkatkan dayalebih
lanjut. Namun, kenaikan daya yang dicapai denganmeningkatkan rasio subjek
kontrol untuk subyek yang terpapardari 2: 1 sampai 3: 1 lebih kecil dari
kenaikan yang dicapai dengan meningkatkan rasio dari 1: 1 sampai 2: 1.
Setiappeningkatan tambahan dalam ukuran kelompok kontrol meningkatkan
kekuatan penelitian lebih lanjut, tetapi dengan semakin lebih kecil keuntungan
di kekuatan statistik. Dengan demikian, jarang ada anak yang menyertakan lebih
dari tiga atau empat kontrol per studisubyek. Misalnya, orang bisa merancang
sebuah studi denganαdari0,05 untuk mendeteksi risiko relatif 2,0 untuk variabel
hasilyang terjadi pada kelompok kontrol dengan tingkat kejadian0.01.Sebuah
studi dengan 2319 individu yang terpapar dan 2319 kontrol akan menghasilkan
kekuatan 0,80, atau 80% kemungkinan darimendeteksi perbedaan besarnya itu.
Dengan sama2319 subyek yang terpapar, rasio subjek kontrol untuk
terkenasubyek dari 1: 1, 2: 1, 3: 1, 4: 1, 5: 1, 10: 1, dan 50: 1akan menghasilkan
kekuatan statistik 0,80, 0,887, 0,913,0,926, 0,933, 0,947, dan 0,956, masing-
masing. Hal ini penting untuk membedakan antara rasiojumlah kontrol dan
jumlah kelompok kontrol. Bukan hanya itu saja studi dalam kasus-kontrol, di
mana pemilihan kelompok kontrol yang tepat bisa sulit untuk memilih lebih dari
satu kelompok kontrol. Hal ini dilakukan karena alasan validitas, tidak dengan
kekuatan statistik, dan beberapa kelompok kontrol tidak digabungkan dalam
analisis. Disituasi ini, tujuannya adalah untuk memastikan bahwa setiap
perbandinganmenghasilkan jawaban yang sama, tidak untuk meningkatkan
sampel yang tersedia. Dengan demikian, perbandingan masing-masing
kelompok kontrol ke subyek yang terpapar harus diperlakukan sebagai studi
terpisah. Itu perbandingan kelompok terpapar setiap kelompok kontrol
membutuhkan perhitungan ukuran sampel yang terpisah. Setelah lima variabel
di atas telah ditentukan, ukuran sampel yang dibutuhkan untuk studi tertentu
dapat dihitung. Beberapa formula yang berbeda telah digunakan untuk kalkulasi
ini masing-masing memberikan hasil yang sedikit berbeda. Formula yang
mungkin paling sering digunakan dimodifikasi dari Schlesselman:

1 1

----------
---------- --
------- -

N 1 U 1
2 Z1 –α
= p 1 –R [ + K– U
2

p 1 –
p

+ Z1 –βpR 1 – Rp +
-------------------

K ]

P yang merupakan kejadian penyakit yang tidak terkena, dan R merupakan


risiko relatif minimum untuk dideteksi. α adalah tipe I tingkat kesalahan yang
dapat diterima, β adalah jenis tingkat kesalahan IIyang diterima, Z1-α dan Z1-β
merujuk ke unit yang normal menyimpang sesuai dengan α dan β. K adalah
rasio jumlah subjek kontrol untuk jumlah subyek yang terpapar, danZ 1-
αdigantikan oleh Z1- α/2 jika ada yang berencana untuk menganalisis penelitian
menggunakan dua ekor α.

Kp + pR

U=
--------------------

K+1

K merupakan rasio jumlah subjek kontrol untuk jumlah subyek yang terpapar.
Serangkaian tabel disajikan dalam Lampiran A, yang dihitung dengan
menggunakan rumus ini. Dalam Tabel A1-A4 kami telah diasumsikan α (Dua
sisi) dari 0,05, β 0,1 (90% kekuasaan), dan kontrol rasio terkena 1: 1, 2: 1, 3: 1,
dan 4: 1, masing-masing. Tabel A5-A8 yang sama, kecuali mereka
mengasumsikan β 0,2 (80% power). Setiap tabel menyajikan Jumlah subjek
terkena diperlukan untuk mendeteksi salah satu dari beberapaditentukan risiko
relatif, untuk variabel hasil yang terjadi disalah satu dari beberapa tingkat
insiden yang ditentukan. Misalnya, bagaimana jika seseorang ingin menyelidiki
nonsteroidal anti-inflammatory obat yang akan dipasarkan, tapi premarketing
memberi pertanyaan data tentang kemungkinan hepatotoksisitas? Ini akan
mungkin dipelajari menggunakan desain penelitian kohort dan tergantung pada
nilai-nilai dipilih untuk α. β, kejadian penyakit dalam tersedia, risiko relatif
seseorang dapat terdeteksi, dan rasio kontrol untuk yang terkena ukuran sampel
dibutuhkan bisa sangat berbeda (lihat Tabel 3.2). Sebagai contoh, bagaimana
jika tujuan Anda adalah untuk mempelajari hepatitis yang terjadi, katakanlah, di
0,1% dari semua individu tersedia? Jika seseorang ingin merancang studi
dengan satu kontrol per terkena subjek untuk mendeteksi risiko relatif 2,0 untuk
variabel hasil ini, dengan asumsi α (Dua sisi) dari 0,05 dan β 0,1, orang bisa
melihat pada Tabel A1 bahwa itu akan membutuhkan 31483 subyek yang
terpapar, serta jumlah yang sama kontrol tidak terekspos. Jika satu orang kurang
peduli dengan hilang temuan nyata, bahkan jika itu ada, orang bisa mengubah β
0,2, dan sampel yang dibutuhkan ukuran akan turun menjadi 23.518 (lihat Tabel
3.2 dan Tabel A5). Jika satu ingin meminimalkan jumlah mata pelajaran terkena
diperlukan untuk penelitian, satu dapat mencakup hingga empat kontrol untuk
setiap yang terkena ( Tabel 3.2 dan Tabel A8 ) . Ini akan menghasilkan ukuran
sampel dari 13402, dengan empat kali banyak kontrol, total 67010 subyek.
Akhirnya, jika satu menganggap terbayangkan bahwa obat baru ini bisa
melindungi
terhadap penyakit hati dan satu tidak tertarik pada hasil yang, maka salah satu
mungkin menggunakan satu ekor α, Sehingga ukuran sampel yang lebih rendah
dari 10728 dengan empat kali lebih banyak kontrol. ukuran sampel yang lebih
kecil yang diperlukan untuk mendeteksi risiko relatif 4,0 atau lebih besar ini
juga disajikan dalam Tabel 3.2.

Table 3.1. Information needed to calculate a study’s sample size

For cohort studies For case–control studies

(
1 α or type I error considered tolerable, α or type I error considered
) and whether it is (1) tolerable, and whether it is

one-tailed or two-tailed one-tailed or two tailed

(
2 β or type II error considered
) β or type II error considered tolerable (2) tolerable

(
3 Minimum relative risk to be
) Minimum relative risk to be detected (3) detected

(
4 Incidence of the disease in the Prevalence of the exposure in the
) unexposed control group (4) undiseased control

Group

Ratio of unexposed controls to Ratio of undiseased controls to


(
exposed study subjects (5) diseased study subjects
5
)

Table 3.2. Contohukuransampel yang dibutuhkanuntukpenelitiankohort

Sebaliknya, bagaimanajikatujuanseseorangadalahmempelajaritesfungsihati yang


tinggi, yang dapatdikatakanterjadipada 1% daripopulasi yang
tidakterkena?Jikaseseoranginginmendeteksirisikorelatifdari 2
ataulebihvariabelhasil yang umum,hanya 3.104
subyekakandiperlukandalamsetiapkelompok, denganasumsiduaekorα dari0,05,
sebuah β 0,1, dansatukontrol per subjekterkena.Atau,
jikaseseoranginginmendeteksirisikorelatifyang samauntukvariabelhasil yang
terjadisejarang0,0001, mungkinkolestatikpenyakitkuning,
satuakanmembutuhkan 315268 subyekdalamsetiapkelompokstudi.

Jelas,
studikohortmemerlukansampeldenganukuransangatbesaruntukmempelajaripeny
akittidakbiasaataulangka.Sebuahstudidaripenyakittidakbiasainiseringkalilebihba
ikdilakukandenganmenggunakandesainstudikasus-kontrol, seperti yang
dijelaskandalambabsebelumnya.

PERHITUNGAN SAMPLE SIZE UNTUKSTUDI KASUS-CONTROL

Pendekatanuntukmenghitungukuransampelpadastudikasus-
kontrolmiripdenganpendekatanuntukstudikohort.Lagipula,adalimavariabel yang
perluditentukan (lihatTabel3.1). Tiga di antaranyaadalah α, atautipe I kesalahan
yang bersediamenoleransi; β, ataukesalahantipe II ada yang
bersediauntukmentolerir;danselisihperbandingan minimum
(perkiraandaririsikorelatif) yang dapatdideteksi.
Inisemuadibahaspadabagianstudikohort, di atas.

Selainitu, dalamstudikasus-
kontrolsatusubyekdipilihdidasarkanpadaadaatautidakadanyapenyakit yang
menarikperhatian,dankemudianmenyelidikiprevalensipaparanmenarik di
setiapkelompokstudi.Hal iniberbedadenganstudikohort, di
manasalahsatumemilihsubjekberdasarkanadaatautidakadanyapaparan,
dankemudianstudiadaatautidaknyapenyakitpenting yangberkembang di masing-
masingkelompok.Olehkarenaitu,variabelkeempatuntukmenentukanstudikasus-
kontroladalahprevalensi yang
diharapkandaripaparandalamkontrolkelompokpenyakit,
bukankejadianpenyakitkepentingan dikelompokkontrol yang
tidakterlihatdaristudikohort.

Akhirnya,
sejalandenganpertimbangandalamstudikohortpadarasiojumlahsubyekkontroltida
kterpaparuntukjumlahsubyekpenelitianyang terkena,
salahsatukebutuhanuntukpertimbangandalamstudikasus-
kontrolrasiojumlahsubyekkontrolundiseaseduntukjumlahstudi yang sakitsubyek.
Prinsip-prinsipdalammemutuskanrasio yang sesuaiuntukpenggunaan yang
samapadakeduadesainstudi. Sekalilagi, adaalasanyang
jaranguntukdisertakanrasiolebihbesardari 3: 1 atau 4:1. Sebagaicontoh, jikasatu
orang untukmerancangsebuahstudidengandua aα ekordari 0,05
untukmendeteksirisikorelatif 2,0 untukpaparan yang terjadipada 5%
darikontrolundiseasedkelompok, studidengan 516 individu yang sakitdan 516
conTrolsakanmenghasilkankekuatan 0,80, atau 80%
kemungkinandarimendeteksiperbedaansebesaritu. Studidengansama516 subyek
yang sakitdanrasiokontroluntukkasus 1:
1, 2: 1, 3: 1, 4: 1, 5: 1, 10: 1, dan 50: 1 akanmenghasilkankekuatanstatistik 0,80,
0,889, 0,916, 0,929, 0,936,0,949, dan 0,959, masing-masing.

Rumusuntukmenghitungukuransampeluntukkasus-
sebuahstudikontrolmiripdengan yang untukpenelitiankohort
(dimodifikasidarischlesselman)

1/ p – V 2(Z 1 – α 1 + K U 1 – U + Z 1–β p 1–p ⁄K+V 1–V ]


2)

dimana R, α, β, Z 1 - α, dan Z 1 - β adalahseperti di atas, p adalah prevalence,


yanglencedaripaparanpadakelompokkontrol, dan K
adalahrasiosubyekkontrolundiseaseduntukkasussakit,

U =-- p K +K + 1R

dan

pR / 1 + p R –1

Sekalilagi, serangkaiantabel yang menyediakanukuransampeluntukstudikasus-


kontroldisajikanpadaLampiran A. PadaTabelA9-A12,
kitatelahmengasumsikansuatu α (dua-tailed) sebesar 0,05, beta0,1 (90% daya),
dankontrolrasiokasus 1: 1, 2: 1,3: 1, dan 4: 1, masing-masing. Tabel A13-A16
adalahsama,kecualimerekamenganggap β dari 0,2(daya 80%). Setiaptable
menyajikanjumlahmatapelajaran yang
sakitdiperlukanuntukmendeteksisalahsatudarisejumlahrisikorelatifditentukan,
untuksejumlahtarifpaparanditentukan.

Misalnya, bagaimanajikalagisatuinginmenyelidikiobat anti-inflamasibaruyang


akanmenjadidipasarkannamundata
premarketingnyamengangkatpertanyaankemungkinankeracunannya? Kali ini,
bagaimanapun, pertamaadalahmencobamenggunakankasus-
kontroldesainpenelitian.Sekalilagi, tergantungpadanilai-nilai yang dipilihdari α,
β, dansebagainya, ukuransampeldibutuhkanbisasangatberbeda (lihatTabel
3.3).Sebagaicontoh,bagaimanajikaseseoranginginmerancangsebuahstudidengans
atukontrol persubjek yang sakit, denganasumsi α (duasisi) dari 0,05 dan β
a0,1?Ukuransampel yang dibutuhkanuntukmendeteksirisikorelative 2,0
untuksetiappenyakitakanbervariasi, tergantungpada prevalence,
yanglencepenggunaanobat yang sedangdipelajari.
Jikasalahsatuoptimisdiasumsikanobatakandigunakanhampirsamaseringsebagaiib
uprofen, denganmungkin 1% daripopulasi, makasalahsatubisamelihatTabel A9
danmelihatbahwaituakanmembutuhkan 3210subyek yang sakitdanjumlah yang
samadariundiseasedkontrol.
Jikasalahsatukurangpedulidenganhilangnyataasosiasi, bahkanjikaituada, orang
bisamemilihuntuk β dari 0,2,danukuransampel yang
dibutuhkanakanturunmenjadi 2398 (lihatTabel3.3 danTabel A13).
Jikaseseoranginginmeminimalkanjumlahmatapelajaran yang
sakitdiperlukanuntukpenelitian,
satudapatmencakuphinggaempatkontroluntuksetiapmatapelajaranterkena (Tabel
3.3 danTabel A16).Iniakanmenghasilkanukuransampel 1370,denganempat kali
lebihbanyakkontrol. Akhirnya,
jikakitamenganggapitudibayangkanbahwaobatbaruinibisamelindungihatipenyak
it, makasalahsatumungkinmenggunakan α satu-ekor,
menghasilkanukuransampelagaklebihrendahdari 1096, lagidenganempat
kalibanyakkontrol. ukuransampel yang lebihkecil yang
diperlukanuntukmendeteksirisikorelatif 4,0
ataulebihbesardanjugadisajikanpadaTabel 3.3.

Sebaliknya,
bagaimanajikaperkiraanseseorangdaripenjualanobatbarulebihkonservatif?Jikase
seoranginginmendeteksirisikorelative dari 2,0 denganasumsipenjualanke 0,1%
daripopulasi, mungkinmiripdengantolmetin, kemudian 31 588
subyekakandibutuhkan dimasing-masingkelompok, denganasumsi α dua-tailed
0,05, sebuah β 0,1, dansatukontrol per subjek yang sakit. Sebaliknya,
jikasalahsatuperkiraanobatakandigunakanhanya 0,01% daripasien,
mungkinsepertifenilbutazon, satuakanmembutuhkan 315 373 subyek di
setiapkelompokbelajar.Jelas, studikasus-
kontroldapatmemerlukansangatbesarukuransampeluntukmempelajariobat yang
relatifjarangdigunakan.DiSelainitu, masing-
masingpenyakitmemerlukankelompokkasus yang terpisahdan,dengandemikian,
sebuahstuditerpisah.Dengandemikian, seperti yang dijelaskandalamsebelumbab,
penelitianobat yang digunakanjarangdanbaruobat yang
dipasarkanbiasanyalebihbaikdilakukandenganmenggunakanpenelitiankohortdes
ain

Seperti dijelaskan dalam Bab 2, utilitas dari serangkaian kasus di


farmakoepidemiologi terbatas, sebagai tidak adanya kelompok kontrol membuat
inferensi kausal sulit. Meskipun demikian, bagaimanapun juga , ini adalah
desain yang telah digunakan berulang kali. Ada pertanyaan ilmiah yang dapat
diatasi dengan menggunakan desain ini, dan koleksi yang setara kelompok
kontrol dengan ukuran seri kasus akan menambah biaya yang cukup besar untuk
penelitian. serangkaian kasus biasanya digunakan dalam farmakoepidemiologi
menduga jumlah yang lebih baik kejadian penyakit tertentu pada pasien terkena
obat baru dipasarkan. Misalnya, dalam "Tahap IV" postmarketing penelitian
pengamatan obat dilakukan untuk prazosin, para peneliti mengumpulkan
serangkaian kasus dari 10 000 subyek yang baru terkena dan direkrut melalui
tenaga penjualan pabrikan, menduga jumlah yang lebih baik kejadian dosis
pertama, yang merupakan yang diduga efek samping dari obat.5,6 Seri kasus
biasanya digunakan untuk menentukan apakah penyakit terjadi lebih sering
daripada beberapa kejadian yang telah ditentukan pada pasien yang terkena.
Paling sering, kejadian yang telah ditentukan menarik adalah nol, dan satu
mencari setiap kejadian penyakit yang sangat langka. Sebagai contoh lain,
ketika cimetidine pertama kali dipasarkan, ada kekhawatiran apakah itu bisa
menyebabkan agranulositosis, karena itu berkaitan erat kimia untuk metiamide,
lain H-2 blocker, yang telah dihapus dari pasar di Eropa karena disebabkan
agranulositosis. Penelitian ini juga mengumpulkan 10 000 subyek. Ini hanya
ditemukan dua kasus neutropenia, satu pasien juga menerima kemo terapi.
Tidak ada kasus agranulocytosis.7

Untuk membangun keamanan obat, penelitian harus menyertakan jumlah subjek


yang memadai untuk mendeteksi kejadian peningkatan penyakit, jika ada.
Umumnya, ini dihitung dengan asumsi frekuensi kejadian yang dimaksud
adalah makin kecil, sehingga terjadinya peristiwa tersebut mengikuti distribusi
Poisson, dan kemudian perhitungan umum sekitar 95% interval kepercayaan
hasilnya diamati.

Tabel A17 dalam Lampiran A menyajikan tabel berguna untuk membuat


calculation.8 Untuk menerapkan tabel ini, yang pertama menghitung tingkat
kejadian diamati dari hasil studi tersebut, yaitu jumlah subjek yang
menghasilkan penyebaran penyakit selama interval waktu yang ditentukan,
dibagi dengan jumlah total individu dalam populasi berisiko. Misalnya, jika tiga
kasus penyakit hati yang diamati pada populasi 1.000 pasien terkena obat anti-
inflamasi nonsteroid baru selama periode waktu tertentu, kejadian akan 0,003.
Jumlah subjek yang mengembangkan penyakit adalah "jumlah yang diamati
yang estimasi didasarkan (n)" pada Tabel A17. Dalam contoh ini, itu adalah 3.
batas bawah dari interval kepercayaan 95% untuk tingkat kejadian ini kemudian
yang sesuai "Bawah faktor limit (L)" dikalikan dengan tingkat kejadian yang
.
diamati. Dalam contoh di atas, itu akan menjadi 0,206 0,003 = 0.000 618.
Sekilas, batas atas akan menjadi produk dari "faktor Batas atas (U)" sesuai
dikalikan dengan tingkat kejadian yang diamati. Dalam contoh di atas, ini akan
.
menjadi 2,92 0,003 = 0,00876. Dengan kata lain, tingkat kejadian (95%
interval kepercayaan) akan 0,003 (,000618-0,00876). Dengan demikian,
estimasi terbaik dari tingkat kejadian akan menjadi 30 per 10 000, tapi ada 95%
kemungkinan bahwa itu terletak di antara 6.18 per 10 000 dan 87,6 per 10 000.

Selain itu, panduan sederhana yang membantu adalah apa yang disebut "aturan
bertiga," berguna dalam situasi umum di mana ada kegiatan dari jenis tertentu
yang diteliti.8 Secara khusus, jika ada kegiatan dari jenis tertentu diamati dalam
studi X individu, maka salah satu dapat 95% yakin bahwa peristiwa itu terjadi
tidak lebih sering daripada 3 / X. Misalnya, jika 500 pasien dipelajari sebelum
pemasaran obat, maka salah satu dapat 95% yakin bahwa setiap peristiwa yang
tidak terjadi di salah satu dari mereka pasien dapat terjadi dengan frekuensi 3
atau kurang di 500 subyek yang terpapar, atau bahwa memiliki tingkat kejadian
kurang dari 0,006. Jika 3000 subyek yang terkena sebelum pemasaran obat,
maka salah satu dapat 95% yakin bahwa setiap peristiwa yang tidak terjadi pada
populasi ini mungkin terjadi tidak lebih dari 3 di 3000 subyek, atau peristiwa
memiliki tingkat kejadian kurang dari 0,001. Akhirnya, jika 10 000 subyek yang
dipelajari dalam penelitian surveilans obat postmarketing, maka salah satu dapat
95% yakin bahwa setiap kejadian yang tidak diamati mungkin terjadi tidak lebih
dari 3 di 10 000 orang terkena, atau bahwa mereka memiliki tingkat kejadian
kurang dari 0,0003. Dengan kata lain, peristiwa tidak terdeteksi dalam
penelitian ini dapat terjadi lebih jarang dari 1 di 3333 subyek.

Diskusi diatas tentang penentuan ukuran sampel dalam penelitian kohort dan
case-control yang menganggap bahwa seseorang dapat memperoleh informasi
dari masing-masing lima variabel yang menjadi faktor perhitungan ukuran
sampel tersebut. apakah ini sebenarnya realistis ? empat dari variabel, pada
kenyataannya, benar-benar dikontrol oleh peneliti, patuh atau spesifikasi : α, β,
merupakan perbandingan dari kontrol subjek untuk mempelajari subjek, dan
resiko relatif minimum untuk bisa dideteksi. Hanya satu variabel yang
membutuhkan data yang berasal dari sumber lain. Untuk study cohort, ini
adalah kejadian yang diharapkan dari suatu penyakit dalam unex-posed pada
kelompok kontrol. Untuk study case-control. Ini adalah prevalensi yang
diharapkan dari paparan dalam undiseased pada kelompok kontrol. Dalam
mempertimbangkan informasi yang diperlukan, sangat penting menyadari
bahwa dalam proses perhitungan ukuran sampel itu adalah perkiraan, meskipun
sophis-ticationnya matematika. Tidak ada alasan yang kuat mengapa α harus
0,05, sebagai perbandingan untuk 0,06 atau 0,04. Variabel lain ditentukan oleh
peneliti yang sama halnya dengan arby-trary. Dengan demikian, hanya
perkiraan yang dibutuhkan untuk variabel yang hilang. Seringkali informasi
yang dibutuhkan sudah tersedia dari beberapa sumber data yang ada, untuk
contohnya statistik vital atau sumber data pemanfaatan obat komersial. Jika
tidak, seseorang bisa mencari pada literatur medis untuk satu atau lebih study
yang telah dikumpulkan sebagai data definisi populasi, baik secara sengaja atau
oleh produk dari data yang mereka kumpulkan, dan menganggap populasi anda
akan belajar hal yang sama. Jika ini bukan pemikiran yang tepat, atau jika tidak
ada data tersebut dalam literatur medis, ada satu yang tersisa dengan dua
alternatif. Yang pertama, dan terbaik, alternatif adalah studi yang dilakukan
dalam contoh yang kecil dalam suatu populasi, dalam mengukur informasi yang
dibutuhkan. Yang kedua adalah hanya untuk menebak. Dalam kasus kedua,
salah-satunya harus mempertimbangkan apakah tebakannya masuk akal dan
mungkin tebakannya rendah. juga, untuk melihat apakah besarnya sampel anda
harus meningkatkan dalam memperhitungkan ketidaktepatan perkiraan kita.

Akhirnya, bagaimana jika seseorang mempelajari beberapa hasil variabel,


(dalam penelitian kohort) atau beberapa variabel exposure (dalam penelitian
case-control), yang mana masing-masing berbeda dalam frekuensi yang anda
harapkan dalam kelompok kontrol ? dalam situasi itu, investigator akan fokus
pada ukuran sampel penelitian pada variabel yang mengarah ke kebutuhan yang
besar, dan perhatikan bahwa penelitian tersebut akan memiliki kekuatan yang
lebih untuk variabel yang lainnya (atau exposure). Hal ini biasanya mempunyai
hasil yang terbaik yang dapat diharapkan dari ukuran sampel yang minimum.
Bagaimanapun juga, untuk memungkinkan beberapa peluang jika salah-satu
asumsi yang mendasar itu salah. Ini juga akan mengizinkan subkelompok untuk
menganalisa dengan kemampuan yang memadai. Bahkan, jika ada yang penting
dalam analisis subkelompok yang mewakili hipotesa a priori untuk dievaluasi,
kita harus melakukan perhitungan ukuran sampel untuk subkelompok.

Yang perlu diperhatikan dalam perhitungan ukuran sampel adalah proses yang
berulang-ulang. Tidak ada yang salah dengan perhitungan awal, yang perlu
disadari bahwa itu akan menghasilkan ukuran sampel yang tidak realistis, dan
kemudian memodifikasi asumsi yang mendasar. Yang terpenting adalah peneliti
memeriksa asumsi akhir dengan teliti, menanyakan apakah, mengingat
kesepakatan yang dibuat, dan penelitian ini masih layak dilakukan.

Perhatikan bahwa diskusi diatas dibatasi untuk perhitungan ukuran sampel saja
untuk variabel dichotomus, yaitu variabel yang hanya mempunyai dua pilihan:
subjek yang mempunyai penyakit atau tidak mempunyai penyakit. Informasi
tidak disajikan pada perhitungan ukuran sampel untuk variabel hasil yang
berkelanjutan, yaitu variable yang mempunyai beberapa pengukuran, seperti
tinggi badan, berat badan, tekanan darah, atau kadar kolesterol. Secara
keseluruhan, variabel kontinu dapat digunakan sebagai variabel hasil, kecuali
pengukurannya sangat tidak tepat, akan menghasilkan peningkatan kekuatan
dalam sebuah penelitian. Rincian tentang ini dihilangkan karena study
epidemiologi biasanya tidak menggunakan variabel tersebut. Pembaca yang
tertarik dapat memperoleh informasi yang lebih lanjut tentang ini dapat
berkonsultasi dalam buku teks dari perhitungan ukuran sampel.

Semua diskusi sebelumya telah difokuskan pada pada perhitungan ukuran


sampel minimum yang diperlukan. Namun, dua isu lainnya khusus untuk
farmakoepidemiologi yang penting untuk dipertimbangkan. Pertama, salah satu
keuntungan dari postmarketing study farmakoepidemiologi adalah peningkatan
sensitivitas terhadap efek samping yang jarang terjadi, termasuk ukuran sampel
yang lebih besar daripada yang digunakan sebelum pemasaran. Karena antara
500 dan 3000 pasien yang biasa digunakan pada study sebelum pemasaran,
kebanyakan farmakoepidemiologi study kohort dirancang untuk menggunakan
setidaknya 10.000 subyek yang terpapar penyakit. Jumlah penduduk dimana
10.000 subyek yang terkena akan diambil harus jauh lebih besar, tentu saja,
study case-kontrol bisa jauh lebih kecil, tetapi umunya perlu mengambil kasus
dan kontrol dari suatu populasi seperti pada study kohort. Angka ini tidak
diambil secara semaunya, tetapi didasarkan pada prinsip-prinsip seperti yang
sudah diuraikan diatas, diterapkan pada pertanyaan yang penting dalam
mengatasi pengaturan dalam post marketing. Namun demikian, angka-angka ini
tidak boleh semata-mata diterima tetapi harus dipertimbangkan kembali untuk
setiap studi tertentu. Beberapa penelitian akan membutuhkan subjec yang
sedikit ; banyak juga yang memerlukan subjec yang banyak. Untuk akumulasi
ukuran sampel saat melakukan penelitian harus hemat biaya, beberap tekhnik
khusus perlu dikembangkan, seperti yang dijelaskan dalam bagian III buku ini.

Kedua, karena pengembangan teknologi baru, studi farmakoepidemiologi


mempunyai potensi untuk masalah yang relatif too large ukuran sampel. Hal ini
lebih penting dari biasanya, karena itu, ketika menafsirkan hasil penelitian yang
menggunakan sistem data ini untuk memeriksa hasil penemuan mereka, dapat
membedakan dengan jelas antara signifikasi statistik dan signifikansi klinis.
Dengan ukuran sampel yang sangat besar, salah-satunya dapat menemukan
perbedaan signifikansi statistik dengan kinik. Selain itu, harus di ingat bahwa
penemuan halus, bahkan jika statistik dan klinis itu penting, bisa dengan mudah
menghasilkan bias atau pembaur (lihat bab 2). Penemuan halus tidak boleh
diabaikan, tetapi harus ditafsirkan dengan hati-hati.

Pendahuluan

Farmakologi klinis terdiri dari semua aspek ilmiah Penelitian obat obat pada
manusia. Tujuan secara keseluruhan adalah untuk memberikan pengetahuan
dasar yang dibutuhkan untuk memastikan rasional terapi obat.Selain
mempelajari efek biologis obat, studi farmakologi klinis meliputi
nonfarmakologis (Misalnya, ekonomi dan sosial) penentu dan efek dari
penggunaan obat-obatan. Perkembangan farmakologi klinis berawal sejakapa
yang disebut "ledakan obat" yang terjadi antara tahun 1930-an dan 1960-an,
yang ditandai dengan diucapkannya tingkat ekskalasi di mana obat baru
memasuki pasar berkembang ekonominegara. Dengan ekspansi pengobatan
terapeutik yang datang dengan cepat kebutuhan untuk lebih banyak informasi
mengenai efek dan penggunaan optimal dari agen ini, yang memacu
pertumbuhan farmakologi klinis sebagai disiplin ilmu.
Beberapa akan mendefinisikan tambahan disiplin terkait, farmakoterapeutik,
yang merupakan aplikasi dari prinsip-prinsipfarmakologi klinis untuk resep
rasional,pelaksanaan uji klinis, dan penilaian hasil selama praktek klinis
kehidupan nyata.

Farmakologi klinis mencoba untuk menjelaskan respon terhadap obat pada


individu, sementara farmakoepidemiologi yang bersangkutandengan mengukur
dan menjelaskan variabilitas dalam hasil pengobatan obat pada populasi.
Namun, ada tumpang tindih besar di dua lingkup disiplin ilmu ini dan banyak
farmasi klinisyang sangat terlibat dalam penelitian farmakoepidemiologi.
Farmakoepidemiologi adalah penerapan metode epidemiologi untuk subyek
klinisilmu farmasi. Tentu saja, pendekatan tidak akan dibenarkan jika respon
terhadap obat yang benar-benar dapat diprediksi. Dari perspektif ini , asal-usul
farmakoepidemiologi dapatterlihat jelas dalam disiplin farmakologi klinis
danfarmakoterapi.

Dalam studi epidemiologi keterpaparan non-obat, itu sering diasumsikan bahwa


jumlah dan lamanya paparan sebanding dengan risiko hasilnya. Misalnya, risiko
stroke atau serangan jantung sering dianggap peningkatan proporsi keduanya
dengan tingkat faktor risiko, seperti tekanan darah tinggi atau kolesterol darah,
dan lamanya waktu faktor risiko yang telah ada.Juga, durasi paparan karsinogen
(misalnya, asap rokok) kadang-kadang diasumsikan berhubungan linier dengan
tingkat risiko. Pada kesempatan tersebut, asumsi proporsionalitas ini terus benar
dalam pharmacoepidemiology. Misalnya, risiko meningkatnya kanker
endometrium dalam proporsi langsung ke durasi paparan estrogen. Dalam
situasi lain, asumsi proporsionalitas tidak valid, seperti halnya dengan ruam,
reaksi hati, dan reaksi hematologi untuk obat-obatan, yang sering terjadi dalam
beberapa minggu pertama pengobatan, risiko menurun setelahnya. Ini tampak
berkurangnya risiko mungkin artefak dari fenomena epidemiologi dikenal
sebagai "penipisan susceptibles" jangka panjang (di mana pengguna dari kelas
obat cenderung mereka yang toleran terhadap efek obat), dan / atau mereka
mungkin karena sejumlah faktor biologis yang unik untuk cara di mana obat
mendapatkan tanggapan, ditangani oleh tubuh, dan digunakan dalam praktek
klinis.

Paparan obat tidak pernah benar-benar kejadian acak, sebagai individu yang
menerima obat hampir selalu berbeda dari mereka tidak menerima hal itu.
Keadaan yang menyebabkan pasien menerima obat tertentu dalam dosis
tertentu, di waktu tertentu, yang kompleks dan berhubungan dengan perawatan
kesehatan pasien perilaku dan penggunaan layanan, tingkat keparahan dan sifat
kondisi sedang dirawat, dan keuntungan yang dirasakan dari obat dalam
pengaturan yang spesifik. Untuk berbagai kondisi, dokter mengubah atau
lakukan titrasi dosis obat terhadap respon, dan akan cenderung beralih obat
dalam kasus non-respon.Akibatnya, pilihan obat dan dosis dapat ditentukan oleh
faktor-faktor yang terkait diri mereka dengan hasil dalam studi. Dengan kata
lain, hubungan antara obat dan hasil bisa jadi dapat dikacaukan oleh indikasi
untuk obat atau fitur terkait lainnya (lihat juga Bab 40). Karena probabilitas
tinggi mengacaukan hal di luar itu yang dapat dikontrol untuk menggunakan
variabel terukur (yaitu, sisa yang membingungkan) , farmakoepidemiologi
cenderung berhati-hati tentang penafsiran lemahantara hubungan paparan obat
dan hasil.

Ketika menafsirkan studi farmakoepidemiologi, adalah penting untuk


menyadari bahwa ada hubungan antara respon obat dan faktor berbagai biologis
dan sosiologis, dan mencoba untuk mencari alasan bagi mereka. Disiplin
farmakologi klinis telah memberikan kita penjelasan untuk beberapa variasi ini
dalam menanggapi obat pentingdan pengetahuan ini diperlukan ketika
melakukan dan menafsirkan studi farmakoepidemiologi.
Bab ini dimaksudkan untuk memperkenalkan pembaca untuk beberapa konsep
inti dari farmakologi klinis. Jelas, satu bab buku tidak dapat menyampaikan
seluruh disiplin ilmu; banyak topik umum dan khusus pada buku pelajaran
farmakologi klinis yang ada hal ini. Penekanan bab ini akan pada konsep yang
mungkin penting dalam melakukan dan pemahaman penelitian
farmakoepidemiologi. Secara khusus, salah satu area paling penting dari studi
dalamfarmakologi klinis yang secara inheren setuju dengan penggunaan metode
epidemiologi adalah variabilitas respon obat yang ada di seluruh populasi.
Bagian berikut menyajikan beberapa konsep sentral farmakologi klinis yang
penting untuk farmakoepidemiologi yang mencoba untuk memahami perbedaan
dalam populasi berkenaan dengan efek obat. Secara khusus, bab ini akan
mendiskusikan sifat obat, mekanisme kerja obat, konsep potensi obat, peran
farmakodinamik dan farmakokinetik (termasuk faktor genetik yang
mempengaruhi fungsi-fungsi ini), dan pentingnya perilaku manusia dalam
menjelaskan variabilitas dalam efek obat.
THE NATURE OF DRUGS

Sebuah obat dapat didefinisikan sebagai setiap zat eksogenyang memberikan


efek fisiologis. Diambil sebagai sebuah kelompok, obat sangat bervariasi
berkaitan dengan struktur molekul mereka. Misalnya, interferon alfa-2a adalah
glikoprotein rumit, sedangkan kalium klorida adalah garam sederhana yang
berisi hanya dua unsur. Kebanyakan obat menengah dalam kompleksitasnya,
dan menghasilkan respon farmakologis mereka dengan mengerahkan bahan
kimia atau pengaruh molekul pada satu atau lebih konstituen sel.

Biasanya, komponen obat aktif dari tablet, kapsul, atau bentuk sediaan farmasi
lainnya presentasenya hanya kecil dari total massa dan volume sediaan. sisanya
adalah terdiri dari bahan tambahan (seperti binder, pengencer, pelumas,
pengawet, pewarna, dan kadang-kadang penyedap) yang dipilih, antara masalah
lain, karena mereka diyakini menjadi suatu obat yang inert. Hal ini relevan
dengan farmakoepidemiologi karena produk obat tiruan bahan aktif kadang-
kadang dapat menghasilkan efek dari mereka sendiri. Misalnya, benzil alkohol,
yang umumnya digunakan sebagai pengawet dalam pelarut injeksi, telah terlibat
sebagai penyebab sindrom beracun yang mengakibatkan dalam kematian
sejumlah bayi.

Juga potensi perhatian untuk farmakoepidemiologiyang faktanya bahwa, dari


waktu ke waktu, produk farmasi dapat diformulasikan untuk mengandung
eksipien yang berbeda.Selanjutnya, karena nilai pemasaran obat paten
ditetapkan nama produk, produk non-resep kadang-kadang dirumuskan
mengandung bahan aktif yang berbeda, dan kemudian terus dipasarkan di
bawah nama merek aslinya. Ini berpotensi menjadi perhatian setiap peneliti
farmakoepidemiologi yang tertarik dalam mempelajari efek obat non-resep. Hal
ini juga berpotensi menjadi sumber kesalahan pengobatan (lihat juga Bab 34).

MEKANISME TINDAKAN OBAT

Farmakologi mencoba untuk menggolongkan tindakan obat pada berbagai


tingkat studi , seperti dalam organisme , organ, jaringan , sel , sel komponen ,
dan tingkat molekul. Pada tingkat makromolekul, banyak obat mendapatkan
respon dengan protein khusus seperti enzim dan sel reseptor. Sementara
sekarang molekul obat berada dalam cairan tubuh secara bebas, penduduk asli
dalam tubuh, atau terikat dengan protein atau konstituen lainnya , tipe bebas
atau tidak terikat yang tersedia berinteraksi dengan target protein, dan demikian
itu penting dalam memunculkan sebuah respons.

Enzim merupakan protein katalisis, atau molekul yang membantu terjadinya


reaksi biokimia menjadi lebih cepat. Dengan langsung menghambat enzim, obat
memblokir pembentukan produk. Seperti halnya, angiotensin enzim
menghambat dan memblok terjaidinya perubahan angiotensin 1 untuk
membentuk senyawa aktif menjadi angiotensin 2, mengakibatkan penurunan
arteriolar perlawanan yang bermanfaat pada perorangan dengan mengidap
hipertensi atau gagal jantung kongestif. Obat lainnya memblok ion channels,
dan konsekuensi mengubah fungsi.sebagaia contoh, calcium channel memblok
obat mengurangi ion kalsium dalam sel otot halus, dengan cara demikian
menghambat terjadinya kontraksi pada otot halus,memperluas pembuluh darah,
dan mengurangi resisten pada arteriol

Jalan lain, obat berinteraksi dengan reseptor khusus dalam permukaan sel, yang
bergerak dalam system intraseluler , Akhirnya yang dihasilkan dalam perubahan
intraselular milieu. Sebagai contoh , obat yang mengikat untuk mengaktifkan
dan β2-adrenoceptors (β2-agonists) di pernafasan paru-paru intraseluler
meningkatkan konsentrasi siklik adenosina monophos-phate dan mendorong
protein kinase , menghasilkan relaksasi otot halus dan bronchodilasi. Banyak
obat yang bertindak melalui interaksi dengan g-protein-coupled sel reseptor
pada permukaan. Ini adalah protein reseptor khusus lapisan ganda lipid dalam
membran sel dan disiarkan ke dalam sel obat yang ada di luar . Obat lain ,
seperti purin dan pirimidina lawan yang digunakan dalam kanker kemoterapi ,
dan nukleosida analogues yang digunakan dalam pengobatan infeksi virus hiv
dan lainnya mengerahkan efek mereka dengan memblokir sel

POTENSI OBAT

Dalam hal penggunaan pharmacologi, istilah potensi mengacu pada jumlah obat
yang diperlukan untuk memperoleh respon yang diberikan, dan penting ketika
seseorang membandingkan dua atau lebih obat yang efek hampir mirip.
Misalnya , 10 mg morfin telah kurang lebih sama analgesik 1.3 mg hydro-
morphone ketika kedua obat yang diatur oleh injeksi . Demikian, kita
mengatakan bahwa kurang lebih 10 mg morphine “equipotent” to 1.3 mg
hydromorphone, dan hydromorphone kurang lebih 7.7 waktu adalah waktu yg
manjur (10/1.3= 7.7). Disamping itu, adanya kecenderungan untuk
menyamakan potensi dengan “effectiveness”, Menghasilkan kesalahpahaman
karena salah satu obat lebih kuat dibandingkan dengan alternatif , oleh karena
itu lebih efektif. Pandangan ini keliru. Sebagai komponen obat aktif biasanya
hanya melingkupi sebagian kecil dari dosis farmasi bentuk, jumlah obat yang
nyaman disampaikan ke para pasien adalah jenis obat yang jarang bermasalah.
Jika diperlukan, bisa langsung metingkatkan dosis.Potensi miligram jarang
diperhatikan dalam terapi penggunaan obat, sementara maksimal kemanjuran (
yang dapat mengerahkan menunjukkan maksimum obat efek) adalah yang jauh
lebih penting.
Di sisi lain , mempelajari potensi obat mungkin penting dalam menafsirkan
pharmacoepidemiology. Misalnya, jika obat tertentu tercatat untuk memiliki
tingkat yang lebih tinggi efek samping dari obat lain dari kelas yang sama,
Penting untuk menyelidiki apakah hal ini disebabkan dari sebuah intrinsik efek
obat itu, atau jika obat sedang digunakan dalam kegiatan klinis penggunaan
pada dosis yang lebih tinggi, Dibandingkan dengan potensi mereka , dari obat
lain dari kelas yang sama . Sebagai contoh , hal ini dapat menjelaskan beberapa
perbedaan yang jelas dalam risiko serius dari pencernaan komplikasi dengan
masing masing anti-inflammatory non steroid drugs.

FARMAKODINAMIK DAN FARMAKOKINETIK

Klinis farmakologi dapat dibagi dalam farmakodinamik dan farmakokinetik.


Pharmacodynamics quantifies respon dari target jaringan dalam tubuh untuk
konsentrasi yang diberikan obat . Pharmacokinetics adalah studi tentang proses
penyerapan obat, distribusi, dan ekskresi dari tubuh. Sementara farmakokinetik
memperhatikan aksi obat dalam tubuh. Efek gabungan ini proses menentukan
waktu kursus konsentrasi dari obat di target dan konsekuensi dari kehadiran
obat pada saat konsentrasi. Peran masing-masing berkontribusi pada kondisi
variabilitas efek obat di antara jumlah penduduk semakin dibahas pada
gilirannya

. PERAN FARMAKODINAMIK DALAM PENENTUAN VARIABILITAS


RESPON OBAT

Dibandingkan dengan sebagian besar eksposur (paparan) berasal dari non-drug


(bukan obat), denganadanya pengetahuanyang cukup tentang efek obat pada
saat dipasarkan. Hal ini harus dimasukkan ke dalam desain studi barudalam
mencari untuk mendapatkan informasi lebih lanjut tentang aksi dari suatu obat.
Hal ini berlaku apakah desain studi baru adalah eksperimental atau non-
eksperimental. Selanjutnya, ada informasi yang cukup tentang faktor-faktor
penentu respon pasien terhadap obat pada umumnya. Pada bagian ini, kami
menyajikan efek genetika, Respon adaptif, usia, keadaan penyakit, dan obat-
obatan yang digunakan secara bersamaan dalam menentukan variabilitas respon
obat.

FAKTOR GENETIK MANUSIA

RESPONS TERHADAP OBAT

Ini adalah daerah yang paling cepat berkembang dari penelitian farmakologi
klinis (lihat juga Bab 37). Ilmu genomik membantu kita memahami (dan
mungkin memprediksi) yang akan merespon (atau tidak) untuk obat yang akan
mengalami toksisitas yang serius pada dosis biasanya padaefekterapeutik.
Penyelidikan dalam penentu genetik telah dipusatkan pada tiga bidang utama:
8
aksi obat, transporter obat, dan metabolisme obat. Yang terakhir dua topik
yang kemudian dibahas dalam bagian farmakokinetik. polimorfisme nukleosida
tunggal dalam gen adalah kode untuk reseptor obat yang dapat mengakibatkan
variabilitas respon terhadap obat tertentu. polimorfisme genetik berbeda dalam
urutan DNA terjadi dengan frekuensi 1% atau lebih, yang dapat menyebabkan
pembentukan protein yang tidak berfungsi dengan baik.Misalnya, poli-
morphism dari adrenoseptor β2 menyebabkan kurangnya respon terhadap
bronkodilator, dan variasi genetik dalam reseptor 5HT2a untuk ketahanan
terhadap agen anti-psikotik clozapine.9 Polimorfisme gen yang berbeda yang
mempengaruhi platelet dan fungsi sel endotel dapat dikaitkan dengan
peningkatan risiko trombosis, dan resistensi relatif terhadap efek anti-trombotik
dari aspirindengan dosis rendah.10

Hal inidapatdimengertibahwapolimorfisme gen memilikiperanpotensial


yangpentingdalammenjelaskanvariasiberbagaiobatyang
memilikiefekmenguntungkandanmerugikan. Farmakoepidemiologi,historis,
memperkirakanrata-rata efekobatpadapopulasidantrentelahmendekatiefisien,
terutamamelaluieksploitasi data yang disimpandalamcatatanmediselektronikdan
database administratif (lihat Bab 13-22), yang
dapatdihubungkanuntukmempelajarihubunganantarapaparandanhasil.Sebagaiil
mu pharmacogenomics, adakebutuhan yang
berkembanguntukmenggabungkansamplingbiologis,
baikmelaluitinjauandesainstudi ad hoc yang lebihefisien,
ataumelaluicatatanmedisatauadministratifdari sample biologis.
Desaininiakanmengangkatisu-isuetika yang
signifikandaristudifarmakoepidemiologitradisional (lihatjuga Bab 38).

EFEK responsadaptif

Iniadalahaturanumumfarmakologibahwaresponfarmakodinamikseringdiikutiden
ganresponadaptif, secarakasar, adalahupayatubuhuntuk "mengatasi" atau
"melawan" efek obat. Contohnyaadalahpeningkatankonsentrasienzim yang
terikatmembran Na+ / K+ ATPase yang
terjadiselamapengobatanlanjutandenganglikosidajantungseperti
digoxin.SepertiglikosidajantungmengerahkanefekmerekadenganmenghambatNa
+
/ K+ATPase, peningkatankonsentrasilokal, atauupregulasi, enzimini yang
terjadiselamaterapimungkinbertanggungjawabuntukefekinotropikdariobat yang
terlihatpadabeberapaindividu.
Adrenoreseptor permukaan sel cenderung cenderung meningkat selama
pemberian agen bloking β-adrenergik seperti propanolol, mengakibatkan
peningkatan jumlah reseptor β aktif. Jika obat beta bloking ditarik cepat dari
pasien, sejumlah besar reseptor β menjadi berhasil mengikat norepinefrin dan
epinefrine yang merupakan ligan natural. Hal ini dapat menyebabkan takikardia,
hipertensi, angina yang biasa disebut “beta bloker withdrawal syndrom”

Dalam beberapa kasus., mekanisme respon adaptif belum sepenuhnya


dieksplorasi. Misalnya, diantara subyek menambil obat anti anti inflamasi
(NSAID), studi endoskopi telah mendokumentasikan kerangka mukosa
gastrointestnial. Kerusakan mukosa telah direkomendasikan bawa beberapa hari
terhitung penyelidikan dan terapi endoskopi. Dalam beberapa kasus, mekanisme
respon adaptif jelas belum sepenuhnya dieksplorasi. Misalnya, di antara subyek
mengambil obat anti-inflammatory drugs (NSAID), studi endoskopi telah
mendokumentasikan kerusakan mukosa gas-trointestinal dalam beberapa hari
terhitung pepemeriksaan Endoskopi . Pasien kronis akibat aspirin menemukan
bahwa kerusakan mukosa muncul dan dapat diselesaikan dari waktu ke waktu.
Sementara ini menunjukkan bahwa paparan lanjutan mempromosikan adaptasi
lambung, mekanisme yang ini mungkin terjadi tidak jelas. Studi
Pharmacoepidemiology ulserasi lambung dan komplikasinya perdarahan, per-
foration, dan stenosis yang sesuai dengan efek samping, menunjukkan bahwa
risiko komplikasi gastrointestinal

Pada minggu-minggu awal pengobatan NSAID, dan menolak ada yang


menjaga. Namun, bukti yang terbaru telah mempertanyakan kesimpulan ini.
Dalam sebuah penelitian linkage catatan, MacDonald et al. menemukan bahwa
risiko meningkat dari admission ke rumah sakit dengan komplikasi
gastrointestinal terkait dengan penggunaan NSAID yang konstan selama
paparan terus-menerus dan bahwa kelebihan risiko muncul untuk bertahan
selama setidaknya satu tahun setelah exposure. terakhir Jadi studi
eksperimental dan observasional adaptasi yang agak bertentangan dalam temuan
mereka, yang menggambarkan bahwa tidak selalu mungkin untuk
mengkorelasikan pemahaman biologis kita dengan pengamatan epidemiologi;
kadang-kadang yang terakhir dapat menginformasikan mantan, pembalikan dari
pandangan umum dari proses penemuan

9
Pada kasus NSAID, bidang studi cenderung pada pengenalan kontroversial
obat COX-2 inhibitor (misalnya, rofecoxib), yang memiliki risiko lebih rendah
menyebabkan komplikasi gastrointestinal serius daripada NSAID non-selektif,
tetapi meningkatkan risiko oklusi vaskular.

PENGARUH UMUR

Secara keseluruhan, pengaruh usia pada respon farmakodinamik kurang


dipelajari dari efeknya pada farmakokinetika. Hal ini khususnya terjadi pada
usia yang sangat muda, yang jarang disertakan dalam studi eksperimental untuk
menyelidiki efek klinis obat. Meskipun mungkin tampak berlawanan, orang tua
sering sama atau bahkan kurang sensitif terhadap efek farmakologis utama dari
beberapa obat daripada usia muda. Tapi, secara keseluruhan lansia berperilaku
seolah-olah mereka memiliki "berkurangnya cadangan fungsional" dan respon
homeostasis sekunder mungkin terganggu. Beberapa contoh dari efek usia
tua/lansia pada respon farmakodinamik dapat ditemukan pada terapi
kardiovaskular:

• Telah lama diketahui bahwa pasien lansia yang relatif tahan terhadap efek dari
kedua isoproterenol obat β-agonis dan obat β-blocker, propranolol.18 Sejauh
mana hal ini disebabkan oleh peningkatan kadar katekolamin plasma dan
perubahan jumlah β-reseptor tidak jelas.

• karya eksperimental Elegant telah menunjukkan bahwa pasien lansia memiliki


respon primer electrophysio-logika tumpul ke saluran kalsium memblokir obat
verapamil.19 Tingkat perpanjangan interval PR elektrokardiografi dalam
menanggapi konsentrasi tertentu verapamil kurang jelas pada usia lanjut
19
dibandingkan pasien usia muda. Namun, berbeda dengan efeknya pada
interval P-R, verapamil menghasilkan penurunan lebih besar dalam tekanan
darah pada orang tua daripada yang dilakukannya dalam mata pelajaran yang
lebih muda.

Bagaimana mungkin dua pengamatan terakhir dirujukkan? Kemungkinan


jawabannya adalah bahwa kedua tanggapan fisiologis adaptif sekunder dan
respon farmasi-cologic utama terganggu. Pemeliharaan tekanan darah
tergantung pada aktivasi sistem saraf simpatik, yang cenderung kurang
responsif dalam elderly. 18It kemungkinan bahwa penurunan nilai sekunder
(adaptif) respon, daripada peningkatan kepekaan terhadap tindakan
farmakologis primer per se, account untuk peningkatan kerentanan efek
samping dari banyak obat.

Peraturan homeostatis (kontrol tubuh dari lingkungan internal) sering terganggu


pada orang tua dan dapat berkontribusi untuk terjadinya efek samping serta
peningkatan sensitivitas terhadap efek obat. Misalnya, orang yang lebih tua
memiliki gangguan kemampuan untuk ekskresi, mungkin sebagai akibat dari
ginjal produksi pro-taglandin rendah. Ini dapat diperburuk oleh perawatan yang
kurang baik ekskresi, seperti diuretik, atau produksi prostaglandin ginjal,
misalnya, NSAIDs. Dalam kedua kasus, ada risiko dari dilutional hiponatremia
atau volume overload.

hipotensi postural (penurunan mendadak tekanan darah yang terjadi dengan


berdiri atau duduk, terutama pada pasien pada obat antihipertensi) sering gejala-
ATIC pada orang tua; patogenesis mungkin termasuk penurunan respon
baroreseptor, aktivitas simpatis diubah dan responsif, gangguan arteriol dan
tanggapan vasomotor vena, dan perubahan regulasi volume.

Contoh Lain peran Negara terhadap penyakit pada variabilitas farmakodinamik


adalah kecenderungan NSAID yang dapat merusak fungsi ginjal pada individu
dalam kelompok tertentu. 23 Gagal jantung kongestif dan gagal hati keduanya
ditandai dengan tingkat sirkulasi yang tinggi pada vasokonstriktor hormon
norepinephrine, angiotensin II, dan hormon antidiuretik. Dalam menanggapi
kemunculan hormon ini, ginjal melepaskan prostaglandin untuk memodulasi
efek vasokonstriktor mereka dan dengan demikian membantu menjaga aliran
darah ginjal pada saat kondisi fisiologi sedang stres. Pada individu yang rentan,
penghambatan sintesis prostaglandin (misalnya, sebagai akibat dari pemberian
NSAID) dapat menyebabkan vasokonstriksi yang ditandai dengan pengurangan
secara cepat aliran darah dalam ginjal, dan penurunan konsekuen dalam tingkat
filtrasi glomerulus.

INTERAKSI OBAT-OBAT YANG TERJADI MELALUI MEKANISME


FARMAKODINAMIK
Meskipun banyak interaksi obat-obatan yang penting terjadi melalui mekanisme
farmakokinetik, sejumlah interaksi penting pada dasarnya adalah
farmakodinamik. Interaksi farmakodinamik timbul sebagai konsekuensi dari
obat yang bekerja pada reseptor yang sama, situs tindakan, atau sistem
fisiologis dan memiliki efek sinergis atau antagonis. Dalam meneliti variabilitas
yang ada dalam populasi berkaitan dengan efek obat, ada atau tidak adanya obat
bersamaan dapat memainkan peran yang sangat penting dan harus dianggap
sebagai potensi kausal atau variabel pengganggu dalam studi
pharmacoepidemiology.

Misalnya, individu dengan konsentrasi serum digoksin diberikan secara berlebih


untuk penderita keracunan digoksin jika mereka kehabisan elektrolit tertentu,
seperti magnesium dan kalium. Dengan demikian, pasien yang diberikan
bersamaan diuretik magnesium- / kalium-buangan seperti furosemide lebih
mungkin dibandingkan mereka yang tidak diberikankan aritmia, mengingat
konsentrasi serum digoksin yang sama

Namun, pembentukan di tempat pertama kavernosus cGMP ini disebabkan


pelepasan oksida nitrat dalam menanggapi rangsangan seksual. Pada pria
menggunakan obat nitrat bersamaan untuk penyakit jantung, ada risiko
penurunan drastis tekanan darah akibat potensiasi dengan sildenafil dari efek
hipotensi mereka, dimediasi oleh relaksasi otot polos pembuluh darah.
Meskipun penggunaan bersamaan merupakan kontraindikasi oleh produsen,
sejumlah kematian sildenafil terkait diduga telah karena kombinasi obat ini.

Studi farmakoepidemiologi(kasus-kontrol) telah menunjukkan hubungan antara


penggunaan jangka panjang (> 3 bulan) dari penekan tertentu mengenai nafsu
makan (phentermine ditambah fenfluramine atau dexfenfluramine, atau
dexfenfluramine sendiri) dan katup jantung abnormalities.

25
Penggunaan penekan nafsu makan amphetamine seperti, terutama fenflu-
Ramine dan dexfenfluramine, juga telah dikaitkan dengan hipertensi.

26
paru primer telah mendalilkan bahwa efek yang tidak diinginkan adalah
karena serotonin accu-formulasi sebagai konsekuensi dari kedua meningkatkan
pelepasan dan penghapusan serotonin berkurang. Serotonin adalah mediator
predom-inant vasokonstriksi paru yang disebabkan oleh menggabungkan
trombosit dan telah terbukti meningkatkan paru pembuluh darah proliferasi otot
polos. penggunaan jangka panjang dari fenfluramine dan dexfenfluramine dapat
menghasilkan kelebihan serotonin yang cukup untuk merusak pembuluh darah
di paru-paru. Serotonin kelebihan juga dianggap respon atas kerusakan jantung
sebagai temuan patologis di katup rusak yang menyerupai orang-orang dari
penyakit jantung karsinoid atau penyakit jantung yang terkait dengan toksisitas
ergotamine, yang keduanya sindrom berhubungan dengan serotonin.

Fenfluramine dan dexfenfluramine ditarik dari pasar di seluruh dunia pada


tahun 1997.Kesimpulannya, tanggapan adaptif, usia, keadaan penyakit, dan
obat-obatan masing-masing secara bersamaan dapat memiliki efek penting pada
respon farmakodinamik, dan dapat mengakibatkan heterogenitas mampu
dipertimbangan dalam respon terhadap obat, baik antara dan di dalam individu.
Tunjangan harus dibuat untuk ini ketika menginterpretasikan data
farmakoepidemiologi. Kami sekarang akan mempertimbangkan dampak dari
faktor-faktor penentu farmakokinetik variabilitas dalam respon obat.

PERAN FARMAKOKINETIKA DALAM PENENTUAN VARIABILITAS


DARI RESPON OBAT
Seperti disebutkan sebelumnya, farmakokinetik adalah ilmu yang
menggambarkan perjalanan waktu penyerapan, distribusi, dan eliminasi obat
dalam tubuh, proses yang pada gilirannya menentukan konsentrasi obat di situs
aktif. Dari perspektif penelitian, umumnya lebih mudah untuk mengukur
konsentrasi obat yang berubah dalam cairan tubuh daripada untuk
mengkarakterisasi respon farmakologis padakonsentrasinya. Akibatnya, literatur
tentang farmakokinetik banyak, dan dapat dikatakan bahwa farmakologi klinis
sebagai suatu disiplinsangat peduli dengan studinya. Namun, harus diakui
bahwa variasi dalam parameter farmakokinetikmerupakan penyebab penting
dari heterogenitas yang mengamati bahwa ada kaitandenganrespon pasien
terhadap obat. Pada bagian ini, kita meninjau proses penyerapan, distribusi, dan
eliminasi obat, dan kemudian mempertimbangkan pengaruh usia, genetik,
penyakit, dan obat-obatan secara bersamaan. Pertama, bagaimanapun, hal ini
berguna untuk menentukan beberapa parameter matematika dasar yang
digunakan dalam farmakokinetik.

PARAMETER MATEMATIS DASAR DIGUNAKAN PADA


FARMAKOKINETIK

Bagan 4.1. Kurvakonsentrasiwaktu plasma


darihipotesisobatsetelahpemberianpadapembuluhdarah.
Catatanpenurunancepatawalpadatingkatdarahmencerminkandistribusiobat,
konsekuensidarikelarutanlemak, dantingkat protein yang mengikat. Fasekurva
terminal konsentrasiwaktuadalah log-linier
danmencerminkaneliminasiobatdaribagian.
Inimungkindisebabkanolehklirensginjalataumetabolismehati. Dalamhalini,
faseeliminasi terminal sebandingdenganwaktuparuhsekitar 100 menit.
Bagan 4.1 menunjukkankonsentrasi serum
darihipotesisobatmengikutiinjeksipilbesarpadapembuluhdarahtunggal yang
direncanakanmelawanwaktu. Karenatingkatkemundurandarikonsentrasiobat
serum,sepertihalnyafenomenaalam yang lain, lebihseringmunculpadalog-linier,
sedangkanporosvertikal di rencanakanpadaskalalog-aritmik.
Telahditelitibahwapadabeberapaobat-obatan, porsiawalpada log-
konsentrasiversuskurvawaktuberselisihkhususnyadarigaris yang
ditentukanolehporisi terminal kurva. Denganalasantersebut,
konsepdarikompartemenfarmakokinetik di kembangkan.

Bagianfarmakokinetikadalahruangteori yang
secaramatematisditentukanpadamolekulobat-obatanuntukdidistribusikan,
danditunjukkandengankomponen linier yang diberikandari log-konsentrasi
versuskurvawaktu. Inibukanlahruanganatomidanfisiologissebenarnya,
tetapibiasanyadisebutsebagaisebuahjaringanataukelompokjaringan yang
memilikialirandarahdanafinitasobat yang sama. Karenateoridasardari model
matematikafarmakologklinistelahmencobauntukmenghubungkankurvawaktukon
sentrasi plasma lebihdekatdengan parameter
fisiologisseperticurahjantungdankoefisienpartisijaringan.
Penggabungandarivariabeltersebutkadang-
kadangmeningkatkankecermatandankemampuanprediksidari model kinetik.

Awalnya, kecepatanpenurunandarikonsentrasiobat yang terhitung (Bagan 4.1)


dihubungkanpadadistribusimolekulobatmelalui plasma
sampaipadajaringanperfusi yang baik. Hal
inibiasanyaditujukansebagaitahapdistribusi.
Setelahkonsentrasimolekulobattelahmeraihekuilibriummelewatibagianpenuruna
nlebihbertahapdalamkonsentrasi serum yang terlihatdibagiankanankurva yang
menunjukkanpengeluaranobatdaritubuh, danditujukansebagaitahapeliminasi
terminal.
FARMAKOPIDEMIOLOGI

Bagan4.2. Profilkonsentrasiobat plasma untukduahipotesisobatdiulangselama12


setiap jam darijadwalpemberiandosis. Kurva yang
lebihrendahberhubungandenganobatdanwaktuparuh 10 jam;
konsentrasikestabilandicapaisetelah 50-60 jam. Sebaliknya, kurva yang
tinggiberhubungandenganobatdanwaktuparuh 20 jam dankonsentrasi plasma
masihmeningkatdiakhirstudi.

Karenadosisobatsuntikandiketahuidankonsentrasiplaswaawalsegerasetelahpemb
erian (Cp, puncakkonsentrasi plasma) dapat di perhitungkandaripoin-poin yang
adapadakurva, parameter farmakokinetikdikenalsebagai volume distribusinyata,
atauVddapatdihitungdenganmembagidosis Cp. Vdditunjukkandalamsatuan
volume seperti liter danpada volume
dimanaobatdilarutkanuntukmemproduksikonsentrasipuncak yang nyata.
Hanyadenganbagianfarmakokinetik, distribusivolume
nyataadalahsebuahteoridaripadakenyataan, meskipun volume
mempunyaifisiologis yang sama. Misalnya, sebuahobat yang
sangatlarutdalamlemaksepertiantidepresantrisiklikmungkinmemiliki volume
distribusi yang jelasyaituratusan liter. Hal
inidikarenakansekatobatsangatmudahdalamjaringanlemak,meninggalkansedikit
obatyang terhitungdalamalirandarah.

Garis miring yang


menunjukkantahapelimunasidikenalsebagaidasareliminasikonstan, atauKe,
dandinyatakandengansatuanwaktutimbalbalik, seperti jam-1
.Karenalinearitasdarifaseeliminasi terminal padaalur semi-log, waktu yang
digunakanuntukkonsentrasiobat yang
diberikanuntukmenurunkansetengahdarikonsentrasiasliadalahkonstandandikenal
sebagaimasawaktuparuhobat. Masawaktuparuhdinyatakandalamsatuanwaktu,
seperti jam. Secaramatematis, parameter inidihitungdaridasareliminasikonstan
yang menggunakanrumusT1/2 0.693/Ke.

Parameter farmakokinetiktambahan, jarakruangan, atauCl,jugadapatditentukan.


Sekalilagi, iniadalah parameter teoritisdanmengacupada volume yang
sedangdihitungharusbenar-benardibersihkandariobat, per satuanwaktu,
terlepasdarimekanismejarakruang. Hal inidinyatakandalamsatuan volume per
satuanwaktu, seperti liter per jam.
Jarakruangandapatdihitungdenganmengambilprodukdaridistribusi volume yang
jelasdandasareliminasikonstan. Pentinguntukdicatatbahwakedua volume
distribusidantingkatjarakruanganbersamaandalammenentukaneliminasiwaktupar
uh(T1/2 (0.693 Vd)/Cl).

Ketikaobat di berikansesuaidengancaradosis yang stabil, konsentrasiobat plasma


secepatnyamencapaiekuilibriumdimanajumlahobat yang
diberikansebandingdenganjumlahobat yang dikeluarkanolehtubuh (Bagan 4.2).
Hal iniditujukanpadakestabilan. Jumlahwaktu yang
dierlukanuntukobatdalammencapaikestabilanbergantungpadatingkateliminasiob
atpadasetiap orang.
Tujuandaripemantauanobatterapeutikyaitumencapai>95%darikonsentrasistabildi
tentukansecaraumumuntukmemperkirakankonsentrasistabil yang benar. Hal
inidapatdiselesaikandenganmengambilsampelbiologissetelahkira-
kiralimawaktuparuhobat.Jumlahobat yang
diberikanmempengaruhibesarnyakonsentrasiobat yang stabil,
tapibukanjumlahwaktu yang dibutuhkanuntukmencapaikestabilan.
Dalamkeadaanini, hasilwaktuparuhlebih lama untukmencapaikonsentrasi yang
stabildancenderungmenumpuk. Hal
inidapatmenyebabkankeracunanketikaobatwaktuparuhpanjangdimulaidirumahsa
kitdanpengaturan yang
sesuaitidakdibuatuntukmenindaklanjutidanmengawasikonsentrasiobatatauefek.

PENGARUH VARIASI PENYERAPAN OBAT

Dalam praktek klinis, sebagian besar obat diberikan melalui mulut. Karena
sebagian besar molekul obat kecil dan setidaknya sebagian larut dalam lemak,
mereka diserap oleh difusi pasif di seluruh area permukaan dari mukosa yang
melapisi usus kecil. Tingkat absorpsi ditentukan terutama oleh sifat fisikokimia
obat dan integritas usus kecil, sedangkan tingkat penyerapan tergantung pada
waktu pengosongan lambung dan motilitas dari usus kecil. Yang kedua
bertambahnya usia dan adanya kondisi penyakit yang kadang-kadang
mempengaruhi tingkat penyerapan gastrointestinal obat yaitu jika mereka
memiliki efek yang baik akan cenderung mengurangi penyerapan. penyerapan
juga dapat berkurang hasil dari mengosumsi obat dengan chelating agent.
Misalnya, anion mengikatkan resin cholestyramine (digunakan untuk mengikat
asam empedu dan menurunkan kadar kolesterol darah) yang mampu mengikat
berbagai obat, termasuk statin (misalnya, fluvastatin, simvastatin), yang
mungkin dapat dicerna oleh pasien hiperkolesterolemia

Kadang, variasi dalam penyerapan dapat meningkatkan tingkat ketersediaan


sistemik obat dan menyebabkan efek yang merugikan. Hal ini biasanya
disebabkan oleh perubahan bioavailabilitas yang mengikuti perubahan
formulasi. Contoh ini terlihat di Australia yang melibatkan kalsium nifedipine
Antag-onist, yang tersedia baik sebagai tablet rilis berkelanjutan dan sebagai
kapsul rilis cepat. Individu yang melakukan secara tidak sengaja dari bekas
dengan dosis yang sama sesekali mengalami dari kedua hipotensi, mungkin
karena penyerapan yang cepat mengarah ke konsentrasi puncak peningkatan
obat, dengan vasodilatasi berikutnya

Penyerapan obat tidak terbatas pada saluran pencernaan. penyerapan sistemik


obat dapat terjadi setelah penyerapan yang tidak diinginkan melalui rute lain,
seperti transdermal, setelah pemberian oleh inhaler dosis terukur, atau secara
bertahap pada mata. Setiap obat ini dapat menyebabkan efek samping.
Kemampuan senyawa larut lipid yang diserap dalam kulit utuh telah digunakan
dalam desain sistem pengiriman transdermal untuk beberapa obat, termasuk
estradiol, nitrogliserin, nikotin, dan skopolamin.

Transdermal penyerapan obat dapat menghasilkan efek samping yang


bermanfaat, seperti yang digambarkan oleh toksisitas heksaklorofen yang terjadi
pada neonatus mengikuti campuran antiseptik ini dengan jumlah bedak
berlebihan, dan dalam hal lain, contaminasi bedak dengan antikoagulan
warfarin. Neonatus sangat rentan terhadap efek dari paparan obat transdermal
karena kulit mereka memberikan penghalang tidak cukup untuk penyerapan
sistemik, dan karena mereka memiliki area permukaan besar dalam proporsi
berat badan. Dalam cara yang sama, jumlah kortikosteroid yang cukup untuk
menghasilkan efek sistemik dapat tertelan setelah pemberian inhaler dengan
dosis terukur. obat beta-blocking ditanamkan ke dalam mata dapat melakukan
perjalanan menyusuri saluran nasolachrymal ditelan dan diserap, merangsang
bronkospasme pada individu yang rentan eksaserbasi gagal jantung kongestif

Singkatnya, karena variabilitas dalam penyerapan bentuk sediaan oral obat dari
saluran pencernaan biasanya mengurangi penyerapan itu lebih penting sebagai
penyebab kurangnya kemanjuran dari peningkatan efek samping. Namun,
penyerapan sistemik yang tidak diinginkan dapat terjadi melalui berbagai rute,
dan dapat memiliki konsekuensi penting.

PENGARUH VARIASI SISTOLIK


Distribusi obat

Sebagai molekul obat yang diserap, didistribusikan ke berbagai jaringan pada


tingkat dan ke tingkat yang ditentukan oleh: (1) kelarutan lipid obat, (2) tingkat
protein yang mengikat obat, dan (3) jumlah aliran darah yang diterima oleh
jaringan yang berbeda. tingkat kelarutan lemak memberikan kemampuan untuk
bergerak mudah melintasi membran sel dan menumpuk di lingkungan lipid, dan
karena itu menghasilkan proporsi yang lebih tinggi dari molekul obat
didistribusikan ke jaringan lemak. Ekstensif mengikat protein plasma akan
mengurangi pergerakan molekul obat dari kompartemen sentral, dan dengan
demikian mengurangi volume distribusi obat yang jelas. jaringan perfusi yang
baik akan cenderung menerima jumlah yang lebih besar dari obat dari jaringan
yang perfusi buruk.

Pengikat protein merupakan aspek distribusi obat yang menerima perhatian


mungkin lebih dari layak. efek buruk dari obat yang sering dikaitkan dengan
mengikat protein berubah, yang dapat terjadi pada kondisi penyakit tertentu,
kehamilan, atau ketika obat yang sangat terikat protein lainnya yang diambil
secara bersamaan. Namun, ada relatif sedikit kesempatan ketika gangguan
penyakit yang disebabkan pengikat protein atau protein yang mengikat interaksi
obat-obat telah terbukti memiliki efek klinis yang penting. Alasan utama untuk
ini adalah bahwa, sementara itu adalah fraksi bebas dari obat yang berinteraksi
dengan protein untuk menghasilkan efek farmakologis, juga fraksi gratis yang
tersedia untuk mekanisme clearance. Oleh karena itu, setiap peningkatan
konsentrasi obat bebas yang disebabkan oleh salah satu tingkat albumin
berkurang atau dengan perpindahan dengan obat lain juga disertai dengan
peningkatan cukai, sehingga bebas, konsentrasi aktif akhirnya berubah sedikit.
Periode waktu yang mungkin ada peningkatan penting dalam konsentrasi bebas
terbatas sekitar tiga setengah hidup setelah onset interaksi. Ada situasi sesekali
di mana aturan umum ini mungkin tidak berlaku, terutama di mana perubahan
kecil dalam konsentrasi memiliki efek yang besar, atau di mana obat memiliki
mekanisme pembersihan sendiri yang memiliki kapasitas yang terbatas, dan
karena itu dapat menjadi jenuh

Penelitian telah menunjukkan bahwa tidak semua distribusi obat adalah pasif.
Ada keinginan yang tumbuh di fungsi obat "transporter." Transporter obat
adalah protein khusus yang memediasi penghabisan obat (yaitu, transportasi
keluar) dari sel dan jaringan. mediator yang paling banyak dipelajari adalah P-
glikoprotein, yang terletak di membran plasma, dan translocates substrat yang
dari dalam sel ke luar. keinginan protein ini muncul dari pengamatan bahwa
lebih dari ekspresi P-glikoprotein dalam sel kanker menyebabkan konsentrasi
intraseluler rendah obat antikanker dan ketahanan dari tumor terhadap
pengobatan. Penelitian selanjutnya telah mengungkapkan potensi yang lebih
luas untuk transporter ini untuk menjelaskan variasi dalam tindakan berbagai
senyawa, dengan mengurangi konsentrasi dalam berbagai jaringan, termasuk
sistem saraf pusat. Misalnya, hasil terbaru telah mendokumentasikan
polimorfisme ABCB1 gen transporter obat, yang kode untuk P-glikoprotein,
dan menyebabkan resistensi terhadap berbagai obat antikonvulsan

Kesimpulannya, perubahan distribusi obat sering dikutip sebagai alasan untuk


variabilitas dalam menanggapi obat-obatan dan, karena itu, dapat terlibat ketika
mencari penjelasan untuk temuan pharmacoepidemiologic. Perubahan penting
dalam fase pasif distribusi obat jarang menghasilkan efek klinis. Namun,
informasi baru tentang peran transporter obat menunjukkan bahwa variabilitas
dalam proses-proses yang aktif dapat menjelaskan kurangnya khasiat berbagai
macam obat

PENGARUH VARIASI OBAT

ELIMINASI
Obat diekskresikan dari tubuh berupa senyawa induk yang tidak berubah atau
berupa satu atau lebih hasil dari metabolisme obat. Meskipun sejumlah organ,
termasuk sistem bilier, paru-paru, dan kulit, berpengaruh dalam eliminasi obat,
ginjal mempunyai peran yang paling penting. Sebagian besar organ ekskretori
mengeluarkan senyawa larut air daripada senyawa larut lemak karena lebih
efisien. Akibatnya, obat yang larut air cenderung tidak berubah dan dieliminasi
dalam urin, sedangkan obat yang larut lemak cenderung mengalami
metabolisme sehingga dihasilkan produk yang lebih larut larut dalam air,
biasanya di metabolisme dalam hati, sebelum diekskresikan.

Pengaruh Variasi pada Eliminasi Ginjal

Hampir semua obat cukup kecil untuk disaring melalui glomeruli, unit
penyaringan ginjal dan tubulus ginjal. Tingkat filtrasi glomerulus bergantung
pada tekanan perfusi glomeruli dan karakteristik protein yang mengikat obat.
Hanya obat yang tidak terikat pada aliran darah siap untuk disaring, tingginya
derajat ikatan protein dan tingginya afinitas obat pada ikatan protein akan
membatasi jumlah obat yang mencapai tubulus ginjal. Sekali di dalam tubulus
ginjal, obat yang larut lemak dapat segera direabsorbsi ke dalam aliran darah,
melewati membran lipid dari sel-sel yang melapisi tubulus ginjal hingga hampir
tidak ada fraksi/zat untuk disaring lalu diekskresikan dalam urin. Karena proses
ini tidak melibatkan konsumsi energi sel, hal tersebut dikenal sebagai
reabsorpsi tubular pasif. Obat yang larut dalam air, seperti antibiotik
aminoglikosida dan digoxin, tidak melewati membran tubular dan langsung
diekskresikan melewati urin. Sekresi tubular aktif terjadi ketika zat disekresikan
ke tubulus ginjal dengan energi protein karier. Ini merupakan mekanisme
penting bagi pembersihan sejumlah obat, termasuk penisilin.

Untuk obat yang mudah terionisasi pada pH fisiologis, seperti salisilat, pH


menjadi penting dalam penentu ekskresi ginjal. Karena obat yang tidak
terionisasi (tidak bermuatan) merupakan obat lebih larut lemak, kemungkinan
besar mengalami reabsorpsi tubular pasif. Oleh karena itu, ekskresi ginjal
salisilat yang terionisasi pada pH tinggi (basa) dapat ditingkatkan oleh
alkalinisasi farmakologis urin. Hal ini dimanfaatkan ketika diuresis alkalin
digunakan untuk meningkatkan bersihan ginjal pada kasus keracunan salisilat.

Dari sudut pandang farmakoepidemiologi, pentingnya bersihan ginjal dapat


diperkirakan. Oleh karena itu, dapat diidentifikasi individu yang berisiko
keracunan melalui akumulasi obat yang larut dalam air. Ini jauh lebih sederhana
daripada memperkirakan fungsi hati (lihat di bawah).

Konsentrasi kreatinin plasma adalah ukuran dari fungsi ginjal yang sering
digunakan dalam praktek klinis. Ukuran ginjal membersihkan kreatinin dari
darah (klirens kreatinin) berkorelasi erat dengan laju filtrasi glomerulus.
Konsentrasi kreatinin pada setiap titik waktu adalah fungsi produksi dan
pembersihan yang keduanya cenderung menurun sesuai usia; bentuk karena
massa otot menurun, yang terakhir karena penurunan terkait usia dengan fungsi
glomeruli. Misalnya, jumlah kreatinin darah 0,1 mmoll -1 dalam wanita usia 80
tahun mencerminkan tingkat fungsi ginjal yang lebih rendah dari konsentrasi
kreatinin laki-laki usia 20 tahun (Gambar 4.3).

Pentingnya mempertimbangkan usia ketika menafsirkan konsentrasi kreatinin


plasma diilustrasikan pada Gambar 4.3. Jika dua hal yang disebutkan dalam
paragraf sebelumnya diperlukan pengobatan digoxin, dosis yang digunakan
untuk mencapai konsentrasi terapeutik pada seseorang yang lebih tua kurang
dari setengah dosis yang dibutuhkan oleh laki-laki muda. Mengingat bahwa
setiap individu ini memiliki konsentrasi kreatinin darah yang identik . Namun,
tidak bisa diajdikan parameter untuk menggambarkan fungsi ginjal.
Gambar 4.3. Perubahan dalam estimasi klirens kreatinin (Rumus Cockcroft dan
Gault35)pada usia laki-laki dan wanita yang mempertahankan kreatinin serum
0,1 mmol l-1 (NR 0.07- 0.12 mmol l-1)sepanjang hidup mereka. Dalam
memperkirakan kreatinin klirens, diasumsikan berat laki-laki 75 kg dan berat
wanita 60 kg. Gambar tersebut mengindikasikan kreatinin klirens menurun
secara linier dengan usia dan serum kreatinin. Karena filtrasi glomerulus yang
tidak bagus lagi sehingga akibatnya klirens dari beberapa obat terganggu pada
orang tua. Misalnya, perempuan pada umur 80 tahun (kreatinin klirens 45 ml
min-1) membutuhkan kurang dari setengah dosis digoxin yang dikonsumsi laki-
laki pada usia 20 tahun, walaupun memiliki tingkat kreatinin serum yang
identik.

Kesimpulannya, penting untuk memperhitungkan variasi dalam menentukan


fungsi ginjal ketika melakukan studi farmakoepidemiologi untuk obat dengan
prinsip rute eliminasi dari tubuh. Beberapa penelitian farmakoepidemiologi
mengenai laboratorium klinis, memungkinkan data perkiraan fungsi ginjal akan
dibuat dan dimasukkan dalam analisis hasil. Akibatnya, penting dalam
mengenali konsentrasi kreatinin plasma dan harus disesuaikan dengan usia dan
berat badan sebelum digunakan sebagai perkiraan fungsi ginjal. Sejumlah rumus
yang cocok telah publikasikan dan yang paling banyak digunakan adalah rumus
Cockcroft dan Gault.35

Interaksi Obat-obat Melibatkan Eliminasi Ginjal

Obat mampu mengganggu eliminasi zat lain di ginjal. Hal ini dapat memberikan
efek pada filtrasi, reabsorpsi tubular, atau sekresi tubular. Sebuah diskusi
menyeluruh di luar behasan ini, terdapat satu atau dua contoh yang
menggambarkan pentingnya jenis interaksi. Efek aliran darah ginjal dirusak
oleh golongan obat NSAID terjadi di beberapa aspek klinis. Akibatnya, NSAID
mampu menghambat eliminasi berbagai senyawa potensial beracun, termasuk
lithium dan methotrexate. Akumulasi zat ini dapat menghasilkan efek samping
yang serius.

Dalam kasus tekanan filtrasi diatur oleh angio-tensin II-dimediasi


vasokonstriksi dari post-glomerular arteri eferen, angiotensin converting
enzyme inhibitor (ACEI) atau antagonis reseptor angiotensin tiba-tiba dapat
menurunkan laju filtrasi glomerulus melalui penghambatan angiotensin sintesis
II. Hal ini dapat terjadi pada stenosis arteri ginjal, hipovolemia, dan gagal
jantung, sehingga meningkatkan efek atau toksisitas obat yang diberikan
bersamaan yang diekskresi melalui ginjal atau yang bersifat nefrotoksik.
Cyclosporine immunosuppressan menginduksi vasokonstriksi dari aferen
arteriole glomerular terkait dosis dan reversibel. Peningkatan risiko gagal ginjal
akut terjadi ketika cyclosporine dikombinasikan dengan NSAID, ACEI, atau
obat-obatan nefrotoksik lain.

Probenesid merupakan obat yang digunakan dalam pengobatan asam urat dapat
mengurangi reabsorpsi asam urat oleh tubulus ginjal dan menghambat sekresi
tubular aktif penisilin. Hal ini menjelaskan dua efek terapi probenesid yaitu
menurunkan konsentrasi asam urat dalam darah dan meningkatkan efek dari
dosis penisilin. Kedua mekanisme digunakan dalam praktek klinis.

PENGARUH VARIASI PADA METABOLISME OBAT

Variabilitas dalam metabolisme obat merupakan faktor penting yang harus


dipertimbangkan dalam analisis dan interpretasi studi farmakoepidemiologi.
Pada sesi ini, kita akan mempertimbangkan efek genetika, usia, keadaan
penyakit, dan obat-obatan secara bersamaan pada metabolisme obat.
Selanjutnya, kita akan membahas beberapa implikasi dari metabolit obat aktif
dan klirens intrinsik. Tapi pertama, gambaran dari metabolisme obat akan
dijelaskan berikut ini.

Sekilas Tentang Metabolisme Obat

Mayoritas obat yang sangat larut lemak secara efektif dieliminasi oleh ginjal.
Pertama, mereka harus diubah menjadi metabolit yang larut dalam air kemudian
dapat diekskresikan melalui urin, atau kadang-kadang melalui feces, melalui
empedu. Langkah pertama yang diperlukan untuk proses metabolisme adalah
hati. Reaksi kimia yang dibutuhkan dalam metabolisme obat diklasifikasikan
sebagai reaksi tahap I dan tahap II. Reaksi tahap I biasanya oksidatif (misalnya,
hidroksilasi) dan membuat sisi aktif pada molekul obat dapat bertindak sebagai
target untuk tahap II reaksi conjugative (sintetis). Reaksi fase II melibatkan
sintesis molekul baru dari kombinasi obat dan substrat yang larut dalam air
seperti glukuronat atau asam asetat (Gambar 4.4). Hasil reaksi berupa
glukuronida atau asetil turunan obat, sangat larut dalam air, dan diekskresikan
dalam urin, atau kadang-kadang dalam feses apabila berat molekul tinggi.
Kebanyakan obat yang menjalani metabolisme tahap I (oksidatif) diubah oleh
enzim superfamili yang disebut sitokrom P450 (CYP). P450 ini dinamakan
demikian karena dalam bentuk tertentu penyerapan cahaya maksimal terjadi
pada panjang gelombang 450 nanometer. Kebanyakan metabolisme obat tahap I
melibatkan sitokrom P450 1, 2, dan 3 (CYP1, CYP2, dan CYP3). Enzim
tertentu ada dalam famili CYP seperti enzim CYP2C9, CYP2C10, CYP2C18,
dan CYP2C19 bertanggung jawab penuh dalam metabolisme kelompok enzim
CYP2C. Obat yang berbeda dapat dimetabolisme oleh isoenzim yang berbeda, 5
atau karena spesifisitas substrat yang tidak lengkap, obat dapat dimetabolisme
oleh lebih dari satu enzim.

Beberapa obat mampu ikut dalam reaksi sintetik tanpa metabolisme tahap I
sebelumnya. Contohnya adalah benzodiazepine temazepam yang terkonjugasi
langsung dengan glukuronida, dan dieliminasi dalam bentuk urin. Sebaliknya,
diazepam, benzodiazepine, harus menjalani beberapa tahap I reaksi oksidatif
sebelum dapat terkonjugasi dan dieliminasi. Reaksi tahap I variasi intra dan
antar-individu lebih besar daripada reaksi tahap II. Hal ini menjelaskan
mengapa metabolisme diazepam sebagian besar dipengaruhi oleh usia dan
penyakit, sedangkan metabolisme temazepam relatif tidak terpengaruh oleh
faktor variasi ini.

Pengaruh Faktor Genetik pada Metabolisme Obat

Faktor genetik kadang-kadang penting dalam menentukan aktivitas enzim pada


metabolisme obat. Penelitian telah menunjukkan bahwa waktu paruh
fenilbutazon dan antikoagulan coumarin jauh lebih variabel dalam monozigotik
dibandingkan heterozygotik. Waktu paruh obat pada populasi secara
keseluruhan dipaparkan oleh Gaussian, meskipun batasnya sering lebar, dan
variasinya mencakup 5 sampai 10 kali lipat.38
Metabolisme anti-TBC pada obat isoniazid obat menunjukkan distribusi
bimodal dalam populasi. Konjugasi isoniazid dengan asam asetat merupakan
langkah penting dalam inaktivasi dan eliminasi. Variabilitas pada hasil asetilasi
isoniazid dari gen resesif tunggal yang distribusinya menunjukkan beberapa
ketergantungan ras (asetilasi polimorfisme). Misalnya, sekitar setengah (50-
60%) masyarakat Kaukasia adalah lambatnya acetylator, dan karena
kapasitasnya berkurang dalam eliminasi obat.38 Di Jepang, prevalensi lambatnya
asetilator fenotipe hanya 15% dan lambatnya asetilator belum teridentifikasi
pada populasi Eskimo. Meskipun telah dilakukan upaya untuk mengkorelasikan
asetilator fenotip dengan risiko hepatotoksisitas induksi isoniazid, laporan yang
diterbitkan samar-samar menunjukkan asosiasi inactivator lambat dengan
inactivator cepat. Laporan terbaru telah menekankan kemungkinan ada perana
jalur alternatif untuk metabolisme isoniazid. Pasien dengan genotipe CYP2E1
memiliki risiko lebih tinggi hepatotoksisitas dengan isoniazid setelah
penyesuaian status asetilator.39
Gambar 4.4.Reaksi tahap I dan II sering terjadi secara berurutan. Reaksi tahap I
biasanya terdiri dari oksidasi, reduksi, hidrolisis, dan produk selalu lebih reaktif,
dan kadang-kadang lebih beracun, daripada obat induk. Reaksi tahap II
melibatkan konjugasi dan biasanya menghasilkan senyawa aktif. Efek utama
konjugasi ini adalah untuk membuat substansi lebih larut dalam air. Misalnya
phenacetin dikonversi ke asetaminofen (parasetamol) oleh dealkilasi (Reaksi
tahap I). Hal ini memperkenalkan grup hidroksil yang reaktif terikat dengan
grup glukuronil. Phenasetin dan asetaminofen bersifat aktif, sedangkan
glukuronida asetaminofen tidak aktif dan larut dalam air lalu diekskresikan
melalui urin. (Gambar telah dicetak dengan izin dari Rang et al Farmakologi, 5
edn Edinburgh: Churchill Livingstone, 2003.)
Asetilasi polimorfisme mempengaruhi metabolisme sejumlah obat selain
isoniazid; ini termasuk beberapa sulfonamid (termasuk sulphsalazine),
hydralazine, procainamide, dapson, nitrazepam, dan kafein. Secara umum,
Implikasi di bidang klinis adalah karena acetylators lambat memerlukan dosis
yang lebih rendah untuk efek terapi yang baik dan meminimalkan toksisitas dan
efek samping.

40
Hidroksilasi polimorfisme diidentifikasi pada tahun 1977. Sejak itu telah
ditetapkan bahwa sekitar 10% dari Kaukasia dan 1% dari Asia defisiensi
pameran hidroksilasi sebagai akibat dari berkurangnya aktivitas enzim
CYP2D6. Pertama dijelaskan dalam kaitannya dengan debrisoquine, Defisiensi
juga mempengaruhi metabolisme antidepresan (amitryptyline, clomipramine,
desipramine, nortryptyline, mianserin, paroxetine), antiaritmia (flecanide,
propafenone), anti-psikotik (haloperidol, perphenazine, thioridazine), dan β-
blocker (alprenolol, metoprolol) menyebabkan akumulasi senyawa induk aktif.
Dalam kasus amitryptyline dan thioridazine, kedua orang tua dan metabolit aktif
menumpuk. hydroxylators rendah mungkin ditandai dengan meningkatnya efek
atau mempengaruhi durasi berkepanjangan aksi obat.

CYP2C19 polimorfisme digambarkan dalam 2-5% dari Kaukasia dan 12-23%


dari Asia yang memiliki kapasitas defisien untuk hydroxylate S-mephenytoin.
CYP2C19 juga mengkatalisis metabolisme obat yang biasa digunakan seperti
barbiturat, omeprazole, propranolol, diazepam dan citalopram. 41

Konsekuensi klinis dari polimorfisme genetik belum sepenuhnya dijelaskan,


tetapi kemungkinan bahwa seperti perbedaan ditentukan secara genetik dapat
menjelaskan dalam beberapa bagian untuk antarindividu dan antar-etnis
perbedaan respon terapi dan profil efek samping diamati dengan banyak obat.

CYP2D6 fenotip individu tertentu dapat ditentukan dengan menguji clearance


metabolik dari tes obat, seperti debrisoquine atau sparteine. Teknik ini dapat
berguna dalam melakukan studi pharmacoepidemiology. Misalnya, Wiholm
dkk. dibandingkan debrisoquine hidroksilasi dalam kelompok subjek yang telah
mengembangkan asidosis laktat ketika mengambil phenformin dengan distribusi
yang diharapkan pada populasi Swedia.42 Penelitian ini menggambarkan potensi
untuk menyelidiki kelompok individu yang menampilkan reaksi kelihatannya
aneh untuk obat-obatan tertentu. Contoh lain dari penggunaan teknik
laboratorium untuk menyelidiki terjadinya efek samping yang serius termasuk
setan-stration kemungkinan kecenderungan keluarga untuk halothane hepatitis
dan fenitoin diinduksi sindrom hipersensitivitas. 43

Polimorfisme genetik dari enzim obat metabolisme tidak hanya


memperhitungkan efek samping, itu juga dapat menyebabkan kurangnya
efektivitas. Misalnya, individu yang memiliki genotipe metabolisme ekstensif
CYP2C19 perlu dosis besar inhibitor pompa proton (misalnya, omeprazole)
untuk mengurangi sekresi asam lambung. Lambat metabolizer geno-jenis
CYP2D6 akan memiliki perubahan jelek dari kodein morfin dan akibatnya tidak
akan mengalami efek analgesik yang optimal dari obat.8

Serangkaian besar laporan kasus yang divalidasi dipegang oleh banyak sistem
pelaporan spontan merupakan daerah yang subur untuk jenis penelitian (lihat
Bab 9 dan 10). Namun, ini mengharuskan agar lembaga memelihara hubungan
yang baik dengan orang-orang yang mengirimkan laporan. Badan ini juga harus
memiliki mekanisme untuk memperoleh akses ke bahan biologis atau genetik
dengan persetujuan dari komite etik yang relevan. Penggunaan tes genetik
sesuai dgn reaksi obat yang merugikan (ADR) laporan dan metode
pharmacoepidemiologic untuk memprediksi dan menjelaskan variabilitas dalam
respon obat merupakan daerah baru yang menjanjikan dari penelitian (lihat juga
Bab 37).

PENGARUH PENYAKIT PADA METABOLISME OBAT


Penyakit hati dapat mengakibatkan berkurangnya eliminasi obat larut lemak
yang dimetabolisme oleh organ ini. Sayangnya, tidak ada tes yang mudah untuk
fungsi hati yang analog dengan pengukuran kreatinin untuk memperkirakan
fungsi ginjal. Tes biokimia konvensional sebagian besar mencerminkan
kerusakan hati, bukan fungsi hati. Hal ini sangat mungkin bagi seorang individu
untuk memiliki tes fungsi hati terlalu kacau, sementara masih metabolisme obat
yang biasanya, atau alternatif untuk memiliki tes fungsi hati kelihatannya
normal, meskipun kehadiran penyakit hati lanjutan dengan gangguan yang
ditandai kapasitas metabolik. Untuk memperjelas lebih lanjut, hati berperilaku
seolah-olah itu memiliki sejumlah "fungsi parsial" yang merespon secara
berbeda terhadap penyakit. Misalnya, bilirubin konjugasi mungkin terganggu,
sementara sintesis albumin berlanjut cukup normal. Atau, kedua fungsi ini
mungkin hampir normal, meskipun kehadiran penyakit hati yang telah
berkembang sejauh itu telah menghasilkan tekanan tinggi dalam vena portal,
dengan berikutnya perdarahan varises esofagus. Dengan demikian sulit
menggeneralisasi efek dari penyakit hati pada metabolisme obat hati. Namun,
penelitian farmakokinetik telah menunjukkan bahwa penyakit hati telah menjadi
parah dan biasanya kronis, menghasilkan penurunan eliminasi obat. Ini
kasusnya, misalnya, pada individu dengan sirosis atau hepatitis kronis aktif, di
mana reaksi Tahap I terutama terpengaruh, sementara reaksi conjugative relatif
terhindar. individu lain, seperti orang-orang dengan obstruksi bilier atau
hepatitis virus akut, mungkin memiliki metabolisme obat mengejutkan normal.

Metabolisme obat juga dapat dipengaruhi oleh proses penyakit yang berasal dari
organ lain. Misalnya, gagal jantung kongestif dapat mengakibatkan kemacetan
hati yang parah, dan karena itu mengganggu klirens hepatik untuk beberapa
senyawa, sementara hipoksia telah terbukti mengurangi nyata metabolisme
teofilin.44 Berkurangnya aliran darah hati juga dapat mengakibatkan
berkurangnya ekstraksi dan tingginya metabolisme klirens obat seperti morfin
dan propranolol.

Sebagai rangkuman, penyakit hati merupakan penyebab yang jarang terjadi


untuk gangguan metabolisme obat klinis penting. Umumnya, dapat dinyatakan
bahwa faktor genetik dan lingkungan adalah penyebab yang lebih penting untuk
variabilitas dalam metabolisme hepatik obat dari penyakit pada organ itu
sendiri.

EFEK AKTIF METABOLIT

Aturan umum metabolisme obat menghasilkan metabolit yang tidak aktif atau
kurang aktif daripada obat induk tidak selalu berlaku. Ini harus dianggap
sebagai penjelasan yang mungkin untuk temuan pharmacoepidemiologi yang
tak terduga. Misalnya, beberapa metabolit untuk carbamazepine berkontribusi
terhadap aktivitas farmakologi nya.45 Metabolit hidroksil untuk propranolol
memiliki aktivitas yang mirip dengan senyawa induknya.46 metabolit
terkonjugasi biasanya tanpa aktivitas, tetapi morfin-6-glukuronat telah
menunjukkan seperti adanya reaksi morfin, dan akumulasi metabolit ini dapat
menjelaskan efek candu yang berkepanjangan morfin yang ditemukan pada
individu dengan gagal ginjal lanjutan.47 Demikian pula, turunan asetil
terkonjugasi dari procainamide obat antiaritmia telah terbukti memiliki aktivitas
farmakologi, dan dapat menyebabkan keracunan.

Kadang-kadang metabolit memiliki efek toksik yang tidak ditampilkan oleh


obat induk. N-acetylbenzo-quinoneimine adalah metabolit beracun yang
dibentuk oleh metabolisme oksidatif acetaminophen. Hal ini biasanya
diproduksi dalam jumlah kecil tapi cepat dibersihkan oleh reaksi dengan
glutation. Dalam keracunan acetaminophen, cadangan glutathione yang tersedia
habis dan metabolit beracun bebas untuk mengerahkan aksinya pada membran
sel, menyebabkan kerusakan hati yang mungkin pada kesempatan berakibat
fatal. Lebih untuk metabolit yang dapat dibentuk dengan adanya induksi enzim.
Akibatnya, peminum berat kronis dan orang yang memakai antikonvulsan
jangka panjang mungkin lebih rentan untuk terjadi kerusakan hati.48

PENGARUH KLIRENS PRESISTEMIK

Obat oral Tertentu dimetabolisme secara substansial dalam usus dan / atau
dalam hati sebelum mereka mencapai sirkulasi sistemik. Fenomena ini dikenal
sebagai "first pass" metabolisme atau "presystemic" clearance. Obat dengan
klirens presystemic tinggi termasuk morfin, lisan kontra-ceptives, prazosin,
propranolol, dan verapamil. Perbedaan antara obat dengan jarak presystemic
tinggi atau rendah menjadi jelas jika metabolisme hati terganggu oleh penyakit
atau dihambat oleh obat lain atau jika aliran darah ke hati berkurang atau gagal
jantung kongestif.

Dalam kasus obat dengan izin presistemik rendah, penurunan hasil metabolisme
hati dalam perpanjangan dari waktu paruh eliminasi. Umumnya, dibutuhkan
waktu sekitar lima kali waktu paruh untuk mencapai konsentrasi steady state
baru, dan akumulasi dari obat yang dapat menyebabkan keracunan. Jika obat
memiliki izin presistemik tinggi, penurunan metabolisme akan menghasilkan
peningkatan bioavailabilitas obat, dengan konsentrasi tinggi, dan mungkin
beracun, di awal pengobatan, mungkin setelah dosis pertama, meskipun masih
akan memerlukan waktu lima kali waktu paruh untuk mencapai konsentrasi
steady state baru (dengan cara yang sama seperti ketika dosis ditingkatkan).
Dengan demikian, dalam studi tentang efek samping obat pada subyek dengan
gangguan hati atau penghambatan metabolisme oleh obat lain, perjalanan waktu
efek samping bisa sangat tergantung pada faktor ini.

INTERAKSI OBAT-OBAT YANG MELIBATKAN ENZIM METABOLISME


OBAT
Induksi enzim terjadi ketika administrasi kronis hasil substansi dalam
peningkatan jumlah enzim metabolisme tertentu. Ketika enzim tersebut
diinduksi, tingkat metabolisme obat dapat meningkatkan beberapa kali lipat.
Selanjutnya penurunan dalam konsentrasi obat dalam darah, dan, akibatnya, di
lokasi kerjanya, dapat mengakibatkan kerugian besar dari aktivitas obat.
Misalnya, kegagalan etinil estradiol yang mengandung kontrasepsi oral bisa
diakibatkan dari efek enzim-inducing CYP450 dari beberapa obat anti-
epilepsi.49 Laju metabolisme warfarin meningkat dengan obat yang diberikan
serentak, termasuk carbamazepine, rifampisin, dan barbit-asam urat, sehingga
mengurangi steady state konsentrasi plasma, dan karena itu efek antikoagulan
berkurang.

Induksi enzim berlangsung melalui mekanisme yang melibatkan peningkatan


transkripsi gen, mengakibatkan peningkatan sintesis protein enzim yang baru. 5
Hal ini dapat memakan waktu beberapa minggu untuk mencapai puncaknya
(kecuali dengan alkohol, di mana proses ini lebih cepat), dan dapat bertahan
selama beberapa waktu setelah obat menginduksi adalah berhenti. enzim
CYP450 berbeda dalam kemampuan mereka untuk diinduksi dalam menanggapi
paparan yang diberikan. Misalnya, metabolisme teofilin adalah mudah diinduksi
dengan merokok, sedangkan metabolisme fenitoin dipengaruhi untuk sebagian
besar oleh barbiturat dan obat anti-epilepsi.44

Penghambatan enzim terjadi ketika kehadiran satu substansi menghambat


metabolisme zat lain. Ini melibatkan baik kompetisi untuk situs aktif di enzim,
atau interaksi bindingsite lain yang mengubah aktivitas enzim. Berbeda dengan
induksi, enzim inhibisi terjadi dengan cepat, dan dengan cepat dibalik zat
penghambat ditarik kembali.Seperti induksi, senyawa berinteraksi menampilkan
spesifisitas yang cukup, dan sejumlah obat yang biasa digunakan memiliki
kapasitas untuk menghambat fungsi mikrosomal. Misalnya, cimetidine mampu
menghambat Metab-olism banyak senyawa, termasuk warfarin, teofilin,
fenitoin, propranolol, dan beberapa benzodiazepines. 50 Sebaliknya, omeprazole
telah terbukti menghambat metabolisme diazepam dan fenitoin, tetapi bukan
dari propranolol .51-53 Eritromisin adalah inhibitor enzim klinis penting, terkenal
karena efeknya pada metabolisme teofilin. Eritromisin dan antibiotik macrolide
lainnya telah terbukti dapat menghambat metabolisme terfenadin antihistamin
dan astemizol dan agen cisapride prokinetic. Obat ini dapat menghambat
saluran ion kalium dalam hati dengan risiko akibat dysrhythmia ventrikel yang
54
serius, dan mereka telah ditarik dari sebagian besar pasar. Interaksi obat
narkoba tidak selalu berbahaya. kalsium antagonis diltiazem dan verapamil (tapi
tidak nifedipine) meningkatkan konsentrasi siklosporin plasma, tetapi dengan
hemat relatif nefrotoksisitas, dan interaksi yang telah digunakan dalam praktek
klinis untuk menghasilkan konsentrasi imunosupresif dari siklosporin pada
55
dosis oral yang lebih rendah. Penghematan biaya obat 14-48%, disebabkan
penggunaan antagonis kalsium, telah dilaporkan dalam transplantasi
farmakoterapi. Demikian pula, protease inhibitor ritonavir digunakan dalam
kombinasi dengan obat lainnya di kelas ini (misalnya, lopinavir) dalam dosis
rendah karena menghambat metabolisme mereka dan "meningkatkan" kadar
darah mereka dan keefektifan.

Penelitian terbaru telah mengungkapkan bahwa banyak pemicu dan inhibitor


CYP3A4 bertindak sama pada transporter obat P-glikoprotein. Misalnya ini
pompa beberapa obat (misalnya, digoxin) ke dalam lumen usus, mengurangi
8
bioavailabilitas. Makrolida antibiotik dapat menghambat transporter ini dan
sehingga meningkatkan bioavailabilitas digoxin, menyebabkan keracunan. Jelas
dunia interaksi obat-obat yang lebih kompleks dari yang kita bayangkan!

Interaksi timbul tidak hanya sebagai akibat dari obat lain; konstituen makanan
dapat mempengaruhi metabolisme obat. Sebagai contoh, biflavenoids ada dalam
jus jeruk memiliki efek penghambatan kuat pada metabolisme presistemik
antagonis kalsium, menyebabkan dua sampai tiga kali lipat peningkatan dalam
penyerapan sistemik nifedipine lisan dan felodipine. 56 Efek yang sama dari
biflavenoids di siklosporin Concentra-tions telah diamati dan telah digunakan
untuk mengurangi dosis, dan oleh karena efek samping dan biaya, terapi
siklosporin. Kedua antagonis kalsium dan siklosporin dimetabolisme oleh
CYP3A4 CYP450 isoenzim, yang hadir dalam dinding usus dan hati, dan
biflavenoids menghambat aktivitasnya.

Kadang-kadang konstituen diet dapat secara langsung mengantagonis efek obat.


Misalnya, vitamin K yang terkandung dalam makanan seperti kubis, kecambah
brussels, brokoli, bayam, selada, minyak biji perkosaan, dan minyak kedelai,
diambil dalam jumlah yang cukup, mungkin mengantagonis efek warfarin.

AKIBAT DARI VARIABILITAS DALAM FARMAKOKINETIKA

Pembahasan diatas menjelaskan penyebab variabilitas di farmakokinetik hanya


penting jika ada konsekuensi klinis yang mungkin terdeteksi dalam studi
pharmacoepidemiology. Oleh karena itu, penting untuk menentukan keadaan di
mana faktor-faktor ini akan memberikan kontribusi untuk variabilitas respon
obat.

Beberapa faktor yang penting. Yang pertama adalah hubungan antara


konsentrasi obat dan efeknya. Perubahan dari farmakokinetik obat cenderung
menjadi penting jika mereka melibatkan obat-obatan yang memiliki rasio terapi
rendah. Hal ini mengacu pada rasio konsentrasi obat yang menghasilkan efek
toksik pada konsentrasi yang memunculkan efek terapeutik. Jika rasio rendah
maka perubahan kecil dalam konsentrasi obat akan menyebabkan efek samping.
Contoh obat dengan profil ini digoxin dan lithium, yang mana tujuan utamanya
diekskresikan tanpa perubahan oleh ginjal, dan teofilin dan warfarin, yang mana
tujuan utamanya aktif oleh metabolisme hati. Siklosporin juga memiliki rasio
terapeutik yang sempit, tetapi variasi antara individu dalam penyerapan,
distribusi, dan metabolisme telah membuat definisi terapi, tetapi tidak beracun,
konsentrasi sulit. Itu mengalami baik metabolisme hati dan metabolisme lokal
dalam usus, dan yang terakhir mungkin menjadi kontributor utama untuk
variabilitas dalam penyerapan.

Terlepas dari apakah kita berhadapan dengan penurunan fungsi ginjal atau
pengurangan atau penghambatan metabolisme hati, konsekuensi dalam setiap
kasus dari peningkatan konsentrasi plasma akan akumulasi obat, dan toksisitas
potensial. Sebaliknya, interaksi yang melibatkan obat dengan rasio terapi tinggi,
misalnya penisilin, jarang akan menghasilkan efek samping yang signifikan.

PENTINGNYA FAKTOR PRESCIBER DAN PERILAKU KONSUMEN

Perilaku manusia dapat menjadi sumber yang lebih besar variabilitas dalam pola
paparan obat daripada faktor lain yang dianggap sejauh ini dalam bab ini. Hal
ini karena banyak faktor lain dipertimbangkan dalam bab iniyang tidak
berhubungan , melainkan digunakan untuk intensitas paparan (misalnya,
perubahan dalam clearance, atau interaksi obat obat-). Sebaliknya, non-
kepatuhan dengan terapi akan memiliki efek yang lebih mendalam (lihat juga
Bab 46).

Dalam melakukan penelitian pharmacoepidemiology, penting untuk


memberikan kesadaran terhadap dampak perilaku manusia terhadap resep dan
pola konsumsi. Faktor yang berhubungan dengan penyakit yaitu dokter, pasien,
interaksi dokter-pasien, biaya obat dan ketersediaan, dirasakan dan manfaat
yang sebenarnya dan risiko pengobatan, dan perusahaan farmasi kegiatan
promosi.
PENGOBATAN HASIL DAN INDIKASI

Pengaruh utama pada resep bertujuan alami untuk mencapai yang terbaik hasil
pengobatan bagi pasien. Misalnya, jika dosis awal obat pilihan pertama tidak
efektif pada pasien yang diberikan, prescriber dapat memilih untuk
meningkatkan dosis, menambahkan obat lain, atau beralih ke obat yang
berbeda. Kadang-kadang, semua pilihan ini akan diadili secara berurutan. Bagi
banyak gangguan, intensitas mengobati-ment dititrasi terhadap respon yang
terukur, seperti tekanan darah, pengukuran kolesterol darah, atau dis-dikan
bahwa pasien dapat berjalan sebelum mengembangkan nyeri angina. Akibatnya,
individu dengan penyakit yang mendasari atau lebih tahan gejala yang lebih
berat akan cenderung menerima dosis tinggi obat, dan jumlah yang lebih besar
dari obat. Dalam studi pharmacoepidemiology, mungkin karena sulit untuk
menentukan apakah asosiasi penyakit-obat yang diberikan disebabkan oleh obat
yang diteliti, atau dikacaukan oleh sifat atau keparahan keadaan penyakit yang
mendasari (lihat juga Bab 39, 40, dan 47) .

Terjadinya efek samping, misalnya batuk dengan inhibitor ACE atau perdarahan
gastrointestinal dengan OAINS, jelas akan menyebabkan resep ke Alter Pilihan
Obat dan untuk menghindari penggunaan masa depan Agen seperti pada pasien
yang terkena, dan mungkin pada pasien lain. Demikian pula, eksis-ence
kontraindikasi terhadap obat tertentu, seperti β-blocker pada asma, atau
penisilin Alergi, akan berdampak pada Choices Obat resep 'untuk pasien
tertentu. Mendasari patologi Sering mengarahkan pilihan-Obat contoh, ACE
inhibitor adalah pertama pilihan yang wajar untuk Pengobatan hipertensi pada
pasien diabetes, tetapi akan dianggap oleh banyak orang sebagai pertama Drug
tidak perlu mahal untuk yang baru didiagnosis hipertensi sederhana dalam Jika
tidak baik individu. Dengan tidak adanya informasi tentang Diagnosis, patologi
lainnya, dan kontraindikasi, interpretasi akurat dari pola penggunaan obat yang
diamati dalam studi pharmacoepidemiology mungkin sulit.

HARAPAN DAN PERMINTAAN

Permintaan dan harapan pasien telah dikutip mempengaruhi keputusan dokter


untuk meresepkan. Namun, Muncul celah antara 'harapan resep dan Dokter',
pasien di praktek umum yang diharapkan resep memakan waktu hingga tiga kali
lebih mungkin untuk menerima satu daripada mereka yang tidak. Namun,
pasien yang dokter umum diyakini diharapkan resep yang digunakan memakan
waktu hingga sepuluh kali lebih .Berspekulasi bahwa kegagalan memastikan
ekspektasi pasien adalah alasan utama mengapa Dokter meresepkan lebih 1 obat
dari pasien diharapkan. Faktor lain yang mempengaruhi keputusan untuk
meresepkan dalam studi ini termasuk tingkat dokter dari kualifikasi akademik,
tarif resep praktek, pembebasan pasien dari resep biaya, dan konsuktasi

Kerugian dan Kelebihan Pengobatan

Bahaya dan manfaat dari Pengobatan dapat mengerahkan Pengaruh pada


keputusan resep, pasien dianggap memiliki efek samping yang tidak diinginkan
dari Terapi dibandingkan mereka yang tidak risiko tersebut untuk menerima
treatment.59 Persepsi bahaya dan manfaat mungkin berbeda dengan prescriber
tersebut. Sebagai contoh, telah menemukan bahwa dibandingkan dengan
cardiolo-gists, General Dokter melebih-lebihkan manfaat treatments.

Informasi Framing, yaitu, cara penyajian risiko dan manfaat, mungkin


Mempengaruhi resep keputusan. Hasil pengobatan yang disajikan dalam hal
pengurangan risiko relatif lebih mungkin untuk memperoleh keputusan untuk
mengobati daripada yang disajikan dalam hal pengurangan risiko absolut, atau
nomor yang diperlukan untuk treat. bahan promosi dari perusahaan farmasi
sering menjelaskan manfaat perawatan di relatif sebagai lawan untuk secara
absolut, seperti melakukan artikel koran yang kutipan them.62 sebagai langkah
efek relatif biasanya tampil lebih mencolok daripada absolut meas-ures,
langkah-langkah efek relatif dapat dinilai cukup mengesankan untuk membujuk
resep dengan resep IV sibuk untuk mempertimbangkan data asli secara rinci .
Sementara keputusan untuk meresepkan berdasarkan Bukti tersebut dapat
dibenarkan dalam kasus di mana manfaat mutlak terjadi menjadi wajar, inappro-
priate keputusan resep dapat dilakukan jika sangat kecil atau tidak signifikan.

Pasien juga dapat dipengaruhi oleh cara penyajian data pada manfaat dan
bahaya treatments.63 Misalnya, operasi lebih mungkin akan lebih disukai
daripada medis mengobati-ment jika hasil disajikan dalam bingkai positif
(Kelangsungan Hidup) dari bingkai negatif ( mortalitas).

Semua keputusan manusia tunduk pada bias kognitif. Sebagai Greenhalgh et al.
telah menunjukkan, "bias ini termasuk penahan terhadap apa yang dilihat
menjadi 'normal', ketidakmampuan untuk membedakan antara probabilitas
kecil, dan tidak semestinya influ-ence dari peristiwa yang mudah untuk
mengingat. Cerita (Tentang efek Berbahaya obat) memiliki dampak yang sangat
kuat, terutama ketika disajikan di media sebagai berlangsung drama sosial. "64

PENGARUH EKONOMI

Pengaruh ekonomi diberikan dari Berbagai Sumber, Semoga Mempengaruhi


Penggunaan narkoba dan karena itu interpretasi studi pharmacoepidemiology
(lihat juga Bab 41). Sebagai obat, terutama yang baru, menjadi semakin mahal,
pembatasan anggaran, atau memang insentif, mungkin berdampak pada
keputusan resep. Misalnya, pada tahun 1993, pemerintah Jerman ditempatkan
batas pada biaya Obat penggantian dan mengumumkan bahwa proporsi
pengeluaran lebih dari batas ini akan dapat diperoleh kembali dari anggaran
remu neration Dokter '. Perubahan resep pola, setidaknya pada masa setelah
awal batas, dan signifikan. Jumlah resep turun dan ada langkah untuk
penggunaan kedua Generik Produk dan lebih tua, drugs.65 lebih murah

Di Inggris Departemen Kesehatan memperkenalkan beberapa skema


dimaksudkan untuk mengandung biaya dari Kesehatan Nasional

Layanan resep. Ini termasuk pengaturan indikatif anggaran pra-memotong


untuk praktik umum, menawarkan insentif untuk membuat resep tabungan, dan
skema fundholding dimana Praktek memegang dan mengelola anggaran sendiri
untuk sejumlah layanan, termasuk resep. Efek pada pola resep telah variabel. Di
Australia, perusahaan farmasi wajib memberikan Bukti efektivitas biaya dari
produk mereka, dibandingkan dengan Alternatif yang ada, sebelum listing di
daftar nasional obat penggantian (lihat juga Bab 25). substitusi generik didorong
dan biaya obat-obatan "IV" dikendalikan, sebagian, oleh harga referensi.
Selandia Baru juga menggunakan analisis pharmacoeconomic dan harga
Referensi, tapi tidak biasa antara negara-negara maju juga tender untuk
beberapa Kebutuhan Farmasi nya. Ini telah sangat populer Di antara nama
merek perusahaan pabrikan-Turing utama.

Pendekatan lain yang dimaksudkan untuk mengendalikan biaya resep telah


mencantumkan formularium nasional dan Daftar Limited, pasien co-
pembayaran, dan pedoman.

Sementara pendekatan yang diuraikan di atas mencerminkan beberapa Upaya


pemerintah untuk mengendalikan biaya obat oleh mempengaruhi resep Pilihan,
pasien sendiri mungkin juga mengerahkan Pengaruh berdasarkan kemampuan
mereka untuk membayar obat-obatan. Di mana pasien ditutupi oleh skema
negara atau asuransi swasta, beban Kedokteran tidak dapat dirasakan oleh
pasien atau prescriber menjadi masalah dan pilihan obat tidak akan dibatasi oleh
kemampuan untuk membayar. Bahkan, Choices lebih mahal daripada mutlak
diperlukan dapat didorong. Namun, untuk pasien diharuskan membayar secara
keseluruhan atau sebagian untuk obat-obatan mereka, biaya mungkin
Mempengaruhi pilihan obat dan, misalnya, diuretik sebagai lawan ACE
inhibitor atau antagonis kalsium dapat dipilih untuk hipertensi mengobati-ment,
meskipun tidak selalu pilihan terbaik untuk individu yang bersangkutan. Bahkan
di negara-negara dengan program asuransi sosial yang kuat pasien kadang-
kadang mengalami kesulitan dalam obat affording, karena pasien levels.66 co-
pembayaran yang relatif tinggi

Resep sendiri mungkin memiliki Tujuan berupa uang di resep. Melayani untuk
metode pelayanan Dokter remuner-asi (sebagai terhadap kapitasi melayani)
telah ditemukan untuk mendorong penggunaan yang lebih tinggi dari
services.67 Di Jepang, Dokter mengeluarkan serta meresepkan obat-obatan dan
insentif keuangan yang terkait dianggap berkontribusi pada tinggi jumlah resep
per kapita dan penggunaan Kekhawatiran drugs.68,69 mahal tentang efek pada
resep dari insentif yang ditawarkan untuk Dokter oleh Industri Farmasi telah
Led untuk praktek-praktek seperti yang dianjurkan di sebagian besar negara dan
Produsen telah secara sukarela mengadopsi kode pegangan yang baik praktek.

Industri Farmasi

kegiatan promosi Industri Farmasi dapat mempengaruhi resep praktek dengan


cara yang relevan dengan pharmacoepi demiology. Sebagai contoh, jika
produsen mempromosikan NSAID baru sebagai kurang rentan menyebabkan
toksisitas gastrointestinal dibandingkan OAINS lainnya, mungkin diberikan
kepada Individu yang memiliki risiko intrinsik yang lebih tinggi dari perdarahan
gastrointestinal, seperti orang-orang yang telah mengembangkan dispepsia saat
menerima lain NSAIDS, atau yang memiliki riwayat ulserasi lambung. Individu
ini karena itu akan diharapkan memiliki risiko meningkat perdarahan
gastrointestinal berikutnya di com-parison dengan mereka yang menerima
lainnya OAINS, meskipun temuan tersebut mungkin salah dikaitkan dengan
New Drug. Bentuk "menyalurkan" telah menjadi fitur yang sangat kuat dengan
Cox-2 inhibitor dan, jika tidak disesuaikan dalam studi nonrandomized, akan
memberikan kesan menyesatkan pesimis toksisitas gastrointestinal kelas ini
drugs.70

perusahaan farmasi dapat mengerahkan Pengaruh, langsung dan tidak langsung,


pada resep Pilihan. Hal ini dapat terjadi melalui wakil-wakil mereka yang
mengunjungi dokter untuk memberikan informasi tentang Obat Produk secara
satu-ke-satu, sponsor dari pertemuan pendidikan, Kerja Personalia (misalnya,
Perawat di asma atau klinik diabetes), sponsorship untuk menghadiri
International pertemuan khusus, undangan untuk spesialis untuk menjadi "Ahli
penasehat" di daerah khusus mereka praktek.

PERILAKU PASIEN

Perilaku konsumen juga harus diperhatikan dalam Studi Pharma-


coepidemiology. Sejumlah penelitian telah menunjukkan bahwa individu
dengan beberapa Penyakit, terutama penyakit yang tidak menunjukkan gejala,
seperti hipertensi dan hypercholester olemia, cenderung memiliki kepatuhan
miskin dengan resep rejimen obat Terapi. Oleh karena itu, jika sebuah studi
pharmacoepidemiology harus dilakukan dalam situasi seperti ini, dan
penggunaan obat yang secara operasional didefinisikan sebagai pengeluaran
dari resep, maka jumlah resep ditiadakan mungkin melebih-lebihkan Paparan
benar untuk obat yang. Di sisi lain, sesuai dengan beberapa obat, seperti
kontrasepsi oral, cenderung menjadi baik karena konsumen sangat Termotivasi
untuk membawa mereka. Dalam kasus obat yang diambil untuk gejala tertentu,
seperti sakit atau mengi, Individu dapat minum obat lebih dari yang diresepkan.
Jika hal ini terjadi secara kronis, itu harus tercermin dalam jumlah resep yang
telah dibagikan untuk individu selama periode waktu tertentu.

Penggunaan obat-obatan non-resep, yang kadang-kadang memiliki efek yang


sama seperti obat resep, juga perlu dipertimbangkan. Misalnya, ketika
memeriksa efek dari NSAID menggunakan data resep, penting untuk
mempertimbangkan kemungkinan bahwa Individu yang tampak tidak terpapar
mungkin benar-benar telah terkena non-resep NSAID. Ada kecenderungan
umum di seluruh dunia untuk Variasi yang lebih luas dari obat, yang
sebelumnya hanya tersedia pada resep, untuk menjadi tersedia over-the-counter.
Di banyak negara, obat yang dikenal memiliki potensi yang signifikan untuk
menyebabkan interaksi, seperti cimetidine, termasuk dalam ketersediaan non-
resep ini. Tentu saja, meningkatnya penggunaan suplemen diet, dengan hampir
tidak ada kontrol kualitas atau Peraturan efektif, membuat ini bahkan lebih
buruk.

Konsumen dari obat yang diresepkan mungkin berbeda dari non pengguna
dalam sejumlah cara lain yang dapat mengacaukan studi
pharmacoepidemiology, misalnya, asupan alkohol dan status merokok.
Sayangnya, informasi ini jarang, jika pernah, tersedia dari beberapa Sumber
data, (misalnya, Database otomatis). Individu yang mengambil obat-obatan
tertentu dapat menggunakan layanan medis lainnya memiliki gaya hidup yang
berbeda dari non pengguna. Dalam kasus Terapi estrogen pasca-menopause,
konsumen terbukti menggunakan lebih besar dari pelayanan medis lainnya dan
memiliki tingkat yang lebih tinggi dari latihan daripada non-consumers.71This
penting, karena faktor-faktor ini dengan pembaur potensial dari hubungan
antara penggunaan estrogen dan hasil seperti patah tulang pinggul dan infark
miokard (lihat Bab 40).

Pengetahuan tentang prescriber dan Konsumen perilaku sangat penting ketika


melakukan penelitian pharmacoepidemiology. Kedua dosis tinggi obat dan
penggunaan kombinasi obat sering penanda untuk Penyakit yang mendasari
lebih parah. Oleh karena itu, Upaya untuk menghubungkan Paparan obat
dengan hasil tertentu harus memperhitungkan faktor-faktor ini. keparahan
penyakit atau Intoleransi terhadap obat sebelumnya dapat dihubungkan dengan
cara-cara halus untuk hasil Tujuan, dan studi pharmacoepidemiology tunduk
pada bentuk-bentuk yang membingungkan. pengaruh ekonomi dan promosi
dapat mempengaruhi resep pola dalam sejumlah cara, baik yang jelas dan halus,
dan juga Membutuhkan pertimbangan sebagai pembaur poten-esensial.

KESIMPULAN

Pharmacoepidemiology adalah ilmu yang kompleks dan eksak. Akan nyaman


jika eksposur dan hasil bisa selalu diasumsikan dikotomis.Jika Risiko dapat
diasumsikan meningkat secara proporsional dengan Durasi pameran-korupsi.
Namun, karena kompleksitas penggunaan dan efek dari obat antara Penduduk,
ini menyederhanakan asumsi sering dilanggar. Pengguna obat obatan sering
berbeda dalam hal pengguna, dan cara-cara pemakaian

. Perbedaan-perbedaan ini dapat membaurkan Asosiasi antara Paparan dan hasil.


Tanggapan terhadap obat sangat bervariasi, tidak hanya antara individu tetapi
juga dalam Individu dari waktu ke waktu. Variabilitas respon antar dan intra-
individu ini dapat mengakibatkan efek samping yang nyata di awal Treatment,
dan mengembangkan-ment toleransi pada pengguna jangka panjang. Studi
Farmakologi Klinik memberikan kita banyak Wawasan, dan pengetahuan
tentang Prinsip yang mendasari penting selama tindakan tersebut, dan
khususnya penafsiran Studi Pharma-coepidemiology.

Seperti yang dibahasdalambab-babsebelumnya,


penelitianfarmakoepidemiologimenerapkanteknikepidemiologiuntuk area
farmakologiklinis. Bab iniakanmeninjaustudifarmakoepidemiologi yang
harusdilakukan.
Dimulaidengandiskusitentangberbagaialasanmengapaseseorangmelakukanstudif
armakoepidemiologi.Pusatutamadariiniadalahkemauanseseoranguntukmentolera
nsirisiko.Apakahperspektifseseorangadalahbahwadariprodusen, regulator,
akademisi, ataudokter,
salahsatukebutuhanuntukmempertimbangkanrisikoefeksamping yang
dianggapditoleransi.Dengandemikian,
babiniakanmelanjutkandiskusitentangperbedaanantarakeselamatandanrisiko.
Iniakanmenyimpulkandengansebuahdiskusitentangfaktor-
faktorpenentutoleransiseseorangdaririsiko.

ALASAN MELAKUKANSTUDI FARMAKOEPIDEMIOLOGI

Keputusan untuk melakukan studi farmakoepidemiologidilihat mirip dengan


keputusan peraturan tentang untukapakah menyetujui obat untuk pemasaran
atau keputusan klinis tentang untuk apakahmeresepkan obat. Dalam setiap
kasus, pengambilan keputusan melibatkan penimbangan biaya dan risiko dari
terapi terhadap manfaatnya.
Biaya utama dari studi farmakoepidemiologi mencakup biaya (moneter, usaha,
waktu) dari melakukan penelitian itu sendiri. Biaya ini jelas akan bervariasi,
tergantung pada pertanyaan yang diajukan dan pendekatan yang dipilih untuk
menjawab penelitian. Apapun, dengan pengecualian postmarketing uji
klinissecara acakakanterwujud, biaya per pasien cenderung setidaknya urutan
besarnya kurang dari biaya studi premarketing. Biaya lain yang perlu
dipertimbangkan adalah biaya kesempatan dari penelitian lain yang mungkin
dibatalkan jika penelitian ini dilakukan.

Salah satu risiko melakukan studi farmakoepidemiologi adalah kemungkinan


bahwa hal itu bisa mengidentifikasi hasil yang merugikan seperti yang terkait
dengan obat yang diselidiki padahal sebenarnya obat tidak menyebabkan hasil
yang merugikan. Risiko lain adalah bahwa hal itu bisa memberikan jaminan
palsu tentang keamanan obat ini. Kedua risiko ini dapat diminimalkan dengan
desain yang sesuai studi, peneliti terampil, dan interpretasi yang tepat dan
bertanggung jawab dari hasil yang diperoleh.

Manfaat studi farmakoepidemiologi dapat dikonseptualisasikan dalam empat


kategori yang berbeda: peraturan, pemasaran, klinis, dan hukum (lihat Tabel
5.1). Masing-masing akan menjadi sangat penting untuk organisasi dan individu
yang terlibat dalam memutuskan apakah akan memulai studi. Setiap studi yang
diberikan biasanya akan dilakukan untuk beberapa alasan ini. Masing-masing
akan dibahas satu per satu.

Tabel 5.1. Alasan untuk melakukan studi farmakoepidemiologi

Regulator
(1) Diperlukan
(2) Untuk mendapatkan persetujuan sebelumnya untuk pemasaran
(3) Sebagai respon atas pertanyaan oleh badan pengawas
(4) Untuk membantu permohonan persetujuan untuk pemasaran di tempat lain

Pemasaran

(1) Untuk membantu penetrasi pasar dengan mendokumentasikan keamanan


obat
(2) Untuk meningkatkan pengakuan nama
(3) Untuk membantu reposisi obat

(A) hasil yang berbeda, misalnya, kualitas hidup dan ekonomi


(B) Berbagai jenis pasien, misalnya, orang tua
(C) indikasi baru
(D) pelabelan yang kurang ketat

(4) Untuk melindungi obat dari tuduhan tentang efek samping

Hukum

(1) Dalam mengantisipasi masa depan litigasi produk

Clinical
(1) Pengujian hipotesis

(A) Masalah hipotesis atas dasar struktur obat


(B) Masalah diduga atas dasar data manusia praklinis atau premarketing
(C) Masalah diduga atas dasar laporan spontan
(D) frekuensi reaksi yang merugikanmemerlukankuantitatif yang lebihbaik
(2) Hipotesis menghasilkan kebutuhan tergantung pada:
(A) apakah merupakan entitas kimia baru
(B) profilkeamanandarikelas
(C) relatif aman dari obat dalam kelas
(D) formulasi
(E) penyakit yang akan diobati, termasuk

(i) durasinya
(ii) prevalensinya
(iii) tingkat keparahannya
(iv) apa terapi alternatif yang tersedia

REGULASI

Mungkin alasan yang paling jelas dan kuat untuk melakukan studi
farmakoepidemiologi postmarketing adalah peraturan: rencana studi
farmakoepidemiologi postmarketing diperlukan sebelum obat akan disetujui
untuk pemasaran. Persyaratan untuk penelitian postmarketing telah menjadi
semakinbanyak dalam beberapa tahun terakhir. Bahkan, sejak awal 1970-an
FDA diperlukan untukpenelitian postmarketing pada saat persetujuan untuk
sekitar sepertiga dari semua obatbaru yang disetujui. Banyak studi
wajibmelakukan uji klinis acak, yang dirancang untuk memperjelas pertanyaan
residual tentang khasiat obat. Lainnya berfokus pada pertanyaan toksisitas obat.
Sering tidak jelas apakah studi farmakoepidemiologidilakukan dalam
menanggapi kebutuhan peraturan atau dalam menanggapi sekedar "saran" oleh
regulator, tetapi efeknya pada dasarnya sama. Contoh awal dari penelitian yang
dilakukan untuk menjawab pertanyaan peraturan termasuk "Tahap IV"
penelitian kohort dilakukan dari cimetidine dan prazosin.

Kadang-kadang produsen dapat menawarkan untuk melakukan studi


farmakoepidemiologi dengan harapan bahwa badan pengawas mungkin
menyetujui pemasaran obat sebelumnya. Jika agen percaya bahwa setiap
masalah serius akan terdeteksi dengan cepat dan andal setelah pemasaran, bisa
merasa lebih nyaman untukmemasarkan obatlebih cepat. Meskipun sulit untuk
menilai dampak dari studi postmarketing pada keputusan peraturan, dampak
ekonomi yang sangat besarpada persetujuan sebelumnya telah memotivasi
beberapa produsen untuk memulai studi tersebut. Selain itu, dalam beberapa
tahun terakhir pihak berwenang telah sesekali merilis obat sangat penting
setelah pengujian dasarnya hanya Tahap II, dengan pengertian bahwa data
tambahan akan dikumpulkan selama pengujian postmarketing. Misalnya, AZT
dirilis untuk pemasaran setelah hanya melakukanpengujian yang terbatas, dan
kemudianhanya data tambahan yang dikumpulkan pada kedua keamanan dan
kemanjuran, data yang ditunjukkan, antara lain, bahwa dosis awalnya
dianjurkan terlalu besar.

Beberapa penelitian postmarketing obat timbul dalam menanggapi laporan


reaksi merugikan yang dilaporkan ke badan pengawas. Suatutanggapan laporan
tersebut mungkin menyarankan perubahan label. Seringkali respon yang lebih
tepat, secara klinis dan komersial, akan mengusulkan studi
farmakoepidemiologi. Penelitian ini akan menyelidiki apakah efek samping ini
sebenarnya lebih sering terjadi pada mereka yang terkena obat daripada yang
telah diharapkan dengan tidak adanya obat dan, jika demikian, seberapa besar
adalah meningkatnya risiko penyakit. Sebagai contoh, database Medicaid
digunakan untuk mempelajari reaksi hipersensitivitas terhadap tolmetin, laporan
berikut tentang masalah ini untuk SistemPelaporanSpontan FDA.
Akhirnya, obat jelas dipasarkan pada waktu yang berbeda di negara yang
berbeda. Sebuah studi farmakoepidemiologipostmarketing dilakukan di negara
yang pemasaran obatnyarelatif awal bisa berguna dalam menunjukkan
keamanan obat untuk badan hukum di negara-negara yang belumdiizinkan
pemasaran obat. Hal ini menjadi semakin layak, baik sebagai industri dan
bidangfarmakoepidemiologi menjadi lebih internasional, dan
regulatorberkolaborasilagi.

PEMASARAN

Seperti yang akan dibahas di bawah, studi farmakoepidemiologidilakukan


terutama untuk mendapatkan jawaban atas pertanyaan klinis. Namun, jelas
bahwa alasanutama yang mendasari untuk beberapa studi
farmakoepidemiologiadalah potensi dampak pemasaran dari jawaban studi.
Bahkan, beberapa perusahaan membuat cabang pemasaran perusahaan yang
bertanggung jawab untukfarmakoepidemiologi, bukan cabang medis.

Karena keterbatasan informasi yang tersedia tentang efek obat pada saat
pemasaran perdana, banyak dokter yang ragu-ragu untuk meresepkan obat
sejumlah besar sampai sejumlah besar pengalaman dalam penggunaannya telah
terkumpulkan. Sebuah penelitian surveilans postmarketing resmi dapat
mempercepat proses itu, serta mengklarifikasi setiap keuntungan atau kerugian
obat dibandingkan dengan pesaingnya.

Sebuah studi farmakoepidemiologi juga dapat berguna untuk meningkatkan


pengenalan nama produk. Fakta bahwa studi sedang berlangsung akan sering
dikenaldalamresep, hasilnyasetelahitudisajikan publik dan diterbitkan.
Peningkatan pengenalan nama ini mungkin akan membantu penjualan.
Peningkatan pengenalan nama produk ini mungkin mengakibatkan terutama
dari studifarmakoepidemiologi yang merekrut subjek untuk studi melalui resep.
Namun, seperti yang dibahas dalam Bab 23, sementara teknik ini dapat berguna
dalam situasi yang dipilih, karenasangat mahal dan cenderung menjadi
produktif dari informasi ilmiah yang berguna daripada kebanyakan alternatif
lain yang tersedia. Secara khusus, pelaksanaan latihan murni pemasaran dengan
penelitian surveilans postmarketing, tidak dirancang untuk mengumpulkan
informasi ilmiah yang berguna, yang akanterhukum.Hal ini menyesatkan dan
bisa membahayakan kinerja masa studi ilmiah yang berguna.

Studi farmakoepidemiologjuga dapat berguna untuk memposisikan obat yang


sudah ada di pasar, yaitu, untuk mengembangkan pasar baru untuk obat. Salah
satunya bisa mengeksplorasi berbagai jenis hasil yang dihasilkan dari
penggunaan obat untuk indikasi yang disetujui, misalnya dampak obat pada
biaya perawatan medis (lihat Bab 41) dan pada kualitashiduppasien (lihat Bab
42 ).Selainitu juga bisa mengeksplorasi penggunaan obat untuk indikasi yang
disetujui dalam jenis pasien selain yang termasuk dalam studi premarketing,
misalnya pada anak-anak atau orang tua. Dengan mengeksplorasi efek
menguntungkan yang tidak diinginkan, atau bahkan khasiat obat (lihat Bab 40),
salah satu bisa mendapatkan petunjuk dan informasi pendukung untuk indikasi
baru untuk penggunaan narkoba. Akhirnya, apakah karena pertanyaan tentang
khasiat atau pertanyaan tentang toksisitas, obat kadang-kadang disetujui untuk
pemasaran awal denganmembatasi label. Misalnya, bretylium awalnya disetujui
untuk pemasaran di AS hanya untuk pengobatan aritmia yang mengancam jiwa.
Persetujuan untuk penggunaan yang lebih luas membutuhkan data tambahan.
Data ini sering dapat diperoleh dari studi farmakoepidemiologi.

Akhirnya, dan mungkin yang paling penting, studi farmakoepidemiologidapat


berguna untuk melindungi investasi besar yang dibuat dalam mengembangkan
dan menguji obat baru. Ketika pertanyaanmuncul tentang toksisitas obat, sering
membutuhkan jawaban yang segera, atau obat mungkin kehilangan pangsa
pasar atau bahkan dihapus dari pasar. Jawaban langsung seringkali tidak
tersedia, kecuali produsen memiliki keinginan untuk melakukan
studifarmakoepidemiologi dalam mengantisipasi masalah ini. Kadang-kadang
masalah ini dapat secarakhususdiramalkan dan ditangani. Namun, ketersediaan
kohort padapasien yang terpapar dan kelompok kontrol sering akan
memungkinkan jawaban yang jauh lebih cepat daripada yang mungkin terjadi
jika harusmelakukanpenelitian de novo. Salah satu contoh adalahPfizerfarmasi,
ketika muncul pertanyaan tentang apakah piroksikam (Felden) lebih cenderung
menyebabkan kematian pada orang tua dari perdarahan gastrointestinal daripada
obat lain nonsteroidal anti-inflammatory. Meskipun Pfizer tidak mendanai
penelitian untuk mengantisipasi pertanyaan seperti itu, beruntung bahwa
beberapakelompokpenelitianfarmakoepidemiologimemiliki data yang tersedia
pada pertanyaan ini karena penelitian lain telahdilakukan. McNeil tidak
seberuntung ketika pertanyaan itu muncul tentang reaksi anafilaksis yang
disebabkan oleh zomepirac. Jika meraka memiliki data yang telah tersedia pada
saat krisis, obatmerekatidakmungkindihapusdaripasar. Baru-baru ini, Syntex
mengakui manfaat potensial, dan risiko, terkait dengan pemasaran ketorolac
parenteral, dan memilih untuk memulai studi kohort dalampengawasan
postmarketing pada saat peluncuran obat. Memang, obat dituduhmemiliki
beberapa hasil buruk yang berbeda, dan itu hanya keberadaan penelitian ini, dan
kemudianhasilyangditerbitkan, yangmenyelamatkan obat di pasar utama.

HUKUM

Studi pengawasan pasca pemasaran secara teoritis dapat berguna sebagai


profilaksis hukum, dalam mengantisipasi nantinya harus bertahan
terhadappertanggung jawaban produk. Kita sering mendengar kalimat "Apa
yang Anda tidak tahu, tidak akan menyakiti Anda." Namun, dalam
pharmacoepidemiology pandangan ini terlihat pendek dan pada kenyataannya,
sangat salah. Semua obat menyebabkan efek merugikan; keputusan regulasi
untuk menyetujui obat dan keputusan klinis untuk meresepkan obat baik
tergantung pada penilaian tentang keseimbangan relatif antara manfaat obat dan
risiko. Dari perspektif hukum, untuk memenangkan gugatan kewajiban produk
menggunakan teori hukum kelalaian, seorang penggugat harus membuktikan
sebab-akibat, kerusakan, dan kelalaian. Sebuah pabrik farmasi yang tergugat
dalam gugatan tersebut tidak dapat mengubah apakah obat yang menyebabkan
efek yang merugikan. Jika obat ini, ini akan mungkin terdeteksi di beberapa
titik. produsen juga tidak bisa mengubah apakah penggugat mengalami
kerusakan hukum dari efek samping, yaitu apakah penggugat menderita cacat
atau biaya yang timbul akibat dari kebutuhan untuk penanganan medis. Namun,
bahkan jika obat itu menyebabkan hasil yang merugikan tersebut, produsen
dapat mendokumentasikan bahwa melakukan penelitian state-of-the-art untuk
mencoba mendeteksi apa obat memiliki efek toksik. Selain itu, studi tersebut
bisa membuat lebih mudah pertahanan pemakaian dengan alasan yang benar, di
mana obat dituding untuk memproduksi tidak menyebabkan efek samping.

KLINIS

Pengujian Hipotesis

Alasan utama untuk studi pharmacoepidemiology sebagian besar adalah


pengujian hipotesis. Hipotesis yang akan diuji dapat didasarkan pada struktur
atau kelas kimia obat. Sebagai contoh, studi cimetidine disebutkan di atas
dilakukan karena cimetidine secara kimia berhubungan dengan metiamide, yang
telah dihapus dari pasar di Eropa karena disebabkan agranulositosis.
Kemungkinan lain, hipotesis dapat juga didasarkan pada premarketing atau
postmarketing yang dilakukan pada hewan atau temuan klinis. Misalnya,
hipotesis dapat berasal dari laporan spon-spontaneus efek samping yang dialami
oleh pasien yang menggunakan obat tersebut. The tolmetin, piroksikam,
zomepirac, dan ketorolak pertanyaan tersebut di atas merupakan contoh di atas.
Pada akhirnya, efek samping mungkin jelas disebabkan obat, tetapi studi
mungkin diperlukan untuk frekuensi kuantitatif. Sebuah contoh akan menjadi
postmarketing studi surveil-lance dari prazosin, dilakukan untuk frekuensi
kuantitatif daridosis pertama sinkop. Tentunya, hipotesis yang akan diuji dapat
melibatkan efek obat yang bermanfaat serta efek obat berbahaya, beberapa
subjek penting mempunyai keterbatasan metodologis. (lihat BAB 40).

MENGHASILKAN HIPOTESIS

Hipotesis menghasilkan penelitian dimaksudkan untuk menyaring efek obat


yang sebelumnya tidak diketahui dan tak terduga. Pada prinsipnya, semua obat
bisa, dan mungkin harus, dikenakan studi tersebut. Namun, beberapa obat
mungkin memerlukan penelitian lebih dari yang lain. Ini telah menjadi fokus
dari penelitian formal, yang disurvei dari para ahli pharmacoepidemiology.

Sebagai contoh, umumnya sepakat bahwa entitas kimia baru lebih


membutuhkan penelitian dari pada yang disebut obat "aku juga". Hal ini karena
kurangnya pengalaman dengan obat terkait dengan pembuatan obat mungkin
lebih bahwa obat baru memiliki efek penting yang tak terduga.

Profil keamanan dari kelas obat juga sangat penting untuk melakukan keputusan
tentang apakah untuk melakukan pengamatan penelitian penyaringan untuk obat
baru. Sebelumnya pengalaman dengan obat lain di kelas yang sama dapat
menjadi prediksi yang berguna tentang pengalaman dengan obat baru itu
mungkin bisa terjadi.

Relatif aman dari obat dalam berbagai kelas juga dapat membantu. Sebuah obat
yang telah menjadi penelitian dalam jumlah besar ke pasien sebelum pemasaran
dan tampak relatif aman untuk obat lain dalam kelasnya kurang membutuhkan
penelitian pengawasan tambahanpostmarketing.

Formulasi obat dapat dianggap sebagai penentu kebutuhan untuk studi skrining
pharmacoepidemiology secara formal. Sebuah obat yang akan, karena
penyusunannya, digunakan terutama di lembaga-lembaga, di mana ada
pengawasan yang ketat, mungkin kurang membutuhkan penelitian tersebut.
Ketika obat yang digunakan dengan kondisi ini, efek samping yang serius
kemungkinan akan terdeteksi, bahkan tanpa penelitian secara formal.

Penyakit yang diobati merupakan faktor penentu penting apakah obat


membutuhkan studi penyaringan pascamarketing tambahan. Obat yang
digunakan untuk mengobati penyakit kronis kemungkinan akan digunakan
untuk jangka waktu yang panjang. Dengan demikian, penting untuk mengetahui
efek jangka panjang dari obat tersebu. Hal ini tidak dapat diatasi secara
memadai dalam waktu yang relatif singkat yang tersedia untuk setiap studi
premarketing. Juga, obat yang digunakan untuk mengobati penyakit umum yang
penting untuk penelitian, karena banyak pasien kemungkinan akan
menggunakan obat ini. Obat yang digunakan untuk mengobati penyakit ringan
atau individu yang terbatas juga perlu studi yang cermat, karena toksisitas serius
kurang dapat diterima. Hal ini terutama berlaku untuk obat yang digunakan oleh
orang yang sehat, seperti kontrasepsi. Di sisi lain, ketika seseorang
menggunakan obat untuk mengobati orang yang sangat sakit, satu dari lebih
kemungkinan terhadap keracunan, dengan asumsi obat ini berkhasiat.

Akhirnya, hal ini juga penting untuk mengetahui apakah terapi alternatif yang
tersedia. Jika obat baru tidak memenuhi kemajuan utama terapi, karena akan
digunakan untuk mengobati pasien yang akan dirawat dengan obat lama, salah
satu kebutuhan untuk lebih yakin dari kelebihan dan kekurangan yang relatif.
Adanya efek samping yang signifikan, atau tidak adanya efek menguntungkan,
cenderung kurang ditoleransi untuk obat yang tidak mewakili kemajuan utama
terapi.

Keselamatan Versus Resiko


Farmasi klinis digunakan untuk berpikir tentang "keselamatan" obat: standar
hukum yang harus dipenuhi sebelum obat disetujui untuk pemasaran di Amerika
Serikat adalah bahwa hal itu perlu dibuktikan Ini "aman dan efektif dalam
kondisi penggunaan yang dimaksudkan." ini penting, namun, untuk
membedakan keamanan dari risiko.Hampir tidak ada obat yang tanpa risiko.
Bahkan tinggal di tempat tidur dikaitkan dengan risiko tertular luka tidur! Tentu
saja tidak ada obat yang benar-benar aman. Namun, disayangkan persepsi
publik tetap mengatakan bahwa sebagian besar obat berada dan harus tanpa
resiko sama sekali. Penggunaan obat "aman", namun, masih membawa
beberapa risiko. Akan lebih baik untuk berpikir dalam hal derajat
keselamatan.Secara khusus, sebuah obat "aman jika risiko yang dinilai
diterima."Mengukur risiko obat seseorang tapi pengejaran probabilistik. Sebuah
penilaian tentang keselamatan seseorang adalah penilaian pribadi dan / atau
sosial tentang penerimaan risiko itu. Dengan demikian, menilai keselamatan
membutuhkan dua jenis yang sangat berbeda dari aktivitas: mengukur risiko dan
menilai akseptabilitas risiko tersebut. Yang pertama adalah pembentukan fokus
dari banyak pharmacoepidemiology dan sebagian besar dari buku ini. Yang
terakhir adalah fokus dari pembahasan berikut.

Toleransi Resiko

Baik atau tidak untuk melakukan studi pengawasan pharmacoepidemiology


postmarketing juga tergantung pada satu kerelaan mentolerir risiko. Dari sudut
pandang produsen, seseorang dapat mempertimbangkan risiko ini dalam hal
masalah risiko peraturan atau hukum yang potensial yang mungkin terjadi.
Perspektif seseorang merupakan dari produsen, regulator, akademisi, atau
dokter, salah satu kebutuhan untuk mempertimbangkan risiko efek samping
yang satu ini bersedia menerima sebagai toleransi.Ada beberapa faktor yang
dapat mempengaruhi kesediaan seseorang untuk mentolerir risiko efek samping
dari obat-obatan (lihat Tabel 5.2). Beberapa faktor tersebut terkait dengan hasil
buruk pengamatan Terkait dengan paparan dan pengaturan di mana hasil yang
merugikan terjadi.

Tabel 5.2. Faktor-faktor yang mempengaruhi penerimaan terhadap risiko

Ciri-ciri hasil yang merugikan

Keparahan

Reversibilitas

Frekuensi

“Penyakit ketakutan”

Segara VS tertunda

Terjadi pada semua orang VS hanya pada orang yang sensitif

Dikenal dengan pasti atau tidak

Karakteristik paparan

Esensial terhadap pilihan

Hadir VS absen

Alternative tersedia

Resiko diasumsikan secara sukarela

Penggunaan obat yang tepat VS penyalahgunaan obat

pendapat para evaluasi

Keistimewaan Hasil Samping

Tingkat keparahan dan reversibilitas reaksi merugikan yang dimaksud adalah


sangat penting untuk tolerabilitasnya. Reaksi yang merugikan yang parah jauh
lebih ditoleransi dari satu yang ringan, bahkan pada kejadian yang sama. Hal ini
terutama berlaku untuk efek samping yang mengakibatkan cedera permanen,
misalnyalahir dengan cacat.

Faktor lain yang penting yang mempengaruhi tolerabilitas hasil yang merugikan
adalah frekuensi hasil yang merugikan pada mereka yang terkena. Khususnya,
ini bukan pertanyaan tentang risiko relatif penyakit akibat paparan, tapi
pertanyaan dari kelebihan risiko ( lihat Chapter 2). Penggunaan tampon yang
luar biasa sangat terkait dengan syok toksik: risiko relatif tampaknya antara 10
dan 20. Namun, toxic shock cukup jarang, yang bahkan 10 sampai peningkatan
20 kali lipat dalam risiko penyakit masih memberikan kontribusi yang luar biasa
resiko kecil sindrom syok toksik pada mereka yang menggunakan tampon.

Selain itu, penyakit tertentu yang disebabkan oleh obat ini penting untuk
toleransi salah satu dari risiko. penyakit tertentu dianggap oleh masyarakat yang
akan disebut "penyakit ketakutan," penyakit yang menghasilkan lebih banyak
rasa takut dan emosi daripada penyakit lainnya. Contohnya adalah AIDS dan
kanker. Hal ini mungkin kurang terjadi risiko obat yang akan dianggap diterima
jika hal itu menyebabkan salah satu dari penyakit.

Faktor lain yang relevan yakni hasil yang merugikan adalah segera atau ditunda.
Kebanyakan orang kurang peduli tentang risiko tertunda dari risiko langsung.
Ini merupakan salah satu faktor yang mungkin telah memperlambat
keberhasilan upaya anti-merokok. Pada bagian ini adalah fungsi dari penolakan;
risiko tertunda tampak seolah-olah mereka tidak pernah terjadi. Selain itu,
konsep ekonomi "Diskon" memainkan peran di sini. Peristiwa yang merugikan
di masa depan kurang buruk dari peristiwa yang sama hari ini, dan efek yang
menguntungkan hari ini lebih baik daripada efek menguntungkan yang sama di
masa depan. Sesuatu yang lain dapat terjadi antara sekarang maupun kemudian
hari, hal relevan yang bisa membuat efek tertunda atau, setidaknya, mengurangi
dampaknya. Dengan demikian, peristiwa yang menumbulkan kerugian tertunda
mungkin layak jika dapat membawa efek menguntungkan hari ini.

Hal ini juga penting yakni hasil yang merugikan adalah raeksi Tipe A atau
reaksi Tipe B. Seperti dijelaskan dalam BAB 1, Tipe A reaksi adalah hasil dari
efek farmakologi berlebihan dari efek farmakologi biasanya obat . Tipe A reaksi
cenderung umum, tetapi terkait dengan dosis, dapat diprediksi, dan kurang
serius. Sebaliknya, reaksi tipe B adalah efek menyimpang dari obat. Reaksi Tipe
B cenderung jarang, tidak berhubungan dengan dosis, dan berpotensi lebih
serius. Tipe B mungkin karena reaksi hipersensitivitas, reaksi imunologi, atau
reaksi idiosinkratik lain untuk obat. Apapun, reaksi tipe B adalah lebih sulit
untuk memprediksi atau bahkan mendeteksi. Jika seseorang dapat memprediksi
efek buruk, maka salah satu dapat mencoba untuk mencegah hal itu. Misalnya,
untuk mencegah aritmia aminofilin-diinduksi dan kejang, kita dapat mulai terapi
pada dosis yang lebih rendah dan ikuti kadar serum dengan hati-hati. Untuk
alasan ini, semua hal lain dianggap sama, reaksi Tipe B biasanya dianggap
kurang ditoleransi.

Akhirnya, penerimaan risiko juga bervariasi sesuai dengan seberapa banyak


mempunyai efek. efek buruk yang sama jelas kurang ditoleransi jika ada yang
tahu dengan pasti bahwa hal itu disebabkan oleh obat daripada hanya
kemungkinan kecil.

KARAKTERISTIK DARI EKSPOSUR (PAPARAN)

Penerimaan terhadap sebuah risiko sangat berbeda, tergantung pada apakah


paparan itu penting atau opsional. Efek samping utama jauh lebih diterima
ketika seseorang menggunakan terapi yang dapat menjaga atau memperpanjang
hidup, seperti kemoterapi untuk penyakit yang ganas (kanker). Di sisi lain,
terapi untuk keterbatasan diri sebuah penyakit harus memiliki risiko rendah
untuk dapat diterima. produk farmasi dimaksudkan untuk digunakan pada orang
yang sehat, seperti vaksin dan alat kontrasepsi, harus sangat rendah risikonya
denganpertimbangan yang dapat diterima.

Penerimaanterhadap sebuah risiko juga bergantung pada apakah risiko berasal


dari ada atau tidaknya sebuahpengobatan. Salah satunya dapat
mengkonsepsikan kematian dari penyakit yang dapat diobati dengan obat yang
belum ada di pasaran sebagai efek samping dari tidak adanya pengobatan.
Misalnya, enam tahunketerlambatan dalam memperkenalkan β-blocker ke pasar
AS telah disalahkan karena mengakibatkan lebih banyak kematian daripada
semua reaksi obat yang merugikan (efek samping) kombinasi terbaru.16Sebagai
masyarakat, kita jauh lebih bersedia untuk menerima risiko semacam ini
daripada risiko dari penggunaan obat yang telah dipasarkan lebih awal.
Physicians (dokter) diajarkan primum non nocere (pertama dilakukan tidak
membahayakan). Ini adalah beberapa, apakah analog dengan kesediaan kita
memungkinkan pasien dengan penyakit terminal untuk mati dari penyakit ini
tanpa intervensi (campur tangan), sementara itu akan dianggap tidak etis dan
mungkin ilegal untuk melakukan euthanasia (mati ringan). Secara umum, kita
jauh lebih toleran terhadap dosa-dosa kelalaian dari pada dosa jabatan/tugas.

Apakah ada pengobatan alternatif yang tersedia sebagai penentu lain dari
penerimaan sebuah risiko. Jika obat adalah satu-satunya pengobatan yang
tersedia bagi penyakit, terutama penyakit serius, maka risiko lebih besar akan
dianggap diterima. Ini adalah alasan zidovudine diizinkan untuk dipasarkan
untuk pengobatan AIDS, meskipun toksisitas dan uji yangtelah dilakukan
terbatas.4 sekilas/sejalan, studi toxic shock syndrome yang terkait dengan
penggunaan tampon yang penting untuk kesehatan masyarakat, meskipun
penyakitnya jarang, karena konsumen bisa memilih di antara tampon lain yang
tersedia terbukti membawa berbagai risiko. 15
Apakah risiko diasumsikan dengan sukarela ini juga penting untuk
penerimaannya. Kami bersedia untuk menerima risiko kematian dalam
kecelakaan mobil yang risikonyajauh lebih kecil dari pada kematian dalam
kecelakaan pesawat, karena kita mengendalikan dan memahami bekas (kejadian
sebelumnya) dan menerima risiko para korban secara sukarela. Beberapa orang
bahkan menerima risiko besar kematian akibat penyakit terkait tembakau, tetapi
akan sangat keberatan untuk diberi obat yang sebagian kecil sebagai racun.
Secara umum, disepakati bahwa pasien harus dibuat sadar efek yang mungkin
beracun dari obat yang diresepkan. Ketika risiko lebih tinggi daripada
penggunaan terapi obat biasa, seperti dengan prosedur invasif atau penelitian
obat, salah satu biasanya meminta persetujuan pasien setelah mendapat
penjelasan formal. Fakta bahwa janin tidak bisa sukarela/sengaja membuat
pilihan tentang apakah iya atau tidak untuk mengambil obat sebagai kontribusi
terhadap tidak diterimanyakelahiran yangcacat akibat obat.

Akhirnya, dari perspektif sosial, kita juga perlu khawatir tentang apakah obat
akan digunakan seperti yang dimaksudkan atau apakah mungkin
disalahgunakan. Penyalahgunaan, dari dalam dirinya sendiri, dapat merupakan
risiko dari obat. Misalnya, obat dianggap kurang diterima jika itu adalah adiktif
, jadi ada kemungkinan untuk disalahgunakan. Selain itu, kemungkinan resep
atau dosis berlebih oleh dokter juga dapat menurunkan dapat terimanya sebuah
obat. Misalnya, dalam kontroversi tentang lahir cacat akibat isotretinoin, tidak
ada pernyataan bahwa obat adalah teratogen kuat, bahwa itu adalah terapi yang
sangat efektif untuk kista acne refraktori serius dan untuk perawatan lainnya.
Juga tidak ada pernyataan tentang efektivitas selama kurang parah.

KAPAN SEBAIKNYA MELAKUKAN SUATU KINERJA STUDI


Pharmacoepidemiology?
Tabel 5.3. risiko kematian tahunan dari beberapa bahaya yang dipilih *

Bahaya Tingkat kematian


tahunan
(per100 000 orang
terkena)

Penyakit jantung (US, 1985) 261,4


Olahraga terjun payung 190
Kanker (US, 1985) 170,5
Merokok (usia 35) 167
Gantung diri (UK) 150
Sepeda motor (AS) 100
Balap perahulistrik (US) 80
Penyakit serebrovaskular(US, 1985) 51,0
Scuba menyelam (US) 42
Scuba menyelam (UK) 22
Influenza (UK) 20
Penumpang kendaraanbermotor 16,7
(US)
Bunuh diri (US, 1985) 11,2
Pembunuhan (US, 1985) 7,5
Eksplorasi gua (AS) 4,5
Penggunakontrasepsi oral (Usia 25- 4,3
34)
Pejalan kaki (AS) 3,8
Bersepeda (AS) 1,1
Puting beliung (AS) 0,2
Petir (AS) 0,05
* Data yang berasal dari referensi 18-20.

acne. Namun, efektivitas yang mengakibatkan digunakan secara luas, termasuk


pada individu yang bisa diobati dengan terapi kurang beracun, dan sejumlah
besar eksposur kehamilan, aborsi, dan cacat lahir daripada yang akan terjadi. 17

PERSEPSI EVALUASI

Akhirnya, banyak tergantung pada persepsi dari individu-individu yang


membuat keputusan tentang apakah risiko dapat diterima. Di AS, telah ada lebih
dari satu juta kematian akibat kecelakaan lalu lintas selama 30 tahun terakhir;
penyakit terkait tembakau yang membunuh setara dengan tiga muatan pesawat
jet setiap hari; dan 3000 anak yang lahir setiap tahun dengan embriopati dari
alkohol yang digunakan ibu mereka dalam kandungan.18 Namun, kematian ini
diterima dengan sedikit perhatian, sementara risiko yang jarang seperti
kecelakaan pesawat atau disambar petir menghasilkan rasa ketakutan.
Keputusan tentang apakah perizinanisotretinoin untuk tetap di pasaran
bergantung pada kemanjuran obat untuk sejumlah kecil orang yang memiliki
penyakit yang tidak disebutkan tetapi tidak mengancam jiwa kelahiran yang
layak (lahir normal) oleh beberapa individu yang lainnya.Tidak ada cara untuk
menghapus komponen subjektif dari keputusan tentang penerimaan risiko.
Memang, penelitian lebih banyak diperlukan untuk menjelaskan preferensi
pasien dalam hal ini. Namun, komponen subjektif adalah bagian dari apa yang
diinformasikan dan dibuat kesepakatan yang sangat penting. Kebanyakan orang
merasa bahwa penilaian subjektif adalah akhir tentang apakah seorang individu
menanggung risiko harus meminum obat yang dilakukan oleh individu itu,
setelah mendapatkan pengarahan dari dokter mereka. Namun, sebagai upaya
untuk membantu penilaian bahwa, hal ini berguna untuk memiliki beberapa
informasi kuantitatif tentang risiko yang melekat dalam beberapa kegiatan
lainnya. Beberapa informasi tersebut disajikan pada Tabel 5.3.

KESIMPULAN

Bab ini adalah ulasan dalam studi pharmacoepidemiology jika harus dilakukan.
Setelah dimulai dengan diskusi tentang berbagai alasan mengapa seseorang
mungkin melakukan studi pharmacoepidemiology, ditinjau dari perbedaan
antara keselamatan dan risiko. Hal Ini disimpulkan dengan diskusi tentang
faktor-faktor penentu toleransi seseorang dari risiko. Saat ini diharapkan dengan
jelas bahwa ketika salah satu mungkin ingin melakukan penelitian
pharmacoepidemiology, bagian selanjutnya dari buku ini akan memberikan
perspektif tentang pharmacoepidemiology dari beberapa bidang berbeda yang
menggunakannya.

Part II

PERSPECTIVES ON PHARMACOEPIDEMIOLOGY

Pandangan Dari Akademik

PENGANTAR
Bidang farmakoepidemiologi memberikan tantangan kepada komunitas
akademis tradisional. Hal ini dapat dilihat sebagai salah satu unsur dari
kelompok disiplin ilmu yang diperlukan untuk memahamibagaimana pemberian
diagnosis dan tekonologi terapeutik dengan cara yang mengoptimalkan bidang
kesehatan yang mungkin lebih luas disebut "terapi". Berbagai kekuatan terus
mendorong isu-isu risiko dan manfaat dari terapi ke dalam kesadaran publik,
sementara akademik kedokteran mengalami kesulitan menerima bahwa disiplin
harus menjadi fokus utama. Keengganan ini untuk merangkul studi terapi
sebagai prioritas relatif terhadap ilmu-ilmu yang lebih mendasar adalah salah
satu unsur sikap yang agak narsis yang diambil oleh pusat kesehatan akademik
(AMCs) yang telah memberikan kontribusi terhadap reaksi tentang ukuran
investasi publik diminta untuk mendukung penelitian dilakukan dalam dunia
akademis.

Namun, akademisi sepenuhnya mampu menciptakan pendekatan baru yang


dapat memberikan dasar untuk disiplin terapi. Pusat Pendidikan dan Penelitian
Terapeutik (CERT) organisasi merupakan salah satu upaya untuk mengubah

dinamika ini dengan menciptakan sebuah konsorsium dari pusat akademik


terkait dengan beberapa pemerintah dan lembaga swasta dengan visi melayani
sebagai sumber daya nasional yang terpercaya bagi orang-orang yang mencari
peningkatan kesehatan melalui penggunaan terbaik dari terapi medis. Program
ini, yang dimandatkan oleh otorisasi untuk FDA, menyatukan AMCs, instansi
pemerintah, industri produk medis, dan pendukung konsumen dengan dana inti
melalui Badan Penelitian dan Kualitas (AHRQ) Kesehatan dan menawarkan
kesempatan untuk bergabung pemerintah dengan dana pribadi untuk memenuhi
misi. Dengan misi dari CERT adalah untuk melakukan penelitian dan
memberikan pendidikan yang akan memajukan penggunaan optimal dari obat-
obatan, peralatan medis, dan produk biologis. Misi ini dicapai melalui kegiatan
yang mengembangkan pengetahuan tentang terapi dan bagaimana cara terbaik
untuk menggunakannya, mengelola risiko dengan meningkatkan kemampuan
untuk mengukur baik efek menguntungkan dan merugikan dari terapi yang
digunakan dalam praktek, meningkatkan praktek dengan memajukan strategi
untuk memastikan bahwa terapi yang digunakan selalu dan hanya ketika mereka
membutuhkan, dan menginformasikan pembuat kebijakan tentang keadaan ilmu
pengetahuan klinis dan efek dari kebijakan saat ini dan yang diusulkan. Upaya
multicenter ini setidaknya sebagian berhasil dalam membawa
farmakoepideimiologi dan studi terapi pada umumnya, kembali ke dalam fokus
utama akademikkedokteran, dan memberikan wawasan pendekatan tambahan
yang diperlukan. kesehatan masyarakat, ekonomi, dan pendidikan yang akan
mengurangi penyebab epidemi kematian dini. Perubahan ini akan sangat
meningkatkan pentingnya terapi medis untuk mencegah, menunda, mengobati,
dan meringankan penyakit kronis. Dua masalah baru di tempat kejadian,
obesitas di kalangan mudadan terorisme menggunakan senjatabiologis, hanya
meningkatkan pentingnya pengetahuan terapi dan infrastruktur akademik dalam
menyediakan tenaga kerja yang kompeten dan kreatif.

Perubahan demografi kesehatan dan masyarakat ini terjadi pada saat revolusi
dalam pengetahuan biologi yang mengarah ke kemungkinan terapi sebelumnya
tak terpikirkan. Investasi penelitian gabungan dari pemerintah AS dan industri
produk medis (obat, biologis, dan

Tabel 6.1 Tren masyarakat dan kesenjangan yang tumbuh antara potensi dan
realitas terapi.

(1) Meningkatkan beban penyakit

(A) Penuaan dari populasi- yang "baby boomers"

(B) kegemukan dari generasi muda yang mengarah ke penyakit kronis awal
(2) Mempercepat ketersediaan teknologi

(A) investasi NIH dalam biologi

(B) Olah gambar / Insinyur

(3) keterbatasan Keuangan

(A) Persaingan aparat pemerintah dan pembayar menahan diri dan


"konsumerisme"

(B) Memperluas pemahaman tentang prinsip-prinsip terapi

ISU DIDORONG OLEH KEBERHASILAN

Sebelum meluncurkan ke dalam mode "pemecahan masalah", kita harus


mengakui manfaat luar biasa yang telahdirasakan dari terapi. Orang hidup lebih
lama dengan sedikit cacat daripada sebelumnya. Sedangkan sebagian
keuntungan sebelumnya berasal dari tindakan kesehatan masyarakat luas, suatu
porsi peningkatan keuntungan harapan hidup bebas cacat yang berasal dari
perawatan medis. Oleh karena itu, akan tidak benar apabila menyiratkan bahwa
sistem adalah bencana. Sebaliknya, pandangan kami adalah bahwa kami
membuat kemajuan dalam terapi yang dapat dipercepat dengan perencanaan dan
integrasi dari disiplin terapi klinis yang lebih baik dan yang dapat ditingkatkan
dengan mempertimbangkan AMCs menjadi sebuah penghalang mendasar dari
sistem ini.

Dasar suatu kesenjangan yang tumbuh antara potensi dan realitas terapi adalah
pertemuan beberapa tren masyarakat. Amerika Serikat dan negara-negara maju
lainnya mengalami perubahan dramatis dalam demografi, dengan peningkatan
besar dalam proporsi penduduk yang akan berusia lanjut. Pada saat yang sama,
di negara-negara berkembang, kemajuan sedang dibuat dalam melembagakan

perangkat) sekarang melebihi 60 milyar dollar per tahun. Penyakit yang paling
umum memiliki satu atau lebih terapiefektif yang telah diketahui, dan banyak
penyakit yang sangat umum seperti penyakit jantung dan kanker memiliki
beberapa terapi yang efektif. Pengetahuan tentang tubuh dan masing-masing
terapi dari setiap bagiannyaberkembang sangat cepat, sementara kemampuan
kita tetap untuk berkembang.

Evolusi berkelanjutan dari komputasi telah memungkinkan


pharmacoepidemiology khususnya untuk mengambil peran yang lebih
menonjol. Hampir sehari lewat tanpa publikasi atau berita tentang analisis
sekunder dari satu set data yang menunjukkan hubungan antara terapi dan hasil.
Alasannya adalah bahwa transaksi perawatan kesehatan semakin sering
dipublikasikan, baik secara langsung atau dengan pengumpulan data klaim dan
data set, ini dapat dimanipulasi oleh peningkatan penggunaan dan lembaga
statistik semakin kuat. Kemajuan teknologi ini juga cepat membuka komunikasi
lintas budaya, sehingga mendorong kolaborasi antar-nasional seperti
dicontohkan oleh International Society for Pharmacoepidemiology (ISPE)
(www. pharmacoepi.org).

Semua tren ini positif, namun mereka mengangkat satu set masalah baruyang
harus diatasi, setidaknya sebagian melalui upaya AMCs.
Sebagaimanateknologipotensial terus berkembang dan ketidakmampuan kita
untuk menyediakan sarana teknologi untuk semua orang semakin jelas, kita
hanya perlu pengetahuan yang lebih baik tentang bagaimana untuk secara
efektif menerapkan teknologi, termasuk perangkat diagnostik, obat, biologis,
dan alat terapi, untuk pasien yang tepat di waktu yang tepat.
PENGETAHUAN DASAR YANG TIDAK MEMADAI

Ada kesenjangan besar dan berkembang antara potensi terapi untuk


menyembuhkan penyakit manusia dan basis aktual pengetahuan kita.
kesenjangan ini tidak berasal dari kurangnya kemajuan dalam studi terapi.
Sebaliknya, masalah ini telah berkembang karena laju pembangunan teknologi
relatif berkembang terhadap kemampuan kita untuk menguji dan
mengevaluasinya.

Obat-obatan dan alat-alat masih dikembangkan dalam studi yang relatif kecil
dalam kurun waktu terbatas, sering tanpa mengukur hasil kesehatan sebagai titik
akhir dan hampir selalu tanpa langkah-langkah yang memerlukan biaya.
Sebaliknya, kita mengandalkan biomarker, pengganti, atau bagian evaluasi
efikasi untuk persetujuan peraturan, dalam kombinasi dengan data keamanan
yang terbatas dari studi jangka pendek. Studi-studi ini biasanya juga termasuk
jumlah pasien yang akhirnya akan menerima terapi ini. Pasien yang
dikecualikan cenderung orang tua dan kaum minoritas, biasanya dengan tingkat
penyakit penyerta yang tinggi, disfungsi terutama ginjal atau penyakit kronis
lanjut. Hasilnya adalah bahwa banyak obatyang telah dipasarkan namun dengan
dokumentasi yang tidak lengkap dari penggunaan obat berisiko tinggipada
populasi.

Sejauh ini pengetahuan dasar yang tidak memadai ini mungkin yang paling
mencolok di arena pediatri. Sebelum UU Pediatric Penelitian Ekuitas tahun
2003, istilah "anak yatim terapi" adalah istilah yang tepat untuk
menggambarkan anak-anak; itu telah diterima bahwa anak-anak tidak bisa
dipelajari dalam uji klinis karena kesulitan dengan memastikan persetujuan.
Namun, karena lembaga ekstensi paten untuk studi senyawa yang sudah di
pasarkan dan kebutuhan untuk studi perkembangan obat jika mereka akan
digunakan pada anak-anak, uji klinis terapi pada anak-anak telah tumbuh dan
berkembang. Baru-baru ini, mandat Kongres telah menyebabkan upaya bersama
untuk mengevaluasi obat lama yang tidak lagi paten, namun yang sering
digunakan pada anak-anak. Upaya ini benar-benar tergantung pada konsorsium
program pediatri akademik yang didanai oleh National Institute of Child Health
and Human Development (NICHD).

Dalam kasus lain, pengetahuan mendasar tentang masalah umum untuk


beberapa terapi kurang atau terbatas. Dampak obat-obatan pada risiko torsade
de pointes, seperti aritmia jantung yang kadang-kadang mematikan, adalah
contoh terbaik. Sementara penemuaan atau riset yang telah dilakukan atas dasar
genetik dan biologis untuk perpanjangan QT, apalagi yang diketahui tentang
pengambilan keputusan medis yang tepat dalam pemilihan obat diketahui
menyebabkan perpanjangan interval QT. Survei terbaru dari dokter telah
menemukan bahwa pengetahuan praktisi tentang rincian masalah ini sedikit.
Bahkan obat yang telah digunakan selama bertahun-tahun sering tidak
mengalami evaluasi yang memadai. Katchman dan rekan baru-baru ini
menggambarkan bahwa metadon menyebabkan perpanjangan interval QT dan
kematian mendadak. Jenis penyelidikan tidak mungkin dilakukan hanya oleh
industri dan akan membutuhkan kerjasama dengan institusi akademik.

Perangkat yang disetujui untuk pemasaran dengan standar yang berbeda dari
obat (lihat juga Bab 31). Seringkali tidak ada percobaan acak yang pernah
dilakukan. Alasan untuk kumpulan peraturan yang berbeda ini berasal dari
siklus pendek pada pemakaian perangkat (sering diukur dalam bulan) dan sifat
berulang pengembangan perangkat. The miokard Laser teknologi
revaskularisasi telah memberikan contoh untuk studi. Dikembangkan untuk
meringankan angina pada pasien refrakter terhadap standar terapi medis dan
perangkat, Transmyocardial Laser Revaskularisasi (TMR) awalnya disetujui
untuk digunakan manusia berdasarkan serangkaian studi observasional
menggunakan kontrol historis dan tanpa menyilaukan. Ketersediaan Masyarakat
database Thoracic Surgeons memungkinkan penggunaan TMR untuk dilacak.
Pada awal adopsi, itu mengejutkan yang paling sering digunakan off-label, dan
sering pada pasien dengan kontraindikasi diberi label dengan tingkat angka
kematian yang jauh lebih tinggi dari perkiraan. Fokus selanjutnya tentang
masalah ini telah menyebabkan penggunaan perangkat yang lebih rasional, dan
uji klinis baru menunjukkan peran yang tepat dari kedua TMR dan
revaskularisasi miokard perkutan (PMR).

Contoh lain yang sangat baik adalah di bidang terapi gout. Sebagian pengobatan
yang efektif untuk gout akut dan profilaksis untuk gout kronis dikembangkan
beberapa dekade yang lalu. Sayangnya, obat baru belum dipasarkan, dan obat
lama tidak pernah dilakukan studi yang menghasilkan data untuk penentuan
dosis dan pendekatan yang tepat untuk digunakan dalam populasi yang
beragam. Dengan demikian, konsorsium akademisi dan anggota masyarakat
profesional telah mengembangkan seperangkat pedoman praktek klinis untuk
gout didasarkan pada data yang sangat sedikit yang tersedia.

Dua proyek belakangan menggarisbawahi pentingnya sumber daya gabungan


dari organisasi profesional dan AMCs dalam memecahkan masalah utama
dalam terapi.

PRAKTEK SUBOPTIMAL

Celah antara praktek pemberian perawatan kesehatan dan pengetahuan dasar


harus berpedoman pada praktik yang lebih banyak.Dalam pencegahan awal dan
penyakit yang standar perawatan telah berevolusi, demonstrasi dari tingkatan
sempurna dari konsistensisampai kepraktek yang standar.celah ini telah
dibuktikan dengan baik di rumah sakit, di mana pengambilan keputusan
sebagian besar sampai melibatkan rawat. Perkembangan data dari pengaturan
rawat jalan, tidak mengherankan, menunjukkan celah ini lebih
besar.Kompleksitas transaksi terapi rawat jalan didorong oleh beberapa faktor,
yang paling menonjol tindakan pasien dalam mengikuti rekomendasi
dariapoteker.

CERT di universitas Alabama telah difokuskan pada praktek-praktek yang tidak


memadai di bidang penyakit pada tulang dan sendi. Secara khusus, ia telah
menunjukkan bahwa orang yang melakukan praktek sering jatuh dalam hal
pengobatan osteoporosis pada semua pasien dan pada pasien yang diobati
dengan glukokortikoid, dan bahwa racial yang signifikan dan perbedaan terkait
khusus ada dalam penggunaan coxib untuk arthritis. penelitiandari praktek
variasi telah menyebabkan upaya kolaboratif besar untuk mengembangkan
pedoman dan indikator kualitas di rheumatology.

Isu penggunaan antibiotik pada anak-anak yang dicurigai media otitis


memberikan contoh menarik lain dari praktek klinis yang tidak memadai. Ada
pandangan luas bahwa antibiotik yang tidak perlu sering diresepkan untuk anak-
anak yang diduga otitis media, dan bahwa ini hasil masalah berlebihan dalam
peningkatan resistensi antibiotik di samping peningkatan dalam pembiayaan.
Studi Penelitian di Jaringan HMO.

telah mendokumentasikan bahwa penggunaan antibiotik menurun, tapi itu jauh


lebih banyak pekerjaan yang harus dilakukan tentang hal isu ini.Dalam sebuah
uji coba secara acak telah menunjukkan manfaat dari penjangkauan pendidikan
dalam mengubah perilaku ini, dan studi di CERT di Universitas Pennsylvania
telah menunjukkan perhatian antara keinginan orang yang praktek untuk
meningkatkan hasil sosial dan kewajiban mereka untuk pasien.dengan
menggabungkan analisis dan keterampilan kuantitatif di pusat-pusat akademik
dan keinginan yang luas dari orang yang praktek untuk meningkatkan, terutama
dalam pengaturan perawatan yang dikelola, kita melihat peningkatan nasional
dalam praktek.

Masalah lain terapi penting adalah penggunaan suboptimal terapi untuk


penyakit arteri koroner (CAD) dan gagal jantung. Baik dalam manifestasi akut
dan kronis gagal jantung dan CAD, sejumlah terapi menguntungkan terbukti
tersedia, namun mereka sering tidak digunakan ketika ditunjukkan atau
diterapkan dalam perilaku yang salah dengan Studi patsien. Salah satu dalam
sistem Tennessee Medicaid, Penelitian Jaringan HMO dan Carolina Utara telah
semua menemukan masalah dasar yang sama. Perbedaan-perbedaan ini telah
diperkuat oleh studi multikultural menunjukkan tidak hanya perbedaan dalam
penggunaan obat pencegahan sekunder, tetapi juga perbedaan hasil, termasuk
masalah yang berkaitan dengan akses ke therapies.Seringkali, kurangnya
pengetahuan menyebabkan obat yang efektif tidak sedang diresepkan . Dalam
kasus lain, dokter tidak setuju dengan indikasi, meskipun ini bukan faktor utama
penghambat penggunaan optimal dari terapi. Data terbaru dari Tennessee
menunjukkan bahwa obat yang tepat diresepkan di RS, 15% pasien tidak
mengisi prescriptions.Sebuah analisis baru-baru ini menunjukkan bahwa
mekanisme saat memberikan disinsentif ekonomi utama untuk fokus pada
mengikuti terhadap terapi yang menyelamatkan nyawa dalam kegagalan hati
pasien.

KEBIJAKAN KONTRAPRODUKTIF ATAU TIDAK PRODUKTIF


Pada saat dana awal dari CERT, banyak kebijakan kontraproduktif yang
berkaitan dengan terapi bisa dikutip. Kasus prototipikal adalah upaya sementara
di negara bagian New Hampshire untuk membatasi penggunaan obat resep
dalam program negara Medicaid.Hasilnya adalah bahwa departemen darurat di
negara bagian kewalahan dengan kunjungan akut dari orang-orang yang
penyakit kronis telah menjadi tidak terkendali karena kurangnya akses ke
narkoba.

Beberapa contoh telah menjadi topik penelitian utama CERT. Kelompok di


University of Pennsylvania mengevaluasi peran Ulasan pemanfaatan
prescribing (lihat juga Bab 29). Menggunakan teknik epidemiologi canggih,
mereka tidak dapat menemukan manfaat dari

Pendekatan negara Medicaid berkaitan dengan kesalahan pemberian resep atau


rawat inap dihindari. Para peneliti percaya bahwa prinsip-prinsip struktural dan
fungsional mungkin menjelaskan kesia-siaan dari program ini secara luas
diterapkan: rendahnya tingkat peringatan, kurangnya hubungan antara tanda,
alasan yang kompleks bahwa obat yang diresepkan, dan waktu yang tertinggal
antara resep dan ulasan Kemampuan beberapa pusat akademik untuk
berkolaborasi pada penilaian bukti tersebut cenderung mengarah pada perbaikan
lebih lanjut dalam saran untuk pembuat kebijakan

Kelompok di Vanderbilt University mengevaluasi dampak beralih ke


spesialisasi sepenuhnya capitated "mengukir" program layanan kesehatan
mental di negara bagian Tennessee. peneliti ini mencatat bahwa pada pasien
antipsikotik ada kerugian yang jelas kontinuitas dalam transisi. Selanjutnya,
pasien membutuhkan obat antipsikotik kurang mungkin untuk membawa
mereka, sebuah fenomena yang paling menonjol pada pasien paling sakit.
Masalah serupa telah dijelaskan oleh group Harvard

PERAN AKADEMIK MEDIS PUSAT

Sementara AMCs mungkin hanya salah satu dari banyak entitas di arena terapi,
semua dokter, apoteker, dan dokter gigi dilatih di AMCs, seperti sebagian besar
perawat.Oleh karena itu, dalam jangka panjang, AMCs memiliki kesempatan
dan tanggung jawab untuk menyediakan basal nasional Infrastruktur-ture bagi
para praktisi terapi.AMCs juga menyediakan rumah bagi mayoritas dokter yang
mempengaruhi sumber-sumber publik dari informasi dan pendapat. Akhirnya,
AMCs menerima sebagian besar pendanaan dari US National Institutes of
Health (NIH), sumber utama pembangunan penelitian medis

MENINGKATKAN PENGETAHUAN

Sementara pengetahuan saja tidak cukup untuk memperbaiki kesenjangan antara


penelitian dan praktek, itu adalah langkah pertama yang diperlukan.Tentu saja,
upaya ini dimulai dengan pelatihan di keperawatan, farmasi, medis, gigi, dan
sekolah kesehatan masyarakat.Bahkan dengan asumsi bekerja sempurna di
"pelatihan dasar" tahun, namun, jumlah praktisi yang ada melebihi jumlah
peserta dengan margin besar.
Banyak pekerjaan dari CERT telah difokuskan pada peningkatan pengetahuan
terapi antara praktisi, tetapi AMCs tidak melakukan pekerjaan yang memadai
berkaitan dengan praktisi, meninggalkan banyak transmisi pengetahuan untuk
industri produk medis itu sendiri. Seperti yang dinyatakan oleh Stephen
Soumerai, pemimpin dalam evaluasi metode dimaksudkan untuk mengubah
resep perilaku, ketika datang untuk menerjemahkan

pengetahuan dalam praktek, "Semuanya bekerja beberapa waktu, dan tidak ada
yang berhasil sepanjang waktu."undang-undang baru di Amerika Serikat telah
memberikan kesempatan untuk mengambil kembali sebagian besar melanjutkan
pendidikan ke AMC arena. organisasi profesional, ditopang oleh peraturan
pemerintah tentang menggunakan melanjutkan pendidikan kedokteran untuk
iklan, telah menghasilkan ketat panduan-garis yang panggilan untuk kontrol
independen program yang mendidik profesional kesehatan.

MENGHIDUPKAN KEMBALI FARMAKOLOGI KLINIK

Bidang farmakologi klinis telah buruk didukung oleh sumber pendanaan


federal, dan untuk sebagian besar AMCs telah merespon dengan mengurangi
jumlah posisi fakultas.Perbandingan dana ini dan kebutuhan masyarakat dapat
diperbaiki sebagian oleh program seperti CERT. Selain itu, sebagai pentingnya
dan ruang lingkup farmakologi klinis telah diperluas, beberapa peluang
kewirausahaan kunci ada. Pusat Penelitian Klinis Umum didanai oleh NIH terus
menerima tingkat yang sangat baik dari pendanaan.Farmasi, bioteknologi, dan
industri perangkat juga merasakan tekanan dari kekurangan bakat dalam
mengembangkan pengetahuan yang dibutuhkan untuk pengembangan obat yang
sukses.Fokus pada keamanan produk medis dan keseimbangan jangka panjang
risiko dan manfaat telah menciptakan permintaan yang besar untuk keahlian
dalam industri, baik di luar fokus pada pengembangan produk. Akhirnya, fokus
masyarakat pada keselamatan pasien akan memerlukan metodologi yang
dikembangkan oleh bidang ini untuk memantau penggunaan obat-obatan dan
perangkat. upaya lebih lanjut diperlukan untuk menghubungkan AMCs dengan
kebutuhan industri dan pemerintah berkaitan dengan fase pemasaran.

MEMBUAT REPOSITORI SUMBER DATA

Semakin bekembang, bukti yang dibutuhkan untuk memandu pilihan di masing-


masing dan kebijakan tingkat akan didorong oleh analisis empiris data dari
populasi. Pada tingkat nasional, badan seperti CERT dapat memberikan
kesempatan bagi beberapa pihak untuk menjawab pertanyaan dari
database.Beberapa database yang tersedia untuk diinterogasi dengan
pertanyaan-pertanyaan spesifik tentang terapi.Namun, kekhawatiran terbaru
tentang privasi dan ukuran tipis dari database menekankan kebutuhan untuk
fasilitas dengan para ahli dalam pengelolaan data dan analisis.The CERT
merupakan salah satu pendekatan untuk ini dengan membawa bersama-sama
para ahli dari beberapa pusat akademik menjadi sebuah organisasi dengan pusat
koordinasi dituduh memfasilitasi proyek-proyek umum.

Dalam membangun ini database terus tinggal bersama pengembang mereka,


tetapi sistem yang dikembangkan untuk meningkatkan berbagi bagian dari
database untuk menjawab pertanyaan spesifik. HMO Jaringan Penelitian telah
menciptakan contoh prototipe ini pendekatan "federasi", di mana pertanyaan
dapat diminta dan sistem menyatukan unsur-unsur database dari berbagai
organisasi pemeliharaan kesehatan untuk memberikan jawaban. Masalah
privasi, penganoniman, berbagi, dan ruang lingkup data yang telah bekerja
terlebih dahulu untuk meningkatkan efisiensi proses mendapatkan akses ke data.

Pada tingkat lokal, ada kebutuhan mendesak untuk institusi sistem kesehatan
untuk mengembangkan repositori data dan keahlian lokal dalam analisis yang
tepat berkaitan dengan kualitas.AMCs memiliki keahlian untuk mengatur
misalnya dengan mengatur repositori data dan menyediakan akses ke data untuk
pur-pose meningkatkan kualitas dan mengembangkan pemahaman umum dari
strategi diagnostik dan terapeutik.Upaya ini tidak harus berhenti di tingkat
nasional, namun. Memang, akses ke UK General Practice Penelitian Database
(lihat Bab 22) telah memungkinkan beberapa pengamatan penting yang akan
dibuat relevansi langsung terhadap kesehatan global.

MENINGKATKAN PRAKTEK

Kasus untuk meningkatkan praktek adalah jelas.Namun AMCs harus


mempertanyakan mana peran mereka harus bermain.Sementara penyedia AMCs
kereta dalam keterampilan dasar mereka, provinsi praktek klinis memiliki
banyak entitas dengan agenda variabel dan kesempatan untuk menunjukkan
pendekatan yang lebih baik untuk organisasi perawatan kesehatan.perusahaan
klinis yang lebih besar ini kerdil kemampuan AMCs untuk langsung mengubah
praktek kedokteran. Dalam hal ini AMCs harus berusaha untuk meningkatkan
posisi mereka yang unik untuk memindahkan praktik nasional terhadap
pelayanan kesehatan yang berkualitas tinggi.

Pada tingkat yang paling mendasar, AMCs memiliki tanggung jawab untuk
menerapkan sumber daya ilmu pengetahuan dengan mengevaluasi terapi yang
sudah dipasarkan.Banyak yang telah ditulis tentang kurangnya insentif bagi
industri produk medis untuk mempelajari produk sebagai kehidupan nyata
sekarang dan selamanya. Selanjutnya, aturan tentang obat generik hanya
memerlukan bukti bioekivalensi, dan margin keuntungan pada obat generik
tidak berpikir untuk membenarkan dana dari hasil studi. Situasi serupa terjadi
berkaitan dengan makanan tambahan dan "alternatif dan komplementer" terapi.
Tidak ada sumber untuk melakukan evaluasi ini selain kader AMCs, idealnya
ditopang dengan dana Federal. The Clinical Research Roundtable dari Institute
of Medicine telah menekankan perlunya ketinggian dana untuk percobaan klinis
pragmatis.

Pada tingkat dasar, AMCs juga harus menanamkan pada praktisi pemahaman
mendasar tentang prinsip-prinsip terapi dan pengukuran kualitas dalam
pelayanan kesehatan.Meskipun American Society Farmakologi Klinik dan
Terapi telah mengajukan kurikulum model untuk domain tertentu, sebuah
terdefinisi kurikulum pada bidang yang lebih luas dari terapi tidak ada, dan
pengajaran dasar-dasar biostatistik, probabilitas, pengambilan keputusan dan
sistem perawatan kesehatan belum diterima dengan baik, dan mungkin tidak
baik dilaksanakan.awal pekerjaan dengan CERT telah membentuk tingkat
kesulitan yang tinggi dalam melakukan perubahan kurikulum dalam program
pendidikan kesehatan AS. Kurikulum ini dikemas, dan banyak kontingen yang
begitu bersikeras tidak kehilangan waktu yang INSER-tion materi baru
dipandang sebagai zero-sum game, di mana penambahan sesuatu yang berarti
penghapusan baru sesuatu yang lain. Namun demikian, kami melihat
peningkatan bertahap dalam penekanan pada keterampilan yang akan
meningkatkan kualitas pengobatan di sarjana, staf rumah, dan melanjutkan
program pendidikan. Salah satu pendekatan untuk mengatasi masalah ini telah
pengembangan kurikulum terfokus yang diposting di Internet untuk digunakan
dalam beberapa pengaturan dan lembaga.

AMCs juga memiliki tantangan pelatihan dan mendukung para peneliti yang
akan menentukan lapangan di masa depan. Saat ini, AHRQ memiliki dana
kurang untuk pengembangan pelatihan dan fakultas, dan arena ini sengaja tidak
menjadi fokus dari NIH. Pemetaan NIH dapat memberikan kesempatan untuk
mengembangkan kader yang lebih besar dari para ahli di bidang terkait
epidemiologi klinis, biostatistik, uji klinis, ekonomi kesehatan, penelitian
pelayanan kesehatan, dan pharmacology klinis

INFORMASI KEPADA KONSTITUEN

Pembuat Kebijakan

Pada akhirnya, banyak masalah dalam terapi hanya dapat diselesaikan dengan
menginformasikan pembuat kebijakan untuk meningkatkan peluang kebijakan
rasional yang memberikan insentif untuk perilaku yang meningkatkan
penggunaan terapi. Potensi untuk memanfaatkan keahlian untuk kepentingan
belum pernah lebih besar sebagai sumber lebih perawatan kesehatan jatuh ke
pemerintah Federal dan rencana pembayar besar.

Masyarakat
Menginformasikan kepada masyarakat tentang keseimbangan risiko dan
manfaat terapi adalah tugas yang luar biasa, yang mengejutkan adalah hanya
sedikit yang mengetahuinya. Peningkatan jumlah studi menunjukkan bahwa
banyak informasi yang tersedia untuk umum adalah baik bias atau tidak
dimengerti. Namun, di AMCs, sedikit perhatian telah difokuskan pada
terjemahan temuan penelitian medis ke dalam laporan yang dapat
ditindaklanjuti secara efektif oleh publik

Pers

Survei dari masyarakat menunjukkan bahwa keputusan yang berhubungan


dengan kesehatan lebih didasarkan pada laporan pers dari pada dokter visit.1
Ketika FDA ingin mendapatkan pesan ke publik, harus menggunakan pers agar
pesan tersebut keluar. Hal ini dapat dikatakan bahwa penelitian observasional
tentang isu luas terapeutik mendominasi laporan pers pada obat, dengan
perhatian yang cukup sering terhadap masalah kuantitatif akan terlibat dalam
interpretasi. Sayangnya, peran pers dalam terapi dan kesehatan masyarakat telah
mendapat perhatian memadai dalam dunia akademis. Dalam baru-baru ini
"think tank," 2 beberapa isu tentang pers dibesarkan, dan agenda penelitian telah
diajukan untuk dipertimbangkan.

PERAN KHUSUS KEMITRAAN PUBLIK-SWASTA

Efek dramatis dari penuaan penduduk dikombinasikan dengan penggemukan


generasi muda akan membuat tantangan sosial yang sangat besar. Memang,
masalah yang bisa dibilang begitu kuat bahwa kemitraan publik-swasta
mungkin satu-satunya cara untuk membuat sumber daya yang cukup untuk
menemukan solusi yang efektif.

1
National Health Council. Americans Talk about Science and Medical News: The National Health Council
Report. Washington, DC: National Health Council, 1997.
2
Mebane F. The importance of news media in pharmaceutical risk communication: proceedings of a
workshop. Pharmacoepidemiol Drug Saf 2004; 14(5): 297-306.
The CERTs telah mengembangkan model pendekatan untuk kemitraan publik-
swasta berdasarkan seperangkat prinsip yang meningkatkan kemungkinan
bahwa investasi publik yang sederhana akan menghasilkan investasi swasta
yang lebih besar sementara juga menjaga sifat ekumenis dari perusahaan.
Prinsip-prinsip ini dirancang untuk mendorong keterlibatan mitra industri di
perusahaan penelitian di bawah seperangkat aturan yang dianggap oleh
pemerintahan CERTs dan didiskusikan secara terbuka.

Prioritas pertama dari CERTs adalah untuk mengatasi masalah-masalah


kepentingan publik. CERTs adalah inisiatif utama untuk meningkatkan
penggunaan rasional terapi melalui kegiatan penelitian dan pendidikan yang
berada di kepentingan umum tetapi tidak dinyatakan akan dilakukan. Kedua,
CERTs secara aktif mencari kemitraan publik-swasta, bukan menghindarinya.
CERTs adalah kemitraan publik-swasta; Oleh karena itu CERTs mencari
kegunaan, interaksi yang sesuai dengan organisasi swasta untuk mendukung dan
meningkatkan pendidikan, penelitian, dan proyek demonstrasi. AHRQ bekerja
dengan pusat-pusat untuk membangun kesepakatan yang tepat untuk
mengoptimalkan penggunaan dan berbagi sumber daya. Ketiga, isu konflik
kepentingan diakui dan dihadapi. Potensi konflik kepentingan yang mungkin
ada dalam setiap kemitraan publik-swasta. Potensi konflik ini tidak dapat
sepenuhnya dihindari atau dihilangkan. Kewajibannya adalah untuk
mengungkapkan sepenuhnya dan mengelola potensi konflik dengan cara
meminimalkan risiko konflik tersebut, sekaligus memaksimalkan kemajuan
untuk mencapai tujuan CERTs. Keempat, integritas akademik adalah yang
terpenting. Sebagai peneliti akademis, individu melakukan proyek-proyek di
bawah naungan CERTs akan mempertahankan keputusan akhir tentang desain
penelitian, analisis, kesimpulan, dan publikasi dan akan memastikan bahwa
pekerjaan mereka sesuai dengan konflik dan lembaga masing-masing.
Akhirnya, satu ukuran tidak cocok untuk semua kegiatan CERTs. Kegiatan
CERTs didefinisikan sebagai proyek yang didukung secara keseluruhan atau
sebagian dana oleh AHRQ dan di bawah program demonstrasi CERTs.
Kegiatan-kegiatan tersebut tunduk pada proses yang ditetapkan untuk program
CERTs, seperti peninjauan potensi konflik kepentingan. Individu yang
berafiliasi dengan pusat juga melakukan kegiatan pendidikan dan penelitian di
luar CERTs yang tidak tunduk pada proses CERTs.

Singkatnya, AMCs memiliki peran penting dalam bidang farmakoepidemiologi


dan terapi. Peran ini termasuk menyediakan basis fundamental pelatihan dan
pemeliharaan disiplin akademis. Namun, juga mencakup integrasi kreatif
dengan penyedia layanan kesehatan, instansi pemerintah, dan industri medis
yang lebih luas.

Sebuah Gambaran dari Industri

ROBERT F. REYNOLDS, DALE B. Glasser dan Gretchen S. DieckPfizer Inc,


New York, NY, USA.

KATA PENGANTAR

Lebih dari satu abad yang lalu, obat-obatan dan vaksin telah mengubah praktek
kedokteran modern dan meningkatan kesehatan masyarakat secara signifikan,
dengan mengurangi morbiditas dan meningkatkan harapan hidup di seluruh
dunia. Lebih dari setengah juta produk farmasi saat ini tersedia di Amerika
Serikat, 1 dan hampir 350 obat baru telah disetujui pada tahun 1990-an oleh US
Food and Drug Admin-Administration (FDA) untuk mengobati kondisi yang
mempengaruhi jutaan orang.2-5 Meskipun tantangan baru dalam penemuan dan
pengembangan obat baru,5-6 35 obat baru telah disetujui pada tahun 2003 untuk
pengobatan penyakit seperti penyakit Alzheimer, kanker, dan infeksi HIV, dan
lebih dari $ 30 miliar diinvestasikan oleh perusahaan farmasi dan bioteknologi
untuk penelitian obat baru dan pengembangan obat baru.7

Peran epidemiologi dalam pengembangan obat, penilaian keamanan, dan


komersialisasi telah berkembang sangat pesat pada beberapa tahun terakhir.
Secara tradisional, industri farmasi dan badan pengatur telah mengandalkan
ilmu dasar penelitian dan studi klinis rancangan percobaan untuk menilai efikasi
dan keamanan obat baru sebelum persetujuan, dan sistem pelaporan secara
kreatif (tanpa diminta) untuk menilai keamanan dari obat setelah persetujuan.
Lima belas tahun yang lalu, epidemiologi digunakan terutama pada defensif
dalam menanggapi pertanyaan hukum atau peraturan. Sekarang, meskipun
pharmaceutical dan bioteknologi perusahaan mempekerjakan epidemiologists
dan menerapkan desain penelitian observasional dan metode dalam banyak
bidang fungsional dalam perusahaan farmasi

Tujuan dari bab ini adalah untuk memberikan gambaran bagaimana desain
epidemiologi dan metode yang diterapkan dalam industri, dengan fokus khusus
pada penggunaannya untuk evaluasi keamanan obat. Pembaharuan dari
Prescription Drug User Fee Act tahun 2002 (PDUFA III) mengakibatkan
munculnya kerangka baru untuk mengevaluasi obat dan mengatur risiko obat.

2
Kaitin KI, Manocchia M, Seibring M, Lasagna L. The new drug approvals of 1990, 1991, and 1992: trends in
drug development. J Clin Pharmacol 1994; 34; 120-7.
3
Kaitin KI, Manocchia M. The new drug approvals of 1993, 1994, and 1995: trends in drug development. Am J
Therapeutics 1997; 4: 46-54.
4
Kaitin KI, Healy EM. The new drug approvals of 1996, 1997, and 1998: drug development trends in the user
fee era. Drug Inf J 2000; 34: 1-14.
5
Kaitin KI, Cairns C. The new drug approvals of 1999, 2000, and 2001: Drug development trends a decade after
passage of the Prescription Drug User Fee Act of 1992. Drug Inf J 2003; 37: 357-71.
6
Kermani F, Bonacossa P. Patent issues and future trends in drug development. J Comm Biotechnol 2003; 9:
332-8.
7
Pharmaceutical Research and Manufacturers of America (PhRMA). Pharmaceutical Industry Profile 2003.
Washington DC: PhRMA; 2003.
Kami memberikan gambaran singkat tentang dampak potensial dari kerangka
kerja ini pada evaluasi keamanan obat sebelum menjelaskan banyak tentang
kegunaan epidemiologi dalam perusahaan farmasi. Kemudian kami
menyimpulkan dengan diskusi tentang daerah mana epidemiologi dan industri
sponsor dan kemitraan yang paling mungkin untuk memajukan bidang
farmakoepidemiologi.

REGULASI BARU DAN FOKUS INDUSTRI PADA MANAJEMEN RISIKO


DAN EPIDEMIOLOGI

Selama proses pengembangan obat dan pemasaran, lembaga regulator nasional,


seperti FDA AS, atau lembaga multinasional, seperti European Medicines
Evaluation Agency (EMEA), mengatur industri farmasi. Badan-badan ini
mengharuskan manufaktur farmasi menunjukkan bahwa obat baru, perangkat
atau vaksin yang aman dan efektif sebelum disetujui, dan bahwa informasi
tentang efek dari obat-obat ini dikomunikasikan kepada pasien dan dokter.
Produsen memiliki kewajiban lebih lanjut untuk mengevaluasi keamanan
produk secara berkelanjutan, dalam rangka mengembangkan dan
mempertahankan label produk yang menjamin pemberian resep yang tepat dari
obat oleh dokter dan penggunaan yang aman oleh pasien. Tersirat dalam proses
ini adalah kebutuhan untuk secara logis untuk persetujuan obat, untuk
pendekatan rasional dan untuk mencapai keseimbangan pengawasan keamanan
obat pada pre-marketing dan post-marketing, dan untuk penelitian ilmiah, bukti
yang berbasis dari peraturan lingkungan. Dengan demikian, produsen
mengabdikan upaya dan sumber daya yang signifikan untuk memenuhi
kebutuhan regulasi seluruh dunia untuk penelitian dan pengembangan obat,
pemantauan keamanan post-marketing obat sesuai dengan sistem pelaporan
kreatif (tanpa diminta) diperlukan dan kerangka waktu, dan dalam
menyelesaikan komitmen Tahap IV.
Lebih dari satu dekade lalu, kekhawatiran meningkat bahwa FDA mengambil
waktu terlalu lama untuk meninjau aplikasi obat baru (NDA) dan membuat
keputusan serta persetujuan.2-3 Karena tinjauan menyeluruh dari keamanan dan
kemanjuran data penting, kekurangan staf di FDA mungkin telah menunda
banyak hal yang berharga, dan dalam beberapa kasus untuk menyelamatkan
nyawa, obat yang tersedia untuk sejumlah besar pasien yang bisa bermanfaat.
Kelompok advokasi pasien, dalam aktivis HIV-AIDS khususnya, yang berperan
dalam memaksa perubahan proses peraturan ini, dan dalam menyediakan akses
untuk pasien yang berpotensi untuk meningkatkan pengobatan dengan kualitas
penyelamatan hidup yang baik untuk masa ke depannya. 8 Pada tahun 1992,
Prescription Drug User Fee Act (PDUFA) disahkan . Ini memungkinkan FDA
untuk menyewa ratusan pengulas tambahan dana yang disediakan oleh sponsor
(produsen) dengan mengumpulkan NDA. Sebagai imbalannya, produsen bisa
berharap keputusan tentang persetujuan dalam waktu satu tahun dengan
mengirimkan NDA (6 bulan jika obat itu disetujui oleh FDA). Setelah
pengenalan PDUFA pada tahun 1992, panjang rata-rata fase persetujuan
menurun lebih dari 20% .3-4 The Act berakhir pada tahun 1997 dan kemudian
diperbaharui oleh Kongres (PDUFA II)

Sejak saat itu, telah meningkat penekanan peraturan pada pengawasan post-
marketing, dan kemungkinan lebih besar untuk studi observasional yang akan
8
Drews J. In Quest of Tomorrow’s Medicines. New York: Springer; 1999.

9
Food and Drug Administration. Report to Congress: Report on Postmarketing Studies. Washington DC: FDAMA
130; US FDA.
10
Food and Drug Administration. From Test Tube to Patient: Improving Health through Human Drugs.
Washington DC: US FDA CDER; 1999.
11
Food and Drug Administration. Managing the Risk from Medical Product Use: Creating a Risk Management
Framework. Washington DC: US FDA; 1999.
12
Hyslop DL, Read HA, Masica DN, Kotsanos JG. Pharmaceutical Risk Management: a call to arms for
pharmacoepidemiology. Pharmacoepidemiol drug Saf 2002; 11: 417-20.
13
Andrews E, Dombeck M. The role of scientific evidence of risk and benefits in determining risk management
policies for medications. Pharmacoepidemiology drug Saf. In Press.
14
Perfetto EM, Ellison R, Ackerman S, Sherr M, Zaugg AM. Evidence-based risk management: how can we
succeed? Drug Inf J 2003; 37: 127-34.
diperlukan sebagai komitmen keamanan pasca-persetujuan.9 Lembaga regulasi
telah lama mengakui pentingnya terus-menerus mengevaluasi keseimbangan
risiko-manfaat obat.10 Baru-baru ini, meskipun lembaga regulasi dan industri
farmasi telah menempatkan kepentingan yang lebih besar pada pengembangan
panduan-peraturan dan proses standar untuk mengenali dan, jika mungkin,
meminimalkan risiko.11-14 Peningkatan kesadaran masyarakat akan potensi
risiko obat dan kemampuan teknologi yang lebih besar untuk mengidentifikasi
langkah-langkah proksi kemungkinan hasil risiko telah diragukan karena
kesadaran yang kurang. Telah terjadi pergeseran bertahap penilaian risiko pasif
dari modus tradisional (misalnya, sukarela sistem pelaporan kreatif dan
penyebaran informasi) dengan penggunaan bentuk-bentuk yang lebih aktif dapat
membentuk potensi untuk evaluasi dan pengelolaan risiko obat, seperti
pembatasan dalam penggunaan dan distribusi atau program pendidikan wajib.
Pergeseran ini telah menghasilkan panggilan untuk proses berbasis ilmiah untuk
mengelola risiko obat.13-14 (Lihat juga Bab 35.)

Sekarang, dengan diberlakukannya revisi dari PDUFA (PDUFA III) pada tahun
2002, manajemen risiko, proses ilmiah dimana risiko diidentifikasi, dinilai,
dikomunikasikan, dan diminimalkan, memiliki peran formal dalam
pengembangan, tinjauan dan persetujuan obat baru. Undang-undang telah
mengakui bahwa terdapat resiko dan manfaat yang melekat dalam intervensi
terapi, dan bahwa tujuan umum dari produsen dan FDA adalah mengoptimalkan
manfaat terapeutik dan meminimalkan risiko obat. Untuk pertama kalinya, di
bawah PDUFA III, pendapatan yang dikumpulkan dalam bentuk biaya
pengguna obat resep akan dialokasikan untuk kegiatan penilaian risiko post-
marketing tertentu. Selanjutnya, rekomendasi bahwa rencana manajemen risiko
dikembangkan sebelum persetujuan obat telah memainkan peran kunci dalam
menggerakkan proses perencanaan manajemen risiko ke dalam tahap-tahap
awal dalam pengembangan obat, meskipun pengajuan rencana manajemen
risiko sebelum persetujuan formal tetap sukarela saat ini. Fokus pada
manajemen risiko selama periode sebelum persetujuan memberikan kesempatan
untuk mengeksplorasi dan potensial mengukur sinyal keamanan dan untuk
mendokumentasikan eksplorasi dan proses pengambilan keputusan dan
pemikiran dalam rencana manajemen risiko, yang tentu akan berkembang
sepanjang siklus hidup dari obat . Rencana manajemen risiko dan program pada
akhirnya akan menguntungkan kesehatan masyarakat, sehingga persetujuan obat
sebelumnya selain persetujuan obat dengan manfaat terapeutik akan
meminimalkan risiko obat. (Lihat juga Bab 35.)

Epidemiologi memainkan peran sentral dalam kegiatan manajemen risiko, baik


melalui studi tentang sejarah alami penyakit, jalur pengembangan penyakit /
pengobatan, dan pola mortalitas dan morbiditas, atau dalam desain dan
pelaksanaan studi keselamatan pasca-persetujuan atau program meminimalisasi
risiko. Kerangka manajemen risiko yang muncul, berdasarkan dengan
penekanan pada metodologi ilmiah dan pengambilan keputusan transparan,
memberikan kesempatan yang unik bagi epidemiologi untuk berkontribusi pada
pengembangan obat yang efektif dan aman dan untuk membangun kepercayaan
publik dalam tindakan industri dan pemerintah.

EPIDEMIOLOGI DALAM PHARMACEUTICAL INDUSTRI


Epidemiologi memberikan kontribusi bagi keberhasilan beberapa fungsi penting
dalam sebuah perusahaan farmasi, termasuk prencanaan produk, penengmaban
portofolio, dan komersilisasi obat, namun kontribusi terbesarnya adalah
dibidang evaluasi keamanan obat. Metode observasi digunakan dalam bebrapa
fungsi, terutapa yang mnedukung komersialisasi dan pemasaran obat baru,
sering digambarkan oleh terminologi lain dalam perusahaan (misalnya luaran
yang diinginkan, ekonomi kesehatn), dan akan dibahas secara lebih mendalam
dalam buku ini (lihat bab 43 dan 44).

EVALUASI KEAMANAN OBAT

Profil keamanan obat mencerminkan perkembangan pengetahuan dari


investigasi pra-klinis untuk penggunaan pertama dari agen pada manusia dan
melalui siklus hidup pasca-persetujuan produk. Bagaimanapun juga produsen
obat secara tradisional mengendalikan 2 sumber utama untuk informasi tentang
keamanan obat : uji klinis yang mendukun New Drug Application (NDA) dan
setelah obat dipasrkan, laporan secara langsung yang diterima oleh seluruh
dunia. Keduanya beruga dan memiliki tempat dalam menilai keamanan obat,
tetapi juga memiliki keterbatasan yang dapat diatasi, sebagian dengan
menggunakan pendekatan epidemiologi secara observasional. Studi
epidemiologi dapat melengkapi 2 seumber data untuk memberikan gambaran
lebih komprhensif dan pragmatis dari profil keamanan obat.

There are many relevant safety issues that can only be studied through
observational epidemiology. Only epidemi-ologic methods are practical for
estimating the incidence of and risk factors for rarely occurring events in large
populations exposed to a drug (see also Chapter 3), to study events with a long
latency period, or to study cross-generational effects of a drug. For example,
case reports of a few patients with primary pulmonary hypertension exposed to
appetite sup-pressant drugs led to a formal epidemiologic study documenting
this association and strengthened labeling for the drug.15

Terdapat banyak isu keselamatan yang relevan dan hanya bisa dipelajaran
melalui studi epidemiologi secara observasional. Hanya metode epidemiologi
praktis yang dapat memperkirakan kejadian dan faktor risiko jarang terjadi pada
peristiwa dalam populasi besar terkait obat (lihat juga bab 3). Untuk
mempelajari suatu peristiwa dengan periode laten yang panjang atau untuk
mempelajari efek lintas generasi dari obat. Misalnya laporan kasus dari
beberapa pasien dengan hipertensi paru primer terkena nafsu makan obat
supressan menyebabkan studi epidemiologi resmi mendokumentasikan
haubungan ini dan memperkuat label untuk obat.

Sementara studi epidemiologi observasional menawarkan banyak keuntungan,


studi epidemiologi seharusnya tidak pernah dilihat dalam isolasi dari sumber
data lain ketika menangani pertanyaan keamanan obat ini. Hasil drai uji klinis,
laporan langsung, studi epidemiologi, dan yang relevan, dataset pra klinis,
semua harus dievaluasi untuk potensi mereka untuk menjawab pertanyaan
keamanan tertentu dengan pertimbangan kekuatan unik dan keterbatsan desain
studi dan metode pengumpulan data yang digunakan.

UJI KLINIK
Uji klinis terjibtrik secara acak dianggap sebagai standar metodologi emas
untuk mempelajarai keamanan dan keamjuran obat. Namun, percobaan dibatasi
oleh jumlah yang relatif kecil dari pasien yang diteliti dan periode waktu yang
singkat dimana pasien yang diamati. Jumlah pasien termasuk dalam
premarketing uji klinis biasanya cukup mengidentifikasi hanya efek samping
paling umum dan akut terjadi. Biasanya, uji coba ini memiliki total sampel
pasien ukuran hingga beberapa ribu. Menggunakan “aturan tiga”, dimana
ukuran sampel yang dibutuhkan kira-kira tiga kali kebalikan dari frekuensi
acara, setidaknya 300 pasien akan diperlukan dalam sidang untuk mengamati
setidaknya satu peristiwa buruk yang terjadi pada tingkat dari 1/100. Demikian
juga, 3000 sampel diperlukan untuk mengamati setidaknya satu peristiwa buruk
dengna probabilitas 95 % jika frekuesi dari acara ini adalah 1/1000. (lihat bab 3
untuk lebih banyak diskusi tentang ukuran sampel yang dibutuhkan untuk
studi). Dengan demikian, uji klinis biasanya hanya cukup besar untuk
mendeteksi peristiwa yang terjadi relatif sering, dan tidak dimaksudkan atau
dirancang untuk mengatasi semua masalah keamanan potensial berkaitan
dengan obat tertentu.

Pembatasantambahanujiklinisterhadapkeamananobatadalahkriteriainklusi /
eksklusi yang
ketatumumdalamstudiini.Pasientermasukdalamstudiklinispersetujuanawalmung
kinsegmensehatdaripopulasipasien.kelompokkhususseperti orang tua,
wanitahamil, atauanak-anakseringdikeluarkandaritrials.Patientsdalamujiklinis
juga cenderungdiperlakukanuntukindikasididefinisikandenganbaik,
memilikiketerbatasandan juga dimonitorpenggunaannarkobasecarabersamaan,
dandiikutitanda-tandaawaldangejalaefeksamping yang
dapatdibalikdenganpengobatan yang tepat. Sebaliknya, setelahobatdipasarkan,
digunakandalam "dunianyata" konteksklinis.Pasien yang
menggunakanobatmungkinmemilikibeberapamorbiditas co yang
merekadiperlakukansecarabersamaan.Pasien juga
dapatmengambilobattanparesep, obat "alami", atauobat-
obatanterlarangtanpasepengetahuandokterresep.Interaksiberbagaiobatdanperawa
tandapatmengakibatkanobattertentumemilikiprofilkeamanan yang
berbedadalampengaturanpasca-pemasarandibandingkandenganlingkungan
premarketing dikendalikan.Contohnyaadalahmibefradilobat, yang
secarasukareladitarikdaripasarsetelahkurangdarisatutahunolehprodusensebagaia
kibatdariinformasibarutentangbeberapainteraksiobat yang
serius.Kepatuhanterhadapobat juga
seringberbedaantaraujicobadimonitordanpenggunaanpersetujuanpascaumum,
sepertihalnyadenganantihipertensi.(Lihat juga Bab 48.)

SISTEM PELAPORAN SPONTAN

Sistem pelaporan spontan yang berharga untuk mengidentifikasi peristiwa yang


relatif jarang dan memberikan sinyal tentang masalah keamanan yang serius,
terutama berkenaan dengan obat baru (lihat juga Bab 11 dan 12) . Sementara
saat ini belum ada definisi yang seragam, sinyal umumnya dipahami sebagai
frekuensi relatif lebih tinggi dari yang diharapkan dari sepasang acara narkoba.
Tergantung pada keadaan dan informasi yang tersedia di tingkat latar belakang
peristiwa di populasi menggunakan obat, definisi "lebih tinggi dari yang
diharapkan" akan berbeda berdasarkan golongan obat, indikasi dan dari waktu
ke waktu. Pada akhirnya, sinyal digunakan untuk menghasilkan hipotesis, yang
kemudian dapat dipelajari melalui studi observasional atau intervensi yang
sesuai; Namun, laporan spontan harus ditafsirkan dalam konteks kekuatan dan
limita-tions dari pelaporan tertentu systems.Inilaporansukarelatundukbanyak
bias danpengaruheksternalpadatingkatpelaporan, yang
tidakterukurdandalambanyakkasusterukur.
Peristiwamungkintidakdilaporkandankeputusanuntuk yang
kejadianmendapatkandilaporkanberpotensisangatdipengaruhioleh bias.

Efekdari bias-bias
iniberbedaantaraobatdanberbedadariwaktukewaktu.Jumlahlaporanspontane-
ousmenerima paling seringberhubungandenganlamanyawaktuobattelah di pasar,
tingkatawaldaripenjualanobat, trensekulerdalampelaporanspontan,
danjumlahwaktupenjualanperwakilandariprodusenmenghabiskanwaktudengand
okter "merinci" produk.
Beberapajenisperistiwatampaknyalebihcenderungdilaporkan, seperti yang
seriusdan / atautanpa label, peristiwa yang jarangterjadipadapopulasiumum,
orang-orang yang terjadisecaraakutdenganpemberianobat, dan yang
berhubungandenganpublikasi di awamatau media profesional.
Frekuensipelaporanbervariasimenurutkelasobatdanperusahaanobat.Jumlahlapor
antidaksamadenganjumlahpasien, sejakperistiwadapatdilaporkanbeberapa kali.
Yang paling penting, dantitikseringdisalahpahami, tingkatinsiden valid
tidakdapatdihasilkandarisistempelaporanspontan,
karenabaikpembilangbenaratau denominator benardiketahui,
dandengandemikianrelatifamantidakdapatdinilaidenganvaliditas.Selainitu,
peristiwadilaporkanmemilikitingkatlatarbelakang yang
mendasaridalampopulasi, bahkantanpaadanyaterapiobat, yang
mungkintidakdiketahui.

Liputan media khususnyamemilikiefek yang signifikanpadawaktudan volume


efeksampingsecarasukarelamelaporkankesistempelaporanspontan.Efekinimemil
iki
didokumentasikanuntukberbagaigolonganobatdanefeksamping.Sebagaicontoh,
dalamsebuahstudiprospektif di AS, media
televisiditemukansecarasignifikanmempengaruhipelaporanefeksampingspontan
untuktriazolam.Laporanpenelitimembandingkanmenerimaempatminggusebelum
program televisinasionalpada Halcion (triazolam)
laporandalamwaktuempatminggusetelah program.Hampirdua kali
lebihbanyakkasus (67 dibandingkandengan 37)
dilaporkanpadabulanberikutnyasetelah program.Laporanolehkonsumen juga
meningkat dari 46% menjadi 60% selamaperiodeini.

Contoh lain yang terkenaldaridampak media


memilikipelaporanspontandiilustrasikanolehlaporanspontandilaporkansetelahtah
un 1990 publikasisebuahartikelmenyatakanbahwa fluoxetine
antidepresandikaitkandenganperilakubunuhdiridanagresikekerasanterhadap
orang lain. Tak lama setelahpublikasiartikelini,
laporanspontankejadianbunuhdiriterkaitdengan fluoxetine meningkat
secarasignifikan, seperti yang dilakukanproporsi yang dilaporkanolehkonsumen
(lihatGambar 7.1 dan 7.2).Khususnya, tarifpelaporanuntukobat lain di kelas
yang samatidaknaikdengancara yang sama,
menunjukkanbahwapelaporanperistiwatelahdirangsangolehpublikasi.
publisitasintensberkontribusikehilanganpangsapasaruntukprodukinimeskipunpra
ktisidanKomitePenasehat FDA
mencapaikesimpulanbahwapadawaktuitutidakadabuktiilmiah yang
menghubungkanperilakubunuhdiridenganagenini. KomitePenasehat FDA
tidakmenunjukkanbahwaprodusenlebihmendukungbuktikeamananobatdenganst
udiepidemiologiprospektif.penelitianselanjutnyadankembalianalisis data
percobaanklinistidakmenunjukkanpeningkatanrisikobunuhdiriatauperilakuagresi
f yang terkaitdengan fluoxetine antara orang dewasa, danjutaanpasien di
seluruhduniatelahmemperolehmanfaatdariterapiini.
Meskipunketerbatasaninipenting,
sistempelaporanspontantelahberhasildigunakan di
sejumlahsituasiuntukmengingatkanlembaga regulator
danprodusenuntukfrekuensiberpotensitinggiefeksamping yangseriusdalamobat
yang barudiluncurkan.Salah satucontohnyaadalahtemafloxacin, yang
telahdisetujuioleh FDA padabulanJanuari 1992.PadabulanJuni 1992,
obatitusecarasukareladitarikdaripasarolehprodusen, menyusullaporandari 6
kematiandanlebihdari 70 efeksampingseriuslainnya, termasuk anemia hemolitik,
gagalginjal, hipoglikemiaberat, dananafilaksis.
Dalamempatbulanpertamasetelahpemasaran, diperkirakan 174.000 orang
mengambilobatini, 38 yang memungkinkanpengamatancepatefeksamping yang
serius yang terjadilebihjarangdaripada yang diamatidalamujiklinis.
Contohlainadalahbahwadarimibefradil, kalsium channel blocker pertama kali
dipasarkan di AS padabulanAgustus 1997. Tigaobat (astemizol, cisapride,
danterfenadin)
tercatatsebagaimemilikiinteraksidenganmibefradilpadasaatpersetujuan.Melaluila
poranspontan (sertastudiklinislanjutan), lebihdari 25 obat yang
kemudiandiidentifikasi yang
berpotensiberbahayajikadigunakandenganmibefradil.Mibefradiltidakpunyamanf
aatkhusus yang dikenal yang tidakdapatbertemudenganobat lain. Produsendan
FDA memutuskanbahwajumlahdankeanekaragamanobatdengan yang
berinteraksitidakbisadibilangditanganimelaluiperingatan yang biasadalam label,
danprofilrisiko-
manfaatitudianggaptidakmenguntungkan.Obatitusecarasukareladitarikdaripasar
AS padabulanJuni 1998.

Dalam rangka untuk mengevaluasi sinyal keselamatan yang timbul dari sistem
pelaporan spontan, perlu untuk mengetahui sebanyak mungkin tentang populasi
menggunakan obat. Misalnya, pengetahuan tentang distribusi usia, jenis
kelamin, penyakit penyerta, dan obat-obatan pada pengguna obat tertentu dapat
memberikan informasi yang diperlukan untuk memperkirakan tingkat latar
belakang diharapkan peristiwa yang satu bisa mengamati. Sejumlah vendor
komersial, seperti NDC Kesehatan Layanan Informasi, HICA, Solucient, dan
IMS Health, menyediakan informasi lengkap tentang penggunaan dan penjualan
produk resep. Meskipun informasi tentang konsumsi obat yang sebenarnya tidak
tersedia, asumsi dapat dibuat tentang frekuensi penggunaan dari menghitung
interval antara isi ulang sumber daya longitudinal. Selain itu, informasi tentang
frekuensi penggunaan off-label atau frekuensi co-resep dengan obat yang
kontraindikasi dapat dieksplorasi.

Teicheret al.artikel dipublikasi asosiasi

Prozac dengan tindakan bunuh diri/ mati

2.5

2.0
Spontaneous reports per 10,000

1.5

1.0
new prescriptions

0.5

1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31
3
3

Quarter since launch

Drug (launch): Prozac (01/88) Zoloft (02/92) Paxil (01/93)

Gambar 7.1.PelaporanSumber data bunuhdiri: Spontanctslaporan / kematian


yang terkaitdengan SSRI berikutpublikasiTeicher et al. 1990 artikel. datadari
database FDA AERS, data resepbarudari IMS Amerika.

Teicheret al.artikel dipublikasi asosiasi

Prozac dengan tindakan bunuh diri / mati


of

15%
a percentage

10%
reports
Consumer reports 5%

total suicide 0%
as

-88 -89 -90 -91 -92 -93 -94 -95 -96 -97 -98

Mar Mar Mar Mar Mar Mar Mar Mar Mar Mar Mar

Calendar Quarter Since Launch

Drug (launch): Prozac (01/88) Zoloft (02/92) Paxil (01/93)

Gambar 7.2.laporankonsumensebagaipersentasedari total


laporanbunuhdiriuntuk SSRI berikutpublikasiTeicher et al. 1990 artikel. Sumber
data: Spontanlaporan data dari database FDA AERS.

ARI FAUZAN

Studi keamanan setelah persetujuan

Selama fase sebeum pemasaran pengembangan obat, uji klinis acak melibatkan
seleksi subjek yang tinggi dan termasuk pengumpulan pada lebih seribu pasien.
Studi ini cukup besar untuk menetapkan kejadian dari manfaat efek klinik dan
mengeluarkan peningkatan luas pada resiko dari efek samping yangumum.
Namun, cukup jarang uji sebelum pemasaran untuk mendeteksiperbedaan kecil
dalam resiko efek samping yang umum atau untuk memperkirakan resiko
peristiwa langka. Identifikasi dan kuantifikasi dari potensi yang jarang tetapi
resiko serius yang membutuhkan desain studi luas untuk membedakan diantara
peran dari latar belakang faktor resiko dan efek samping dari nilai obat tertentu
dari hasil. Karena dari kerumitan desain dan harga, uji coba terkontrol dalam
jumlah besar belum banyak digunakan untuk evaluasi sesudah pemasaran obat.
Belakangan ini, regulator dan komunitas medis mempunyai keinginan
membicarakan untuk data keamanan dari populasi yang benar- benar
menggunakan obat di “dunia nyata” peraturan praktek klinis. Ini menyebabkan
penekanan lebih besar pada penggunaan metode observasional untuk
memahami profil keaamanan obar baru setelah dipasarkan.

Misalnya, dari bagaimana metode observasional dapat berhasil digunakanuntuk


memberikan bukti ilmiah tambahanmengenai keamanan obat baru adalah
kejadian dalam kasus slidenafil. Sildenafil disetujui untuk pengobatan disfungsi
ereksi (ED) pada Maret 1998, diikuti oleh persetujuan di dalam Uni Eropa pada
Mei 1998. Segera setelah peluncuran sildenafil di US, laporan spontan kematian
dan infark miokard diantara penggunaan sildenafil diterima oleh produsen dan
peraturan pemerintah. Jumlah laporan dan bagian dari laporan konsumen pada
sildenafil terlihat tidak seperti untuk obat baru lainnya saat itu, dan cukup luar
biasa meningkatkan kekhawatiran peraturan tentang keamanan sildenafil.
Penelitian ilmiah yang dilakukan sebelum persetujuan sildenafil menyoroti
prevalensi faktor resiko kardiovaskular pada pasien dengan ED dan bukti bahwa
ED menjadi tanda peringatan awal penyakit kardiovaskular, tetapi resiko dan
dugaan yang tepat dari kejadian kardiovaskular akut yang terjadi pada pria
dengan ED yang mencoba dan menerima pengobatan yang tidak diketahui saat
itu. Dengan demikian, dalam menanggapi keprihatinan yang diajukan oleh
regulator Eropa, dua studi keamanan setelah persetujuan yang dimulai untuk
menyelidiki keamanan sildenafil setelah pemasaran.Untuk memperoleh data
keamanan setelah pemasaran sildenafil pada waktu yang tepat, studi pertama
yang dilakukan adalah studi kejadian pemantauan resep (PEM) di UK,
dilakukan oleh pusat akademik independen, DSRU di Universitas Southampon
di Inggris (lihat Bab 14). Dalam hal ini, sebuah studi PEM adalah satu- satunya
sumber data yang layak dimana hasil dapat diperoleh dengan cepat, karena tidak
mungkin untuk menggunakan catatan adminitsrasi otomatis atau rekam medis
sejak sildenafril tidak diganti oleh sistem kesehatan tersebut. Tahap pertama
dari studi PEM, pada 5601 pasien diikuti rata- rata selama empat dan setengah
bulan, selesai pada 2000. Hasil dari tahap pertama menunjukkan bahwa angka
kematian usia- standart untuk penyakit jantung iskemik/ infark miokard dengan
penggunaan sildenafil serupa dengan populasi umum laki-laki di England.
Tahap kedua dari studi PEM sildenafil melibatkan lebih dari 22.000 pria dan
pasien yang diikuti secara signifikan lebih lama dari cohort, dengan tindak
lanjut rata- rata dari tujuh belas dan setengah bulan. Hasil dari kelompok ini
konsisten dengan studi sebelumnya: rasio kematian usia- standar pada pria
menggunakan sildenafil dibandingkan dengan populasi umum laki- laki di
Inggris, menunjukkan kematian di dengan pengguna sildenafil tidak meningkat
bila dibandingkan dengan jumlah pria tahun 1998 di Inggris. Studi PEM
terbesar hingga saat ini di Inggris, dengan total pasien lebih dari 28.000,
memberikan bukti pendukung sumber data lainnya, seperti uji klinis, bahwa
kejadian dari kematian akibat penyakit kardiovaskular diantara laki- laki yang
menerima resep untuk sildenafil dalam peraturan praktek klinis mirip dengan
hasil yang diamati pada laki- laki yang tidak menggunakan sildenafil. Lebih
lanjut, dan paling penting, tidak ada tanda kardivaskular atau serbovaskular
pada identifikasi dari studi PEM.

Selain penelitian PEM di Inggris, sebuah studi observasional prospektif, Studi


Kesehatan Pria Internasional (IMHS), memulai untuk menilai terjadinya
kejadian kardiovaskular pada pria yang mendaptkan sildenafil untuk
penggobatan disfungsi ereksi (ED). Kelompok ini lebih dari 5000 orang
mendapat resep sildenafil di Jerman, Perancis, Spanyol dan Swedia diikuti rata-
rata sekitar delapan belas bulan untuk menilai faktor resiko kardiovaskular,
kejadian kardiovaskular dan penggunaan dari penggobatan ED. 57 Penelitian ini
unik bahwa dalam tingkat kejadian penyakit kardiovaskular dibandingkan
dengan “waktu pengobatan” relatif pada “waktu henti penggobatan” diantara
kelompok pengguna sildenafil. Di bagian desain ini dipilih karena aktivitas
seksual dari dirinya terkait resiko dari morbiditas dan mortalitas kardiovaskular,
58
dan itu mungkin untuk menentukan resiko penggunaan sildenafil saja dengan
metode epidemiologi, meningkatkan ukuran sampel yang diperlukan untuk
desain kasus crossover. Setelah selesai studi berbasis masyarakat ini, tingkat
kejadian penyakit kardiovaskular yang ditemukan sebanding dengan angka
sebelumnya diterbitkan dari percobaan klinis dan populasi- berdasarkan data
epidemiologi, memberikan bukti lebih lanjut yang mendukung keamanan
kardiovaskular dari sildenafil .

Studi setelah percobaan tersebut memeriksa keamanan komparatif, karena


sildenafil merupakan obat kelas pertama. Namun, studi epidemiologi dapat
digunakan untuk memeriksa resiko komperatif terkait dengan obat tertentu
dalam kelas terapi, karena mereka benar- benar digunakan dalam praktek klinis.
Contohnya, ditemukan satu studi besar bahwa diantara obat anti- ulkus,
cimetidin dikaitkan dengan resiko tertinggi penyebab gejala penyakit hati akut.
59
Penelitian lain, memeriksa resiko patah tulang pinggul pada penggunaan
benzodiazepine, menemukan bahwa penggunaan agen long-acting yang
beresiko lebih besar dibandingkan yang menggunakan short- acting.60, 61

Studi epidemiologi observasional mungkin tidak selalu menjadi metode yang


paling tepat untuk mengevaluasi keamanan atau membandingkan profil
keamanan obat yang berbeda, terutama ketika ada kekhawatiran mengenai dari
indikasi (lihat bab 42). Kekhawatiran dari indikasi terjadi ketika resiko dari
suatu peristiwa yang merugikan terkait dengan indikasi untuk penggunaan obat
tapi tidak untuk penggunaan obat itu sendiri. Hasil dari studi observasional
adalah bentuk seleksinya bias, dimana pasien mengambil obat tertentu yang
dipilih dengan cara membuat mereka beresiko tidak merata hasil yang diteliti.
Dalam teori, bentuk lain dari kekhawatiran salah satunya misalnya, kontrol
untuk efeknya jika salah satu dapat dipercaya mengukur keparahan penyakit
yang mendasar, tetapi dalam prakteknya hal ini tidak mudah atau benar- benar
dilakukan ( lihat bab 42). Ini terutama terjadi ketika obat mungkin memiliki
sifat tertentu yang mempengaruhi jenis pasien itu yang digunakan dalam
indikasi. Dalam kasus ini, penelitian menggunakan pengacakan, apakah bisa
jadi diperlukan desain eksperimental atau observasional.

Dalam konteks ini bahwa desain percobaan sederhana secara luasbisa menjadi
rancangan penelitian yang paling tepat untuk evaluasi keselamatan setelah
pemasaran ( lihat bab 41). Ini adalah pendekatan yang diterapkan untuk
ziprasidone, sebuah antipsikotik atipikal untuk penggobatan skizofrenia yang
diluncurkan di AS pada tahun 2001. Dalam praktek psikiatri yang khas, pasien
diobati dengan obat baru bisa jadi sistematis berbeda dari mereka yang dirawat
dengan obat lain, karena penyaluran resep obat ke pasien dengan skizofrenia
yang lebih berat dan atau komorbiditas dan faktor resiko. Kemungkinan ini ada
karena ziprasidone adalah produk yang terbaru pada waktu itu, dan yang paling
mungkin untuk digunakan pasien yang telah gagal pada terapi sebelumnya. Di
samping itu, ada kekhawatiran bahwa pasien yang diobati dengan ziprasidone
mungkin berbeda dari mereka yang diobati dengan obat antipsikotik lainnya,
karena penyaluran resep obat untuk pasien dengan penyakit kardiovaskular
yang mendasari atau penyakit metabolik, terutama mengingat kecenderungan
rendah untuk berat badan yang berhubungan dengan ziprasidone. 62Mengingat
kemungkinan pemilihan fenomena, alokasi acak dari pasien adalah satu-satunya
pendekatan yang menyediakan kepastian perbandingan berisi antara kelompok-
kelompok. Pengacakan dari penetapan pengobatan adalah fitur kunci dari LST,
yang mengontrol untuk kekhawatiran dari hasil oleh faktor dikenal dan tidak
dikenal. Selanjutnya, besar ukuran penelitian memberikan daya yang
dibutuhkan untuk mengevaluasi risiko kecil, baik absolut maupun relatif.
Dengan mempertahankan kesederhanaan dalam prosedur penelitian, termasuk
kriteria inklusi / eksklusi penelitian, penggunaan obat pasien secara bersamaan
dan frekuensi pemantauan pasien, penelitian mendekati praktek kehidupan
nyata.

Hasil studi observasional ziprasidone untuk penderita jantung (ZODIAC)


Percobaan sederhana secara luas membandingkan keamanan kardiovaskular
dari ziprasidone dan olanzapine. Penelitian, melibatkan sekitar 18.000 pasien,
yangbelum pernah menjadi penelitian dalam kejiwaan, baik dalam ukuran dan
desain. Tujuan utama dari penelitian ini adalah untuk memperkirakan relatif
kematian yang bukan bunuh diri di kalangan pengguna ziprasidone dan
olanzapine. Tujuan sekunder untuk memeriksa penyebab lain kematian, dan
untuk memperkirakan relatif kejadian semua penyebab rawat inap dan rawat
inap untuk aritmia, infark miokard, atau ketoasidosis diabetes, dan untuk
menentukan tingkat penghentian pengobatan. Pasien dari 18 negara, Amerika
Serikat, Brasil, Argentina, Peru, Chili, Swedia, Hong Kong, Korea, Malaysia,
Singapura, Taiwan, Thailand, Hungaria, Polandia, Rumania, Slovakia, Uruguay,
dan Meksiko saat ini sedang terdaftar dari berbagai keadaan perawatan. Setelah
mendaftarkan dokter menentapkan kelayakan pasien dan memperoleh Informasi
persetujuan, informasi singkat, termasuk demografi, tingkat keparahan penyakit,
faktor risiko jantung, dan sebelum menggunakan obat anti-psikotik,
dikumpulkan pada dasar kuesioner. Berikut penetapan acak obat, tidak ada studi
lebih lanjut terkait intervensi, tes, atau kunjungan yang diperlukan. Dokter dan
pasien dapat mengubah rejimen dan penetapan dosis obat dari penelitian, dan
diperbolehkan menggunakan pengobatansecara bersamaan. Pasien diikuti
secara klinik yang sesuai dan hasil akhir yang dinilai selama sampai satu tahun.
Informasi mengenai status vital pasien dan apakah dia telah dirawat di rumah
sakit yang sedang memperolehtindak lanjut dengan dokter yang merawat atau
anggota lain yang ditunjuk dari tim perawatan medis. Penelitian ini memiliki
tiga komite independen: komite pengarah ilmiah yang bertanggung jawab untuk
pengawasan umum dari penelitian ini, sebuah data pemantauan keamanan
perlindungan penelitian peserta, dan komite hasil akhir, disamarkan untuk status
pengobatan, dan dibebanakan dengan menilai apakah peristiwa tersebut
dilaporkan memenuhi kriteria hasil akhir studi.

ZODIAC LST juga menghubungkan pengumpulan dataprimer dengan data


otomatis yang diperoleh dari program negara Medicaid (lihat bab 20), karena
beberapa pasien dalam penelitian ini biasanya menerima perawatan dari
Medicaid. Itu diakui tak lama setelah memulai penelitian bahwa dalam beberapa
kasus titik akhir sekunder beberapa penyebab rawat inap, atau rawat inap
dengan aritmia, infark miokardial atau diabetes ketoasidosis bisa jadi daftar
tidak diketahui oleh dokter atau angota tim penggobatan lain. Dalam rangka
untuk mengukur dampak potensial dari rawat inap yang tidak diketahui dalam
analisis sekunder, catatan rawat inap untuk pasien yang terdaftar dalam program
negara Medicaid di AS informasi yang dikumpulkan dari dokter akan
dihubungkan secara rahasia, jika pasien telah menyetujui untuk praktek ini.
Sensitivitas masing- masing hasil akhir rawat inap dapat diperkirakan dengan
menggunakan identifikasi rawat inap dalam catatan rawat inap Medicaid
sebagai kelompok pembanding lengkap (yaitu, standart penting).
Menghubungkan pengumpulan data primer dengan sumber data yang ada
adalah praktek penelitian yang harus meningkat di masa depan, dan merupakan
metode membangun pada kekuatan tertentu dari sumber data primer dan
sekunder.

Hasil latensi (interval waktu antara stimulus dengan respon yang diharapkan)
panjang
Metode epidemiologi memberikan satu satunya cara praktis untuk mempelajari
hubungan antara obat dan efek dengan periode latensi yang sangat panjang.
Penerima awal hormon pertumbuhan manusia (yang berasal dari jaringan
hipofisis kadaver manusia) ditemukan memiliki peningkatan resiko penyakit
Creutzfeldt- Jakob (CJD).63-67Hormon pertumbuhan rekombinan tersedia pada
pertengahan 1980- an, namun karena periode laten yang panjang untuk CJD,
kasus terus di diagnosis baik setelah waktu itu. Contoh lain dimana metode
epidemiologi digunakan untuk mengidentifikasi efek samping jangka yang lebih
panjang dari pengobatan, adalah asosiasi antipsikotik generasi pertama dengan
tardive dyskinesia.68

Kemoterapi kanker moderen hanya untuk anak telah digunakan sejak sekitar
tahun 1970 dan bawa baru- baru itu hanya cukup sejumlah besar anak- anak
yang sembuh dari kanker, memungkinkan untuk estimasi resiko jangka panjang
yang terkait dengan penggunaan agen sitotoksik. Studi epidemiologi
mempunyai dokumentasi diantaranya kumpulan leukimia iatogenik dan
penggobatan agen alkilasi atau apipodo- phllotoxins untuk kanker sebelumnya.
69,70
Neoplasma ganas kedua (dari jenis tumor padat) juga telah dikaitkan dengan
71,72
penggunaan agen alkilasi dan antibiotik anti tumor. Kemoterapi yang
diberikan kepada anak sebelum atau selama pertumbuhan remaja telah dikaitkan
dengan perlambatan pertumbuhan tulang dan hilangnya potensi tinggi badan. 73-
75
Penurunan kepadatan mineral tulang juga telah dilaporkan setelah
penggobatan kemoterapi dimasa anak- anak.

Orangdewasa yang berhasil dari kanker juga telah menjadi subjek penelitian
dengan meneliti hubungan antara kemoterapi dan efek akhir. Contohnya
termasuk temuan penurunan kepadatan mineral tulang pada wanita yang diobati
78
dengan agen sitotoksik untuk kanker payudara dan pada pria dan wanita
dirawat karena penyakit Hodgkin,79,80 yang mungkin karena efek langsung dari
pengobatan pada tulang, efek sekunder dimediasi melalui toksisitas gonad, atau
kombinasi dari keduanya.

Hasil evaluasi efek obat pada kehamilan dan kelahiran

Kecuali pengobatan yang sedang dikembangkan secara khusus untuk mengobati


kondisi terkait wanita hamil, umumunya wanita hamil dikecualikan dari uji
klinis untuk alasan etis, karena resiko potensial terhadap perkembangan janin
dan bayi yang baru lahir.81 Disamping itu, sebagian besar uji klinis dengan
daftar wanita pada studi kasus dari wanita hamiluntuk deteksi kehamilan.
Dengan demikian, pada saat pengenalan untuk pemasaran, efek dari banyak
obat pada kehamilan yang tidak baik dapat diketahui, dengan dasar keamanan
obat selama kehamilan sebagian besar sering berhenti pada studi toksikologi
reproduksi hewan. Ini adalah pertimbangan kesehatan masyarakat, terutama jika
obat tersebut akan digunakan oleh banyak wanita yang berpotensi melahirkan
anak, karenasekitar setengah dari seluruh kehamilan diluar AS tidak
direncanakan.82Sementara setelah pemasaran spontan merugikan kejadian
pelaporan hasil dari kehamilan dapat membantu unuk mengidentifikasi hasil
yang sangat langka yang terkait dengan penggunaan obat- obatan selama
kehamilan, keterbatasan data ini ditetapkan (lihat dibawah).

Metode epidemiologi juga telah digunakan untuk mempelajari kanker pada


individu yang terpapar obat dalam rahim, periconseptual atau segera setelah
lahir dan untuk menguji efek teratogenik dari berbagai agen (lihat juga bab 34).
Sebuah contoh klasik dari paparan dalam rahim adalah hubungan antara
penggunaan ibu dari DES dan sel-jernih adenokarsinoma pada vagina.83,84
Contoh lain termasuk kemungkinan asosiasi antara paparan sebelum lahirdari
metronidazole dan kanker pada anak,85 dan penggunaan dari obat penenang
selama kehamilan.86 Angka dari sebuah penelitian telah meneliti potensi
hubungan antara kanker pada anak dan paparan vitamin K pada periode
neonatal.87-90 Akhirnya, meskipun pengujian teratologi hewan adalah proses
sebelum percobaan dari semua obat, pertanyaan tentang kemungkinan
hubungan antara obat tertentu dan kelahiran cacat mungkin timbul pada periode
setelah pemasaran. Dalam kasus ini, metode epidemiologi yang diperlukan
untuk mengumpulkan dan mengevaluasi informasi nyata dalam populasi yang
menggunakan obat untuk memeriksa kemungkinan efek teratogenik. Studi
tersebut termasuk memeriksa penggunaan diazepam dan bibir sumbing,
penggunaan spermisida sindrom Down, hipospadias, dan penurunan dedormitas
anggota badan;92 dan penggunaan Bendectin dan bibir sumbing, cacat jantung
dan stenosis pilorus.93,94

Dalam keadaan tertentu pendaftaran digunakan untuk mendapatkan informasi


tentang keamanan obat baru selama kehamilan. Informasi yang diberikan saat
pendaftaran tersebut memungkinkan para profesional perawatan kesehatan dan
pasien untuk membuat pilihan yang lebih tepat tentang apakah akan
melanjutkan atau memulai penggunaan obat selama kehamilan, atau
memberikan jaminan terapi pada saat kehamilan, berdasarkan analisis manfaat-
resiko yang dapat terjadi pada setiap individu.

Daftar kehamilan biasanya tipenya prospektif dan observasional, dilakukan


secara aktif untuk mengumpulkan informasi tentang paparan obat selama
kehamilan dan hasil sesudah kehamilan. Seperti pendaftaran pasifyang berbeda
dari sistem pemasaran bahwa dalam mengumpulkan data dari sebelum wanita
mengetahui tentang hasil kehamilan, sebelum melakukan tindakan kedepan dari
paparan obat terhadap hasil kehamilan daripada mundur dari waktu hasil
kehamilan terhadap paparan obat, ini memiliki efek meminimalkan terjadinya
recall bias. Propesktiv alami dari design pendaftaran kehamilan biasanya
mereka juga melakukan pemeriksaan beberapa hasil kehamilan dalam studi
tunggal. Idealnya, pendaftaran akan kehamilan berdasarkan populasi, sehingga
meningkatkan generalisasi. Itu akan memungkinkan untuk penilaian sebab-
akibat yang kuat antara paparan obat dan hasil dari prospektiv alami. Dengan
mengumpulkan informasi tentang waktu paparan obat, jadwal detail
pengobatan, dan dosis, dari penggunaan standar dan definisi standar untuk hasil
kehamilan dan malformasi, dan dengan mencatat data dengan sistematik.
Idealnya pendaftaran juga mengikuti riwayat pengobatan- paparan wanita
setelah melahirkansampai dengan waktu yang lama, untuk mendeteksi setiap
malformasi tertunda pada anak- anak yang tampaknya normal saat lahir.
Akhirnya, pendaftaran kehamilan juga harus meberikan efek dari penggobatan
terhadap hasil kehamilan harus dibedakan dari jaminan penggobatan karena
efek keadaan penyakit jika dapat digunakan, hasil kehamilan. Idealnya, kriteria
pendaftaran memenuhi dua kelompok pembanding: wanita hamil yang tidak
memiliki penyakit dan tidak menjalani penggobatan yang sedang diteliti, dan
wanita hamil dengan penyakit yang tidak menjalani penggobatan atau yang
berbeda penggobatan. Namun dalam prakteknya, biasanya tidak layak untuk
memenuhi kriteria tersebut karena itu susah untuk daftar wanita hamil yang
tidak memiliki penyakit dan tidak menjalani penggobatan. Dengan demikian,
dalam banyak kasus, wanita hamil hanya dengan penyakit yang menggunakan
obat, atau penggobatan lainnya untuk penyakitnya, yang di ikuti.

Umumnya, ketika menganalisa data dari daftar kehamilan, kasus yang


diidentifikasi secara prospektif, misalnya pengetahuan sebelumnya tentang hasil
kehamilan, harus dipisahkan dari kasus- kasus yang diidentifikasi secara
retrospektif, misalnya hasil setelah kehamilan telah ditentukan oleh diagnosis
prenatal, aborsi, atau kelahiran, sebagai yang terakhir akan condong ke
pelaporan kelainan. Untuk meminimalkan penetapan bias, idealnya tingkat
resiko dihitung hanya dari kasus yang di identifikasi secara prospektif. Juga,
karena keegagalan menindak lanjuti dapat mewakili proporsi yang lebih tinggi
dari hasil kehamilan normal, peserta dalam daftar kehamilan harus secara
agresif diikuti untuk memperoleh hasil kehamilan yang lengkap.

Daftar paparan kehamilan yang ada termasuk yang menguji pengaruh obat
digunakan untuk kondisi medis tertentu, seperti infeksi HIV dan epilepsi, 96 serta
orang- orang yang meneliti efek kehamilan dari obat tertentu, misalnya
97
bupropion untuk depresi dan vaksin virus varisella untuk mencegah cacar
air.98 Daftar kehamilan mungkin disponsori oleh universitas berbasis kelompok
penelitian, dari agen pemerintah, dari perusahaan farmasi, atau dari upaya
kolaborasi dari semua bagian tiga entitas. Sementara standart metode
epidemiologi untuk estimasi resiko dari kehamilan hasil assosiasi dengan data
penggunaan obat dari daftar kehamilan belum disepakati, metode potensial telah
diusulkan dan menunggu validasi lebih lanjut.99Rilis terbaru oleh FDA untuk
pedoman penting mendirikan studi keamanan juga akan berjalan jauh ke arah
metode standarisasi untuk paparan daftar kehamilan, lebih meningkatkan utilitas
untuk pengambilan keputusan dan kesehatan masyarakat.100

Epidemiologi dan Manajemen Risiko

Epidemiologi sebagai landasan utama dalam bidang manajemen risiko dalam


perannya untuk mengidentifikasi dan menilai risiko (lihat Bab 35).
Epidemiologi telah digunakan untuk membantu memahami risiko yang melekat
pada populasi yang diamati, untuk memberikan pemahaman lebih lanjut dari
penyakit, untuk membandingkan tingkat penyakit antara obat, dan bahkan
dalam mengevaluasi efektivitas program yang dirancang untuk meminimalkan
risiko. Peran epidemiologi diilustrasikan dalam empat studi kasus manajemen
risiko yang terkenal disajikan dalam Angka 7,3-7,6.

PORTOFOLIO PERENCANAAN DAN PENGEMBANGAN


perencanaan produk adalah fungsi pentingyanginovatif dalam perusahaan
farmasi, karena kebutuhan perkembangan obat baru sertamenjanjikan pipa
produk. Epidemiologi memainkan peran kunci dalam perencanaan dan
mengembangkan proses. Misalnya, teknik epidemiologi dasar telah berguna
untuk mendefinisikan pasar potensial, untuk menentukan bagaimana obat
sebenarnya digunakan dalam populasi, dan untuk menentukan terpenuhi
kebutuhan kesehatan medis di masyarakat. Selanjutnya, metode epidemiologi
yang berguna untuk mempelajari kelompok berisiko tinggi seperti orang tua,
orang miskin, ibu hamil, memberikan pengetahuan pentingtentang manfaat
relatif dan risiko terapi pada populasi yang sangat jarang diteliti dalam uji
klinis.
Memperkirakan insiden dan prevalensi penyakit sangat penting untuk
mengevaluasi masa depan kebutuhan medis yang belum terpenuhi saat ini dan
diproyeksikan untuk obat dalam pembangunan. Data-data epidemiologi
memberikan informasi penting untuk keputusan tentang calon obat untuk
dikembangkan, karena potensi pasar obat merupakan pertimbangan penting
dalam perencanaan obat dan portofolio. Hal ini sangat relevan mengingat bahwa
pengembangan obat mengambil rata-rata delapan setengah tahun dan biaya rata-
rata $ 850 million.7 Of 10.000 setelah disaring ,senyawa hanya 250 yg masuk
uji praklinis, 5 uji klinis, dan satu disetujui oleh Sukses FDA.7,10

Sehingga perusahaan harus hati-hati memilih calon awal pipeline mereka untuk
kemajuan. Informasi mengenai kondisiepidemiologi deskriptif dapat
menyebabkan keputusan pada obat yakni "jalur cepat" atau mengajukan
permohonan persetujuan tentang orphan drug AS atauundang-undang.

Uni Eropa
studi epidemiologi pada prevalensinya, 118.119 merupakan sejarah, 120-123
merupakan frekuensi

komplikasi dari kondisi occur124 sangat penting untuk portofolio perencanaan


jangka panjang. Sumber daya yang kaya akan data dan tersedia untuk
kepentingan umum dari Pusat Nasional AS untuk Statistik Kesehatan, Badan
Kebijakan Kesehatan dan Penelitian, National Institutes of Health, dan lembaga
sejenis di luar AS, seperti Kantor Statistik Nasional di Inggris, dapat digunakan
untuk studi ini, atau sebagai alternatif, informasi ini mungkin berasal dari studi
berbasis populasi yang ditugaskan oleh industri menggunakan sumber data
primer atau sekunder, meskipun biaya dan waktu investasi jauh lebih tinggi.
studi epidemiologi juga digunakan untuk lebih memahami prevalensi regional
dan insiden penyakit, terutama di pasar negara berkembang di mana beban
penyakit sering buruk ditandai. Contohnya adalah studi Interasia (International
Collaborative Study Penyakit Kardiovaskular di ASIA), survei cross-sectional
yang dilakukan pada tahun 2000-2001 lebih dari 20.000 pria dan wanita, untuk
memperkirakan prevalensi dan distribusi faktor risiko penyakit kardiovaskular
pada perwakilan nasional sampel dari populasi umum di Cina dan Thailand.125
Interasia, independen yang dilakukan oleh sebuah lembaga akademis tetapi
didanai oleh perusahaan farmasi-ceutical, telah memberikan kontribusi
signifikan terhadap pemahaman yang lebih besar dari prevalensi faktor risiko
cardio-vascular dan penyakit di Asia 0,126 Selain prevalensi, studi
epidemiologi dapat memperkirakan beban (biaya dan cacat) terkait dengan
kondisi tertentu, menyediakan data membantu untuk menilai obat untuk pasien
dan masyarakat

POLA PENGOBATAN PENGGUNAAN DAN EFEK OBAT


Setelah obat disetujui, metode epidemiologi dapat digunakan untuk memantau
penggunaan dan jenis pasien yang menerima obat. studi observasional mungkin
informatif untuk frekuensi off-label yang menggunakan 127 dan penggunaan
berbagai metode Epidemiologi medi-cations.128,129 database

Survei Perawatan Ambulatory Medis Nasional dapat digunakan untuk


memantau tren dalam resep tertentu secara vertikal, perubahan karakteristik
pengguna dari waktu ke waktu, 130.131 atau untuk mempelajari pola
penggunaan obat antara populasi berisiko tinggi, seperti orang tua dengan
impairment.132 kognitif metode ini juga digunakan untuk mengukur efek
menguntungkan dari obat (lihat juga Bab 42). Studi akhir-poin mungkin
berbeda dari hasil seperti kesejahteraan atau kualitas hidup (lihat Bab 44) pada
variabel kuantitatif seperti tingkat tekanan darah, langsung dan / atau tidak
langsung biaya penghematan-temuan, dan pemanfaatan sistem perawatan
kesehatan. studi pasca-persetujuan manfaat yang sangat relevan ketika uji klinis
telah difokuskan pada langkah-langkah pengganti efikasi, dan ada keinginan
untuk mengetahui informasi lebih lanjut mengenai dampak obat pada kematian
atau hasil kesehatan jangka panjang lainnya.

Metode epidemiologi juga semakin digunakan untuk melaksanakan studi


ekonomi (lihat juga Bab 43). studi ekonomi kesehatan yang berguna untuk obat
pemasaran ketika produsen dapat menunjukkan bahwa penggunaan produk
adalah sama efektif tetapi lebih murah daripada pesaing. Studi-studi ini dapat
digunakan untuk membenarkan masuknya nama merek produk pada
formularium organisasi pemeliharaan kesehatan (HMO), rumah sakit, dan
program Medicaid negara. Studi terbaru termasuk keuntungan ekonomi dari
penambahan selective serotonin reuptake inhibitor untuk mempercepat
meningkatkan-ment depresi, 133 biaya-efektivitas beberapa agen untuk
hipertensi, 134 penyelidikan efektivitas biaya pengobatan untuk ringan sampai
sedang penyakit Alzheimer , 135 pengukuran biaya langsung dan tidak
langsung dari mengobati rhinitis alergi, 136 dan kualitas hidup dan kesehatan
serta manfaat secara ekonomi, termasuk produktivitas kerja, terkait dengan
peningkatan control.137 glikemik

ISU DALAM Pharmacoepidemiology

SUMBER DAYA UNTUK Pharmacoepidemiology

Dalam rangka untuk merespon dengan cepat dan bertanggung jawab untuk
masalah keamanan, kualitas tinggi, sumber data yang valid harus tersedia.
Sebagai hasil dari kebutuhan ini, pengembangan dan penggunaan catatan
linkage dan database otomatis, termasuk database rumah sakit yang telah
mengalami pertumbuhan yang cukup besar selama dua dekade terakhir (lihat
Bab 15-24). database ini menawarkan beberapa keunggulan dibandingkan studi
epidemiologi atau memperluas ruang lingkup uji klinis. Pertama, database
otomatis biasanya besar dalam ukuran, mulai dari ratusan ribu hingga jutaan
pasien, seringkali dengan bertahun-tahun "pengamatan". Keuntungan kedua
adalah cepat; karena informasi tentang subyek penelitian sudah
terkomputerisasi, data dapat diakses dengan cepat daripada menunggu bertahun-
tahun untuk hasil studi di mana pasien diidentifikasi dan diikuti dari waktu ke
waktu. Keuntungan ketiga adalah biaya lebih efisien terhadap studi prospektif.
uji klinis atau studi observasional prospektif lain mungkin biayanya jutaan
dolar, dibandingkan dengan ratusan ribu dolar untuk studi basis data.

kemajuan padapengembangan database penelitian yang baru dan sudah ada


yang berisi informasi tentang penggunaan obat dan hasil yang berhubungan
dengan kesehatan. Ini adalah Advanta-geous terdiri dari berbagai sumber data
yang diperlukan untuk penelitian di pharmacoepidemiology. Banyak
keterbatasandataset otomatis yang perlu dipertimbangkan sebelum melakukan
studi tentang obat baru yang dipasarkan. Setiap sumber data akan memiliki
kekuatan dan keterbatasan sendiri, yang biasanya berhubungan dengan faktor-
faktor penting: alasan untuk mengumpulkan data (misalnya, penelitian,
pemantauan praktek klinis, atau penggantian); jenis data yang dikumpulkan dan
sistem coding; sumber daya yang ditujukan untuk mengevaluasi dan memantau
kualitas penelitian data; variasi dan nasional atau regional dalam praktek medis.
Keterbatasan penelitian umum dari sumber data otomatis adalah bahwa jumlah
yang cukup dari pengguna mungkin belum direkam, atau obat tidak dapat
dipasarkan di negara dimana database berada. Beberapa sumber data yang "lag-
time" antara entri data dan ketersediaan untuk tujuan penelitian. Selanjutnya,
meskipun banyak organisasi pemeliharaan kesehatan sudah mendaftarkan
keseluruhan ratusan ribu anggota, angka-angka ini mungkin tidak memadai
untuk mempelajari risiko terkait dengan obat sangat langka tertentu atau tidak
terdapat dalam database penelitian HMO. Akhirnya, hasil dari sumber-sumber
ini sering terbatas dalam generalisasiBanyak dari sistem pengumpulan data ini
dirancang untuk tujuan administratif, bukan untuk studi penelitian epidemiologi.
Akibatnya, informasi yang dibutuhkan untuk menilai masalah keamanan
tertentu mungkin tidak tersedia dan kualitas informasi medis mungkin tidak
memadai. Sering diinginkan untuk memvalidasi temuan hanya berdasarkan
kode diagnostik atau prosedural yang digunakan untuk tujuan penggantian
melalui tinjauan rinci setidaknya subset dari catatan medis, seperti kegunaan
dari jenis penelitian untuk menjawab pertanyaan penting yang mungkin terbatas
jika data tidak benar divalidasi.

Beberapa database, ulasan rekam medis mungkin tidak layak karena


kekhawatiran tentang kerahasiaan pasien atau anonimitas, terutama setelah
undang-undang baru disahkan pada privasi catatan kesehatan (HIPPA).
Melanjutkan studi validitas penelitian database ini sangat penting, dan harus
dikejar saat feasible.138-142

JURU pharmacoepidemiology

STUDI

Hati-hati, penelitian ilmiah dilakukan dengan menggunakan sumber daya


berkualitas tinggi DAN tidak menjamin bahwa temuan studi ini akan tepat
ditafsirkan. Dengan asumsi bahwa masalah keamanan telah ditangani dengan
menggunakan sumber daya yang tepat data, temuan studi masih dapat
ditafsirkan atau disalahgunakan. Ini memiliki implikasi untuk industri farmasi
dan pasien yang kehilangan akses ke obat yang bermanfaat dan aman. lembaga
regulator juga harus mencurahkan sumber daya yang langka untuk
mengevaluasi isu-isu keselamatan yang salah untuk membuat keputusan regu-
latory, dan dengan dampak interpretasi ini terhadap kepercayaan publik dalam
proses regulasi. Pada akhirnya, yang merugikan telah dilakukan kepada publik
dengan menghasilkan ketakutan yang tidak beralasan, oleh penghapusan obat
yang aman dan efektif, dan dengan biaya yang lebih tinggi untuk obat-obatan

Media Salah tafsir mengenai hasil epidemiologi yg mungkin berdampak pada


obat di pasaran sehingga obat yang memiliki efek yg baik ditarik dari pasar.
BendectinTM, digunakan untuk mual selama kehamilan, di AS dari tahun 1956
melalui 1983. Produsen sukarela menarik diri obat dari pasar pada tahun 1983
karena biaya membela sejumlah besar tuntutan hukum kewajiban produk
diajukan berikut publisitas yang luas yang mengisyaratkan bahwa obat itu
teratogenik. Sejumlah penelitian epidemiologi dalam berbagai pengaturan
dengan berbagai desain yangdilakukan untuk memeriksa masalah ini. Hasil
tidak mendukung kecurigaan bahwa BendectinTM adalah teratogen Karena
penarikannya, obat ini tidak lagi tersedia untuk 10-25% dari semua wanita
hamil yang berpotensi menggunakannya.145 nya Neutel melaporkan bahwa,
pada tahun berikutnya penarikan BendectinTM dari pasaran, dan untuk muntah
pada kehamilan (per seribu kelahiran hidup) di Kanada naik 37% dan 50%
setelah itu, dengan temuan serupa di AS.

Berikut penarikan (1983-1987) adalah $ 16 juta pada Kanada dan $ 73 juta di


US.
Salah tafsir dari studi epidemiologi melanggengkan kesan bahwa disiplin ini
lemah dengan menghasilkan kontroversi atas hasil studi.

Dalam keadaan seperti itu, kelemahan dari studi ini menekankan dan kekuatan
disiplin diabaikan. Akibatnya, informasi yang memberikan kontribusi
epidemiologi dapat berfungsi sebagai kegunaan kini dipertanyakan. pemahaman
yang lebih besar dari kekuatan dan keterbatasan epidemiologi yang dibutuhkan
oleh masyarakat, media, pemerintah, dan sering oleh industri itu sendiri.
Kelompok-kelompok yang beragam memiliki kepentingan umum dan, melalui
upaya bersama mereka, disiplin pharmacoepidemiology dapat ditingkatkan
dengan memfokuskan dukungan, menilai kualitas penelitian, dan memajukan
pemahaman yang lebih besar dari lapangan.

Hubungan antara ilmu pengetahuan dan industri juga berkontribusi terhadap


salah tafsir dari hasil penelitian, dan menyebabkan ketidakpercayaan
perusahaan farmasi, kemitraan akademik-industri telah ada sejak awal abad
kedua puluh, tapi tujuan utama mereka awalnya adalah mengembangkan
kemampuan penelitian dalam industri farmasi muncul. Setelah Perang Dunia
kedua, dan karena sebagian besar pendanaan pemerintah penelitian biomedis
melalui National Institutes of Health (NIH), hubungan ini menurun. Tahun
1980-an menyaksikan kebangkitan pendanaan industri dengan mendatarkan
anggaran NIH dan diberlakukannya Undang-Undang Bayh-Dole di 1980147.
Hubungan akademik-industri yang diikuti telah jelas menghasilkan manfaat
bagi masyarakat, khususnya yang lebih tepat waktu dan efektif transfer
teknologi, tetapi terganggu oleh kekhawatiran tentang biasnya peneliti dan
kegagalan untuk berkomunikasi yang hasilnya memadai dalam beberapa kasus.

lembaga akademis, NIH, dan perusahaan telah merespon masalah .Namun,


aturan di tempat dan proses yang digunakan untuk mengelola potensi konflik
kepentingan bervariasi secara signifikan. Sekarang secara umum diakui bahwa
ada kebutuhan untuk pengungkapan kepentingan keuangan, dan sering batas
peneliti memiliki kepentingan keuangan yang signifikan dalam perusahaan yang
mendukung penelitian mereka. Di masa depan, konflik kepentingan selain
keuangan juga harus diperiksa, termasuk rekan atau pengakuan kelompok,
kemajuan karir, atau afiliasi politik. Untuk penelitian klinis juga penting untuk
memastikan bahwa proses yang sesuai berada di tempat untuk menjaga
penelitian par-ticipants dan kerahasiaan mereka. rekomendasi rinci tentang
proses-proses ini, seperti kapan dan bagaimana untuk mengadakan Data
Keselamatan Pemantauan Boards atau pedoman untuk Penelitian di
pharmacoepidemiology, saat ini tersedia pada bimbingan lebih lanjut yang
diperlukan untuk membantu, universitas, dan lembaga regulator dalam
mendefinisikan jenis konflik kepentingan, khususnya konflik selain keuangan

Industri harus berperan aktif dalam penciptaan dan pengembangan sumber daya
yang diperlukan untuk secara sah dan cepat mengatasi pertanyaan keamanan.
Bidang penting untuk dukungan oleh industri di tahun-tahun mendatang adalah:
pemeliharaan sumber data yang ada; penciptaan sumber data baru;
pengembangan dan validasi metode epidemiologi baru diterapkan untuk
epidemiologi obat; dan program pendidikan dan pelatihan di
pharmacoepidemiology.

Dukungan industri sangat penting untuk pengembangan sumber daya database


baru.kelompok penelitian mungkin memiliki akses ke berbagai jenis informasi,
tetapi tidak memiliki sumber daya keuangan untuk mengembangkan informasi
ke dalam database yang dapat digunakan. perusahaan farmasi yang aktif
mencari sumber data baru tidak harus mengabaikan sumber-sumber potensial
informasi berharga dan, di mana keadaan memungkinkan, memberikan
bimbingan dan pendanaan untuk pengembangan sumber daya data yang layak.
Data hubungan antara database yang ada daerah lain di mana dukungan industri
secara langsung mempromosikan pertumbuhan sumber daya penelitian melalui
dukungan keuangan.

Pengembangan desain studi baru dan metode dalam pharmacoepidemiology


juga harus terus berlanjut, dan ini adalah area di mana industri juga mungkin
memainkan peran.metode baru yang diperlukan untuk bertambah sejumlah
besar individu pada rejimen terapi tertentu dengan cepat dan dapat mengikuti
prospektif mereka untuk mengidentifikasi dan mengukur hasil kesehatan yang
bermanfaat dan buruk yang terkait dengan obat baru.Epidemiologi bekerja
dalam perusahaan farmasi juga harus mengikuti perkembangan desain studi
baru atau pendekatan untuk metode berbasis data untuk mengendalikan
pembaur, seperti skor kecenderungan, yang menawarkan metode ditingkatkan
untuk mengevaluasi risiko dan keselamatan terkait dengan produk
farmasi.Misalnya, publikasi terbaru telah menggunakan desain kasus-crossover
untuk menyelidiki hubungan antara kecelakaan lalu lintas jalan dan penggunaan
benzodiazepine, 152 desain kasus-waktu-kontrol untuk belajar cacat lahir.
Akhirnya, terdapat sejumlah program pelatihan formal di
pharmacoepidemiology di universitas, meskipun jumlah dan ruang lingkup
program ini telah meningkat dalam beberapa tahun terakhir.Dalam rangka untuk
memenuhi meningkatnya kebutuhan industri, badan pengatur, dan universitas
sehubungan dengan ahli epidemiologi terlatih, industri farmasi harus
meningkatkan peran mereka dalam mendukung program-program pelatihan dan
beasiswa.Dukungan tersebut menjamin jumlah yang cukup sebagai ahli
epidemiologi dengan keahlian dalam evaluasi keamanan obat sementara juga
menyediakan struktur untuk pelaksanaan penelitian pharmacoepidemiologic
berkualitas tinggi.

ASOSIASI PROFESIONAL DAN UPAYA PENELITIAN


COLLABORATIVE

Forum ilmiah untuk pertukaran hasil penelitian baru dan kesempatan untuk
komunikasi antara individu dan organisasi dengan perspektif yang berbeda
sangat penting untuk memajukan bidang pharmacoepidemiology. Sejumlah
tempat memberikan kesempatan bagi perwakilan industri untuk bekerja sama,
seperti Asosiasi Riset dan Manufaktur Farmasi (PhRMA), dan bekerja dengan
anggota pihak berwenang di seluruh dunia pada isu-isu kepentingan bersama
(Dewan Organisasi Internasional Ilmu Kedokteran (CIOMS )). Akademik, para
ilmuwan berdasarkan industri, dan otoritas juga mengkomunikasikan hasil-hasil
penelitian dengan satu sama lain melalui Masyarakat Internasional untuk
Pharmacoepidemiology (ISPE) dan Pusat Pendidikan dan Penelitian
Therapeutics (CERT).

Menggabungkan upaya penelitian di perusahaan farmasi menguntungkan


perusahaan, regulator, dan masyarakat melalui penciptaan atau peningkatan
sumber daya data bersama dan metode epidemiologi. Contoh terbaru dari jenis
usaha yang dijelaskan pada Gambar 7.7, yang menguraikan sejarah kolaborasi
unik antara produsen obat antiretroviral untuk pengobatan HIV / AIDS, AS dan
badan pengatur Eropa, akademisi, dan pendukung pasien.

FARMAKOGENOMIK

Farmakogenomik memiliki potensi untuk mengubah praktek medis, dan resep


farmasi, dengan memahami bagaimana variabilitas genetik mempengaruhi cara
di mana orang menanggapi obat.162 farmakogenomik meneliti variabilitas gen
(misalnya, gen metabolisme polimorfisme) yang mendikte respons obat dan
membahas cara-cara ini variasi dapat beused untuk memprediksi bagaimana
pasien akan merespon obat.Dengan mengetahui bagaimana pasien yang berbagi
profil gen tertentu akanmemberikan respon terhadapi obat itu akan mungkin
untuk menyesuaikan terapi obat untuk populasi tertentu atau bahkan individu.Di
masa depan, berdasarkan pengetahuan ilmiah dan label yang tepat tentang yang
obat untuk meresepkan, dokter mungkin dapat mengelola tes genetik yang akan
menunjukkan obat yang tepat sesuai dengan profil pasien. Meskipun ilmu ini
masih dalam masa pertumbuhan, perkembangan kelompok farmakogenomik
dalam industri memberikan anopportunity untuk epidemiologi dengan keahlian
dalam genetika secara signifikan berkontribusi pada tahap awal pengembangan
obat.(Lihat juga Bab 39.)

FDA menyetujui Geodon / Zeldox (ziprasidone) untuk pengobatan skizofrenia


pada bulan Februari 2001. Awalnya NDA untuk Geodon ditolak pada bulan
Juni 1998 berdasarkan "penilaian bahwa Geodon memperpanjang QTc dan
bahwa ini merupakan risiko aritmia ventrikel yang berpotensi fatal yang tidak
sebanding dengan keuntungan yang ditunjukkan dan cukup Geodon lebih sudah
dipasarkan produk obat antipsikotik " 101 surat non-persetujuan
direkomendasikan bahwa sponsor melakukan studi tambahan untuk menentukan
efek QTc dari Geodon pada konsentrasi plasma puncak dibandingkan dengan
atipikal antipsikotiklainnya dan dengan beberapa antipsikotik standar.
Sponsor melakukan studi klinis komparatif enam antipsikotik yang
menunjukkan selang QTc Geodon ini steady state adalah 10 milidetik lebih
besar dari haloperidol, quetiapine, olanzapine dan risperidone dan sekitar 10
milidetik kurang dari thioridazine; lebih lanjut, hasil yang sama di hadapan
sebuah inhibitor.102 metabolisme Mengikuti 1.998 non-persetujuan, sponsor
juga melakukan studi deskriptif dan komparatif epidemiologi untuk mengukur
risiko kematian dan penyakit jantung di antara pasien skizofrenia menerima
farmakoterapi, dan dirancang inovatif studi postapproval untuk menilai
keamanan Geodon.

Sejumlah penelitian telah mendokumentasikan bahwa pasien dengan skizofrenia


memiliki tingkat kematian lebih tinggi daripada populasi umum, tetapi beberapa
telah diperiksa jika angka ini berubah setelah pengenalan antipsikotik atipikal.
Sebelum persetujuan, dan sebagai bagian dari program epidemiologi Geodon,
sponsor melakukan dua studi deskriptif epidemiologi: satu di Amerika Serikat
digunakan Inggris Healthcare Research Database103 dan lain di Kanada
digunakan database.104 Saskatchewan Kesehatan Hasil menegaskan bahwa
pasien dengan skizofrenia memiliki latar belakang yang lebih tinggi tingkat
hasil mortalitas dan kardiovaskular, terlepas dari jenis pengobatan.

Ilmu Perbandingan Epidemiologi

Dalam upaya untuk menentukan "dunia nyata" efek dari penggunaan QTc
memperpanjang obat di antara pasien skizofrenia, sponsor melakukan dua studi
epidemiologi perbandingan: satu data yang digunakan dari system105 US
Medicaid dan lain digunakan Database General Practice Research dari Inggris
106 studi ini dibandingkan antipsikotik dengan berbagai kecenderungan untuk
QTc perpanjangan, dari rendah ke tinggi: haloperidol, risperidone, clozapine
dan thioridazine. Hasil penelitian menunjukkan bahwa tingkat kematian dan
jantung peristiwa mendadak yang serupa di antara pengguna dari haloperidol,
clozapine, risperidone dan thioridazine dosis rendah, dan bahwa pengguna
thioridazine dosis tinggi memiliki tingkat lebih tinggi dari peristiwa ini.

Pasca-persetujuan Keselamatan Studi: ZODIAC besar Percobaan Sederhana

Ziprasidone observasional Studi Jantung Hasil (ZODIAC) adalah percobaan


sederhana besar yang dirancang untuk menguji keamanan kardiovaskular 'dunia
nyata' dari ziprasidone dibandingkan dengan olanzapine. Karakteristik
mendefinisikan ZODIAC meliputi:

Calon studi cukup besar untuk mendeteksi risiko kecil: 18.000 pasien saat ini
dari 18 negara: Amerika Serikat, Swedia, Brasil, Argentina, Peru, Chili, Hong
Kong, Korea, Malaysia, Singapura, Taiwan, Thailand, Hungaria, Polandia,
Rumania, Slovakia, Uruguay, dan Meksiko

Kontrol untuk menyalurkan Bias dengan menggunakan 1: 1 tugas acak untuk


ziprasidone atau olanzapine

Tidak ada monitoring studi tambahan atau tes yang diperlukan setelah
pengacakan

Pasien ditindaklanjuti selama perawatan biasa selama 12 bulan

Poin terakhir: primer - kematian (semua penyebab, bunuh diri, non-bunuh diri,
kardiovaskular, kematian mendadak); -hospitalizations sekunder (semua
penyebab, infark miokard, aritmia, ketoasidosis diabetikum)

Desain ZODIAC membawa beberapa keunggulan dibandingkan observasional


desain studi postmarketing lebih umum digunakan.alokasi acak pasien
menyediakan untuk perbandingan antara kelompok-kelompok; ukuran studi
besar memberikan daya yang dibutuhkan untuk mengevaluasi risiko kecil, baik
relatif dan mutlak; dan kesederhanaan percobaan terkontrol meminimalkan
kesemuan yang dikenakan oleh uji premarketing terkontrol. ZODIAC dimulai
pada tahun 2002 dan sejauh acak lebih dari 10.000 pasien.

Poin kunci:

studi epidemiologi deskriptif dapat digunakan untuk menetapkan tarif dasar


penyakit pada populasi pasien dan studi epidemiologi komparatif dapat
mengukur efek samping dari obat untuk indikasi yang sama

studi prospektif epidemiologi, seperti percobaan sederhana besar, dapat


digunakan untuk mengevaluasi risiko yang berpotensi kecil dalam konteks
"dunia nyata"

FDA menyetujui Accutane (isotretinoin) untuk pengobatan lini kedua jerawat


alami yangmembandel parah pada tahun 1982.Sementara teratogenic terhadap
manusia, Accutane tidak diketahui pada saat pengenalan obat ke pasar, data
praklinik yang tersedia menyarankan bahwa efek teratogenik mungkin sebagai
pengaman isu.Dengan demikian, kotak peringatan hitam termasuk dalam label,
menentukan bahwa Accutane tidak digunakan selama kehamilan dan
merekomendasikan kontrasepsi bagi perempuan anak bantalan potensial.

Laporan spontan kelainan bawaan pada bayi dari pengguna Accutane


peluncuran berikut jelas mendirikan teratogenicity manusia terhadap
obat.Laporan spontan menyarankan pelabelan saat ini saja tidak efektif untuk
mencegah individu kontraindikasi dari menggunakan Accutane. Setelah 1988
pertemuan Komite Penasehat Dermatologic Narkoba, FDA memutuskan
Kehamilan Program Pencegahan (PPP) harus dilaksanakan, menargetkan dokter
diidentifikasi sebagai resep Accutane dan pasien mereka, dan menyediakan
mereka dengan berikut:

• Pedoman untuk meresepkan Accutane, termasuk tes kehamilan


• Sebuah daftar kualifikasi pasien

• Sebuah brosur informasi pasien

• Informasi tentang kontrasepsi

• Detail mengenai program penggantian pasien rujukan kontrasepsi

• Suatu bentuk persetujuan pasien

Efektivitas PPP dievaluasi dengan survei berkelanjutan wanita yang diobati


dengan Accutane, yang dipantau tingkat kehamilan dan hasil, kesadaran pasien
dari risiko, dan perilaku pasien.Sebuah studi pelacakan dokter meresepkan
Accutane juga dilakukan secara paralel, untuk mengikuti perilaku dokter.
Selanjutnya, pada tahun 1989, sponsor Accutane mulai mendistribusikan obat
secara eksklusif di 10-kapsul kemasan blister termasuk peringatan merah dan
hitam, bersama dengan gambar bayi cacat dan simbol "Hindari Kehamilan"

Meskipun pelaksanaan PPP dan modifikasi kemasan untuk Accutane, eksposur


kehamilan lanjut. Selain itu, laporan dari penurunan efisiensi dari kontrasepsi
oral pada wanita mengambil yang menggunakan Accutane diminta FDA untuk
merekomendasikan perubahan label pada tahun 1994, menekankan bahwa
perempuan usia subur taking Accutane harus menggunakan dua bentuk
kontrasepsi yang dapat diandalkan (misalnya kontrasepsi oral ditambah metode
barrier) secara bersamaan.

Hasil yang dipublikasikan pada tahun 1995 dari survei pasien PPP yang sedang
berlangsung menunjukkan bahwa tingkat kehamilan antara pasien perempuan
secara substansial lebih rendah dari tingkat kalangan perempuan usia subur.
Namun, lebih banyak data terbaru dari survei ini dan studi pelacakan dokter
juga menunjukkan persentase yang tinggi dari dokter dan perempuan tidak
sesuai dengan komponen inti dari PPP.108 Menanggapi temuan ini, pertemuan
Dermatologic dan Komite Penasehat Obat Mata diselenggarakan pada tahun
2000, di mana FDA meminta bentuk diperkuat dari PPP, Sistem untuk
Mengelola Accutane-terkait Teratogenisitas (SMART).

SMART membutuhkan dokter yang meresepkan isotretinoin untuk mempelajari


"Panduan untuk Best Practices" dan kembali "Surat Kesepahaman" sertifikasi
pemahaman mereka tentang materi; setelah melakukan hal yang bisa mereka
mendapatkan diri perekat Accutane Kualifikasi Stiker yang harus melekat pada
semua resep baru. Dokter juga dapat memperoleh stiker dengan menyelesaikan
setengah hari terus saja pendidikan kedokteran. Stiker menunjukkan kepada
apoteker bahwa pasien memenuhi lima kriteria yang ditentukan dan, dengan
demikian, "memenuhi syarat" untuk menerima Accutane.SMART juga
membutuhkan apoteker untuk memberikan Accutane hanya pada penyajian
resep ditulis dengan Accutane Kualifikasi Sticker melekat dan dispensings
mungkin tidak lebih dari satu bulan pasokan dalam waktu tujuh hari dari tanggal
"kualifikasi."Apoteker juga harus menyediakan Panduan Pengobatan untuk
semua pasien.

Program SMART saat ini sedang dievaluasi oleh analisis epidemiologi dari data
yang dikumpulkan untuk survei pasien yang sedang berlangsung, hasil yang
subjek dari pertemuan bersama 2004 FDA Obat Keselamatan & Manajemen
Risiko dan Dermatologic &Komite PenasehatObat Kedokteran.

Poin kunci:

Sebuah obat dengan risiko dapat dibuat tersedia untuk pasien dengan
menerapkan program manajemen risiko yang komprehensif diberikan
keseimbangan keuntungan-resiko yang menguntungkan.

program manajemen risiko harus terus dievaluasi untuk menentukan apakah


mereka mencegah hasil yang tidak diinginkan, menggunakan metode penelitian
epidemiologi mana yang sesuai.
Penelitian lebih lanjut untuk menentukan apakah program-program seperti
SMART dapat dilaksanakan, atau efektif dalam mengelola risiko untuk pasien
sambil memastikan akses yang tepat untuk obat baru, diperlukan.

Nama : Tira Julia

Nim : 201310410311223

Kelas : Farmasi-A

FDA menyetujui Lotronex (Alosetron) untuk diare predominan sindrom iritasi


usus (IBS) untuk wanita pada Februari tahun 2000. Obat mencapai penerimaan
pasar dengan cepat, dengan 130.000 resep mengisi penuh untuk obat pada akhir
mei tahun 2000.

Pada juni tahun 2000 terjadi akumulasi spontan laporan kejadian serius untuk
Lotronex. Termasuk empat laporan komplikasi sembelit, lima laporan tentang
iskemik dan dua laporan tentang hepatik abdomalis. FDA didesak untuk
mengadakan pertemuan Komite penasihat tentang sebuah laporan obat saluran
pencenaan untuk meninjau persetujuan dari Lotronex. Pada pertemuan tersebut,
kurangnya data epidemiologi tentang latar belakang risiko komplikasi dari
sembelit dan iskemik kolitis pada pasien IBS sehingga sulit untuk memberikan
konteks laporan spontan untuk diamati. FDA menyatakan bahwa hanya 20%
dari wanita dengan diare-dominan IBS cenderung mendapat manfaat langsung
dari lotronex dan dianjurkan bahwa obat akan ditargetkan hanya digunakan
untuk para wanita yang paling mungkin untuk merespon pengobatan. Sponsor
mengusulkan rencana pengelolaan risiko untuk lotronex, terdiri dari tiga
komponen berikut:

1. resiko definisi dimensi, termasuk melakukan epidemiologi, klinis dan


mekanistik belajar untuk mengevaluasi dan quantifity risiko dan
mengidentifikasi faktor risiko untuk kejadian merugikan.
2. program komunikasi yang ditargetkan untuk dokter, apoteker dan pasien.

3. evaluasi program komunikasi digabungkan dengan pemantauan resep melalui


dan HMO databese.

Setelah pertemuan Juni 2000, "Panduan obat" untuk pasien dikembangkan,


untuk membantu memastikan bahwa wanita yang menggunakan lotronex akan
memahami risiko serius Lotronex tapi jarang dan bagaimana mereka bisa
mengenali mereka risiko dan bertindak dini untuk mencegah komplikasi serius.
Lotronex label untuk profesional kesehatan juga diubah untuk lebih kuat
menunjukkan potensi efek samping pengobatan serta mencoba untuk
menentukan pasien yang lebih mungkin untuk memperoleh manfaat dari obat.
'untuk profesional perawatan kesehatan' dan 'untuk apoteker' surat dikirim oleh
sponsor untuk menyorot label perubahan ini.

Meskipun upaya manajemen risiko ini, pada november 2000, 49 kasus iskemik
ulserativa dan 21 kasus sembelit yang parah telah dilaporkan untuk Lotronex,
dengan sepuluh kasus yang mengakibatkan kematian. Sebagai tanggapan, FDA
mengadakan Rapat Komite Penasehat lain pada november 2000. tidak dapat
menyetujui rencana pengelolaan risiko yang layak dengan FDA. Sponsor
menarik Lotronex dari pasar pada akhir november 2000.

Tahun-tahun berikutnya, IBS pasien yang telah berhasil menggunakan Lotronex


dan profesional kesehatan mereka melobi FDA dan sponsor dengan Surat
meminta reintroducing dari Lotronex. Setelah diskusi dengan FDA, sponsor
mengajukan tambahan aplikasi obat baru Lotronex pada Desember 2001 untuk
persetujuan Lotronex pemasaran terbatas untuk wanita dengan diare-dominan
IBS yang refactory pengobatan dengan terapi lain. FDA menyetujui
reintroducing Lotronex di bawah kondisi terbatas pada bulan Juni 2002, sponsor
setuju untuk mengimplementasikan rencana manajemen risiko baru, terdiri dari
lima komponen:
1. Sebuah program prescribring dokter.

2. Sebuah program pendidikan yang komprehensif untuk dokter, apoteker dan


pasien.

3. Sistem pelaporan dan koleksi untuk serius peristiwa buruk berhubungan


dengan menggunakan Lotronex.

4. Melakukan studi epidemiologi untuk lebih jelas menentukan risiko untuk


pencernaan kejadian buruk pada pengguna Lotronex.

5. Rencana untuk mengevaluasi efektivitas program manajemen resiko


Lotronex, memanfaatkan penelitian epidemiologi.

A view from indrusty

Kesimpulan

Epidemiologi membuat kontribusi yang signifikan untuk pengembangan dan


pemasaran produk farmasi yang aman dan efektif worldwide.it factiliates
proses pengaturan dan menyediakan dasar rasional untuk evaluasi keamanan
obat, khususnya pada fase pasca persetujuan. seperti setiap disiplin lain, itu
harus dipahami dengan baik dan tepat dimanfaatkan. industri memiliki
kesempatan untuk berkontribusi pada pengembangan lapangan dan tanggung
jawab untuk melakukannya dalam marmer yang memperluas sumber daya
sementara memastikan ilmiah berlaku. mencapai tujuan ini membutuhkan
dukungan keuangan dan intelektual serta pemahaman yang lebih baik dari
sifat disiplin dan penggunaannya. dengan berlalunya undang-undang PDUFA
III, kebutuhan untuk ilmuwan dengan pengalaman pelatihan dan riset di
pharmacoepidemiology belum pernah lebih besar. epidemiologi dalam
industri memiliki kesempatan untuk membangun pada keberhasilan dari dua
puluh tahun oleh memajukan metode evaluasi keamanan obat dan manajemen
risiko, dan menerapkan desain epidemiologi dan meto daerah-daerah baru
dalam industri.

FDA menyetujui Propulsid (Cisapride) untuk pengobatan Heartburn nokturnal


yang berhubungan dengan gastroesophageal refluks penyakit (GERD) pada
Agustus 1993. Uptake obat cepat, dengan kira-kira 5 juta resep pasien yang
keluar ditulis pada tahun 1995. Selama periode waktu yang sama, FDA
menerima laporan spontan 34 torsades de pointes, 23 dari perpanjangan
interval QT, termasuk kematian empat, antara pasien yang menggunakan
Propulsid.

Sebagai tanggapan, FDA menambahkan 'kotak hitam' label peringatan pada


tahun 1995, perhatian terhadap penggunaan jika kontraindikasi obat karena
risiko aritmia jantung yang berpotensi fatal. produsen diikuti dengan huruf
"untuk tenaga kesehatan profesional" menjelaskan perubahan label.

Meskipun upaya ini, laporan spontan jantung abdomalities terkait dengan


Propulsid terus meningkat, menghasilkan empat tindakan:

1. Perluasan peringatan 'kotak hitam' pada tahun 1998, penggunaan Propulsid


sekarang dikontraindikasi pada pasien yang menggunakan obat yang bisa
memperpanjang QT intrval dan pada pasien dengan penyakit jantung atau
kondisi yang berhubungan dengan jantung aritmia.

2. FDA mengumunkan pada 'berbicara kertas' perubahan label.

3. Surat 'untuk tenaga kesehatan profesional' didistribusikan dua kali sama


banyak seperti penerima surat pertama.

4. Surat rantai apotek dan kelompok-kelompok yang menyediakan informasi


keselamatan mengumumkan perubahan label.
Tindakan ini juga gagal untuk mengurangi resep tidak pantas dan jumlah
laporan kejadian merugikan meningkat. Perubahan label lain, didirikan pada
Januari 2000, direkomendasikan bahwa dokter melakukan electrocardiograms
dan tes darah sebelum resep Propulsid. Pada bulan Maret 2000, satu bulan
sebelum jadwal pertemuan Komite Penasihat obat Gastrointestinal di FDA
produsen secara sukarela menarik Propulsid dari pasar.

Beberapa analisis epidemiologi retrospektif telah meneliti pola kontraindikasi


Propulsid yang digunakan. Salah satu ditemukan hanya dua persen
pengurangan dalam semua kontraindikasi penggunaan Propulsid setelah
tindakan regulasi 1998. Lainnya menemukan kejadian 1998 diikuti oleh
penurunan subtantial Propulsid resep pembagian dengan obat-obatan
kontraindikasi sementara kejadian 1995, yang didampingi oleh publisitas
kurang, memiliki pengaruh yang kecil. antara kontraindikasi resep dari
Propulsid, sebuah studi ketiga menemukan lima puluh persen ditulis oleh
dokter yang sama dan 89 yang dikerjakan oleh apotek yang sama.

HAART dibentuk dalam menanggapi permintaan oleh European Medicines


Agency for the Evaluation of Medicinal Products (EMEA) untuk informasi
lebih lanjut mengenai komplikasi pendek dan jangka panjang obat
antiretroviral, dengan penekanan khusus pada serangan perapian dan stroke.
Meskipun perubahan pelabelanuntuk protease inhibitor menggambarkan
peringatan umum kelainan morphologic dan metabolik yang mungkin sudah
telah diadopsi, kelompok kerja kolaboratif unik ini didirikan pada tahun 1999
untuk menentukan dan mendukung metode paling kuat untuk menyelidiki
efek dari terapi antiretroviral Komplikasi metabolik.
HAART OC saat ini terdiri dari wakil-wakil dari delapan farmasi manufaktur
obat antiretroviral HIV (Abbott Laboratories, Boehringer ingelheim, Bristol-
Myes Squibb, Gilead Sciences, GlaxoSmithKline, Hoffmann - La Roche,
Merck & Co, dan Pfizer), serta akademik, peraturan dan perwakilan
masyarakat dari AS dan Eropa.

Secara kolektif, perusahaan farmasi anggota Komite telah melakukan lebih


dari tujuh juta dolar untuk mensponsori studi kolaboratif berikut obat
antiretroviral:

1. Lipodistrofi kasus definisi studi - kontrol kasus studi 1,081 laki-laki dan
perempuan rawat HIV-positif dari klinik worldwie dilakukan untuk develove
kasus HIV Lipodistrofi.

2. D:A:D: Multi kohort calon epidemiologi belajar dari Cardiovasculer


morbiditas - studi observasional calon peserta lebih dari 20.000 dari beberapa
kelompok pasien di U.S., Australia, dan 11 negara seluruh Eropa untuk
mencari kenaikan tingkat serangan jantung, stroke dan diabetes.

3. Retrospektif kohort analisis kardiovaskular morbiditas dan mortalitas:


Review veteran administrasi (VA) database- sebuah kohort retrospektif
belajar menggunakan otomatis data dari sistem USVA untuk menentukan
apakah ada peningkatan yang signifikan dalam tingkat serangan jantung dan
stroke setelah memperkenalkan HAART.

4. Meta-analisis dari ada kolaboratif kohort Stidues mengenai relatif insiden


dari metabolisme kelainan - meta-analisis baru-baru ini memprakarsai
metabolik studi utama jaringan percobaan klinis dan penelitian terkait lain.
Proposal penelitan yang peer-review sebelum disetujui dan didanai oleh
HAART OC. Setiap studi dilakukan oleh peneliti akademis dan memiliki
Komite Pengarah sendiri. HAART OC menerima reguler status report dan
kritikali evaluasi pada studi individu. Masing-masing studi disponsori
merupakan effort kolaboratif di berbagai tingkat, sebagaimana dicontohkan
oleh kombinasi dari database (misalnya, penelitian prospektif observasi
menggabungkan data dari sejumlah besar ada HIV penelitian kohort, beberapa
yang biasanya bersaing untuk penelitian sumber daya dan pasien) dan peneliti
(misalnya, peneliti utama studi metabolik yang besar dari beberapa jaringan
penelitian bekerja sama untuk menyelaraskan data yang dikumpulkan dalam
studi masing-masing meletakkan dasar bagi masa depan meta-analisis).

Pernyataan april 2003 di EMEA ditandai ' tersedia hasil dari Studi kohort jelas
menunjukkan bahwa manfaat keseimbangan risiko pengobatan anti retroviral
tetap sangat positif.

Di lihat dari pihak yang berwenang

PENGANTAR

Pharmacoepidemiology yaitumengubahtentangcaraobat-obatan yang diatur.


Keseimbangan manfaat dan risiko dari perubahan obat hinggamelaluiperjalanan
obat, dan dampak pharmacoepidemiology pada semua tahapyaitu dari
penemuan obat hingga pengembangan, melalui obat-obatan yang berlisensi,
untuk pemantauan keamanan dan pharmacoeconomy dari produk yang
dipasarkan. Pemerintah mengatur obat-obatan untuk melindungi kesehatan
masyarakat. Masyarakat dilindungi dari kualitas yang buruk, tidak efektif, atau
produk yang tidak aman. Dalam hal ini untuk lebih mengatur obat-obatan,
pharmacoepidemiology membuktikan alat yang lebih penting. Hal ini
memungkinkan kita untuk membuat keputusan berdasarkan data yang lebih
kuat, memberi kita pilihan ketikakita sebelumnya tidak punya, dan dalam
beberapa kasus yang memungkinkan, sebagai bantuan untuk minimalisir resiko,
danuntuk mengetahuiyang digunakan di pasar aman.

Bab ini menguraikan beberapa prinsip kunci dalam pharmaco-epidemiologi


yang relevan dengan regulasi obat dan menggambarkan konteks di mana
epidemiologi dapat diterapkan. Bab ini menjelaskan bagaimana
pharmacoepidemiology mungkin relevan, dan bagaimana hal itu dapat
diterapkan, di setiap langkah dalam perjalanan obat.

Pharmacoepidemiology dalam PERATURAN OBAT: DEFINISI, BIDANG,


DAN BEBERAPA PRINSIP UTAMA

DEFINISI
Hal ini penting untuk memastikan bahwa kita memiliki beberapa terminologi
utama yang digunakan dalam pharmacoepi-demiology sebagaimana yang
diterapkan padaregulasi obat. Kotak 8.1 memberikan definisi untuk istilah
penting, terutama yang khas tentangregulasi obat. Dalam kebanyakan kasus,
definisi yang diberikan secara internasional disepakati. Sebagai contoh, definisi
dari pharmacovigilance adalah syarat dari Word Heath Organization (WHO).
Sebaliknya, istilah yang umum digunakan lainnya, seperti manajemen risiko,
telah ada definisi yang diterima secara luas, karena itu di sarankan definisi
pragmatis kita sendiri.
Obat yang merugikan(ADE) Sebuah peristiwa yang merugikan adalah setiap
kejadian medis yang tidak diinginkan pada pasien setelah pemberianproduk
obat dan yang tidak memiliki hubungan kausal dengan pengobatan. Peristiwa
yang merugikan misalnya, temuan laboratorium yang abnormal, gejala, atau
penyakit temporal yang berhubungan dengan penggunaan produk obat.
Reaksi obat yang merugikan (ADR) reaksi obat yang merugikan,yaitu
tanggapan berbahaya yang tidak diinginkan padasuatuproduk obat. Ungkapan
"tanggapan terhadap produk obat" berarti bahwa hubungan kausal antara produk
obat dan efek samping obat yang kemungkinanminimal. Reaksi ini ditandai oleh
fakta bahwa hubungan kausal antara obat dengan terjadinya efek obat yang
dicurigai. Untuk tujuan pelaporan peraturan, jika suatu peristiwa spontan
dilaporkan, bahkan jika hubungan tidak diketahui atau tak tertulis,
makadapatmemenuhi definisi reaksi obat yang merugikan.

Persetujuan di Amerika Serikat, persetujuan digunakan untuk lisensi obat-


obatan dan berasal dari bahasa hukum dari Federal Food, Drug, dan Kosmetik.

Otorisasi Istilah yang digunakan di Uni Eropa untuk proses perizinan obat.
Hasil otorisasi dalam hakPemasaran (yaitu, dokumen hukum).

Mendemonstrasikan keselamatan * pengawasan secara aktif atau sistematis


padapopulasi atau yang diatur didefinisikan sebagai paparan pasien daripada
kalender sehingga risiko tidak dapat diterima yang telah ditetapkan dapat
dikecualikan dengan tingkat diberikan kepercayaan.

Khasiat yang memungkinkan obat untuk menghasilkan respon yang


menguntungkan dalam kondisi yang ideal (biasanya diterapkan untuk uji klinis
acak terkontrol).
analisis dampak * Sebuah alat kuantitatif untuk memprioritaskan, yang
tujuannya adalah untuk fokus lebih lanjut, rinci, evalusi pada orang-orang dan
merekayang memiliki dampak pada kesehatan masyarakat.

Pemasaran Otorisasi Istilah yang digunakan untuk lisensi untuk memasarkan


obat di Uni Eropa.

obat yatim piatu atau Term obat yang diterapkan oleh undang-undang yang
relevan (misalnya US Orphan Drug Act) untuk obat yang ditunjuk sebagai obat
yatim piatuyaitu di bawah undang-undang. Obat ini untuk diagnosis,
pencegahan, atau pengobatan penyakit yang langka,dan jarang

Pass studi keselamatan atau uji coba dilakukan setelah obat dipasarkan untuk
memberikan rincian tambahan tentang profil keamanan obat.

Pharmacovigilance Ilmu dan kegiatan yang berkaitan dengan deteksi, penilaian,


pemahaman, dan pencegahan efek samping atau masalah terkait obat lainnya.

Rencana pharmacovigilance Berdasarkan spesifikasi keamanan, rencana


pharmacovigilance tentang langkah-langkah untuk memantau keamanan obat
yang dipasarkan.

PIL (patient information leaflet) adalah istilah Uni Eropa untuk bagian dari
Otorisasi Pemasaran memberikan informasi tentang obat kepada pasien. Secara
hukum itu harus diberikan kepada pasien ketika obat tersebut dibagikan atau
diberikan.

proses audit Istilah ini umumnya digunakan dalam pharmacovigilance untuk


menggambarkan langkah-langkah yang berbeda dalam proses farmasi-
covigilance.

Pembaharuan Dalam Pemasaran Otorisasi baru Uni Eropa hanya berlaku untuk
awal 5 tahun, pada saat keefektifan dan, khususnya, keamanan produk ditinjau
dari Otorisasi Pemasaran diperbarui atau tidak

Manajemen risiko * AS FDA telah mengusulkan bahwa manajemen risiko


adalah proses keseluruhan dan terus menerus meminimalkan resiko di seluruh
siklus hidup produk untuk mengoptimalkan keseimbangan manfaat / risiko.
Manajemen risiko merupakan proses yang berkesinambungan tentang manfaat
dan risiko produk obat, mengevaluasi intervensi dari waktu ke waktu, dan
merevisi intervensi jika diperlukan.

minimalisasi risiko * Hal ini dapat dianggap sebagai bagian dari manajemen
risiko, yang terdiri dari intervensi untuk meminimalkan risiko yang terkait
dengan penggunaan obat dan evaluasi efektivitas intervensi-intervensi.

kuantifikasi risiko * Penilaian frekuensi, keparahan dan keseriusan risiko.

pengurangan risiko * sebuah sinonim untuk meminimalkan risiko.


Spesifikasi keselamatan Spesifikasi keselamatan adalah ringkasan dari risiko
yang teridentifikasi dari obat, populasi yang berpotensi berisiko, dan situasi
yang belum diteliti secara memadai.

Sinyal Sebuah sinyal keamanan obat telah didefinisikan oleh WHO


"melaporkan informasi pada hubungan kausal antara peristiwa yang merugikan
dari obat, hubungan yang tidak diketahui atau tidak lengkap didokumentasikan
sebelumnya. Biasanya lebih dari satu laporan diperlukan untuk menghasilkan
sinyal, tergantung pada kualitas informasi ".

Laporan laporan berasal dari sistem pengumpulan data yang terorganisir, yang
meliputi uji klinis, pendaftar, pasca-persetujuan penggunaan program pasien,
dukungan pasien dan penyakit programlainnya, survei pasien atau penyedia
layanan kesehatan, atau mengumpulkan informasi tentang khasiat atau
kepatuhan pasien .

SPC Ringkasan dari Karakteristik Produk adalah istilah yang digunakan untuk
menandakan bagian dari Otorisasi Pemasaran Eropa yang berisi informasi
tentang produk untuk membantu penulis resep dan dispenser menggunakan obat
dengan aman dan efektif.

Laporan ADR spontan Sebuah komunikasi yang tidak diminta oleh ahli
kesehatan atau konsumen untuk perusahaan, otoritas atau organisasi lainnya
(misalnya WHO, Pusat Regional, Poison Control Center) yang menggambarkan
satu atau lebih reaksi obat yang merugikan pada pasien yang diberi satu atau
lebih produk obat dan yang tidak berasal dari pengumpulan data yang
terorganisasi.

* Dalam kebanyakan kasus, definisi yang diberikan secara internasional


disepakati. Sebaliknya, istilah yang umum digunakan lainnya, seperti
manajemen risiko, tidak memiliki definisi yang diterima secara luas. Ini dapat
dan telah mengakibatkan kebingungan. Oleh karena itu, untuk istilah-istilah ini
telah mengusulkan definisi pragmatis kita sendiri.
RUANG LINGKUFARMAKOEPIDEMIOLOGI DALAM PERATURAN
OBAT

Sebelum mempertimbangkan dengan detail, hal ini layak mendapatkan ikhtisar


dari lingkup farmakoepidemiologi dalam obat regulasi. Tabel 8.1
menggambaran seperti itu. Ini mencerminkan struktur dan isi dari bab ini dan
dapat membantu untuk mengarahkan Anda seperti menavigasi melalui jalan
Anda ini.

BEBERAPA PRINSIP UTAMA

Perlindungan kesehatan masyarakat adalah pusat pengambilan keputusan oleh


regulator farmasi. Mengingat pendekatan berorientasi kesehatan masyarakat ini,
beberapa konsep kunci menggarisbawahi proses regulasi.

Tabel 8.1. Lingkup farmakoepidemiologi dalam peraturan obat.

Tahap siklus Contoh aplikasi yang mungkin dari farmakoepidemiologi

Penemuan Identifikasi pasar potensial melalui studi pemanfaatan distribusi


Obat penyakit dan obat-obatan

Estimasi ukuran pasar potensial, kebutuhan medis yang belum


terpenuhi, demonstrasi efikasi dan keamanan. Pilihandari
Pengembanga
kemungkinan co-diresepkan obat-obatan untuk studi interaksi.
n obat
Perencanaan strategi pengumpulan data keselamatan
untukpengembangan dan fase pasca-lisensi

Estimasi prevalensi penyakit, memberikan informasi mengenai


Obat anakpengobatan lain, demonstrasi efikasi dan keamanan,
yatim menunjukkan manfaat yang signifikan

Informasi tentang penyakit yang akan diobati, terapi yang ada,


profil keamanan terapi alternatif, demografi toksisitas terkait
dengan obat. Perencanaan pemantauan keamanan pasca-
Lisensi lisensidan strategi minimalisasi risiko

Bantuan untuk semua langkah dalam proses pharmacovigilance:


deteksi sinyal dan evaluasi, manfaat / risiko penilaian,
pengukuran dampak kesehatan dari tindakan yang diambil untuk
Pasca lisensi: mengurangi risiko

kewaspadaan

Evaluasi manfaat dan risiko dalam indikasi baru. Re-evaluasi


manfaat dan risiko ketika data baru tersedia mengenai indikasi
Variasi,
didirikan. Estimasi ukuran pasar dan penggunaan terapi yang
pembaharuan,
adaketika mempertimbangkan pindah ke menggunakan tanpa
resep

Reklasifikasi

Farmakoekon Estimasi biaya terapi dan manfaat dalam hal ekonomi untuk
omic mendukung penggantian atau dimasukkan ke dalam formularium

Regulator memiliki kewajiban untuk memastikan bahwa obat-obatan di pasar


adalah aman yang dapat diterima, kualitas, dan efektivitas. Pendekatan kami ini
dengan mengambil keputusan berbasis bukti, menyeimbangkan risiko dan
manfaat dari perspektif populasi pada berbagai tahap siklus hidup produk.
Farmakoepidemiologi dapat membuat kontribusi penting untuk keputusan ini,
keputusan yang berdampak pada berbagai macam orang, khususnya pengguna
akhir dari obat-obatan. Regulator juga harus merespon ketika hasil studi potensi
pentingnya kesehatan masyarakat diterbitkan, mengadopsi evaluasi kritis dan
mengambil tindakan peraturan apapun jika diperlukan.

Ketika membuat keputusan ini, berbagai desain studi, yaikni dilakukan studi
deskriptif dan analitik. Konsep dari "hierarki bukti" berdasarkan desain
penelitian sangat membantu. Hirarki mencerminkan ketahanan data yang
tersedia. Penelitian deskriptif, yang meliputi laporan kasus tunggal, seri kasus,
dan kohort tidak terkendali atau pendaftar, membatasi kesimpulan yang kita
buat tentang kausalitas. Sementara sebagian besar hipotesis, penelitian ini
paling sering dasar pasca-lisensi tindakan peraturan saat waktu dan sumber daya
tidak mengizinkan studi analitik yang lebih menyeluruh. Studi analitik termasuk
pembanding dan memiliki kemampuan untuk menguji hipotesis tertentu. Ini
termasuk studi kasus-kontrol, studi kohort, studi kasus-kontrol, dan kasus-
Crossover analisis, serta uji klinis acak. Hal ini diterima bahwa acak terkontrol
menawarkan kontrol yang lebih besar bias dalam desain penelitian dan berada
pada tingkat yang lebih tinggi dalam hirarki bukti dari penelitian analitis
observasional. Meta-analisis menawarkan metode data amalgama ilmiah dari
studi yang berbeda.

Ketika kita mempertimbangkan keamanan obat, kita memiliki interaksi yang


kompleks dari obat regulasi, keamanan obat-obatan, dan farmakoepidemiologi.
Interaksi ini dapat lebih dipahami dengan mempertimbangkan tiga sumbu (lihat
Gambar 8.1). Meskipun jelas bahwa masalah keamanan bisa timbul setiap saat
dalam siklus hidup obat ini (sumbu 1), elemen data dari sumber yang berbeda
dalam hirarki bukti (sumbu 2) memenuhi peran yang berbeda dalam evolusi
masalah keamanan (sumbu 3), dari generasi data keselamatan, untuk evaluasi,
untuk pengujian hipotesis.

Perlu dicatat bahwa, dalam konteks perhatian keamanan utama, studi


observasional, deskriptif, dan analisis hanya subjek dari semua data yang
tersedia; semua informasi yang tersedia harus dipertimbangkan untuk relevansi.
Data farmakoepidemiologi konvensional didasarkan pada studi observasional,
deskriptif, dan analitis pada manusia, termasuk uji klinis acak. Namun, di
samping sumber-sumber data ini ada banyak data lain yang harus
dipertimbangkan dalam penilaian secara keseluruhan, misalnya, dari masalah
keamanan obat. Ini termasuk data berdasarkan studi farmakodinamik dan
farmakokinetik dan studi non klinik, termasuk dalam studi vitro dan hewan.

Dari perspektif kesehatan masyarakat, ada sejumlah kekhawatiran utama dalam


kaitannya dengan sifat dan penggunaan data farmakoepidemiologi. Ini termasuk
sifat hipotesis, tujuan dan sasaran yang diajukan, rincian metodologi,
pertimbangan etis, dan kualitas data. Obat UK dan Kesehatan produk Regula-
tory Agency (MHRA) Keunggulan dalam model Pharmacovigilance
menguraikan dua tujuan utama global di pharmacovigilance: mendeteksi bahaya
dan demonstrasi keselamatan. Yang pertama adalah sangat tergantung pada
sistem pelaporan ADR spontan menghadang sinyal keselamatan langka yang
sebelumnya tidak dikenal, termasuk pola yang tidak biasa atau nomor
berlebihan risiko diantisipasi. Untuk menunjukkan keamanan pasca-lisensi,
evaluasi keselamatan membutuhkan koleksi direncanakan dari hasil dan paparan
data pada sampel dari populasi yang baru terkena sampai tonggak paparan yang
telah ditetapkan pasien terpenuhi. Surveilans aktif sebelumnya dalam siklus
hidup dari obat yang dipasarkan dari sering dilakukan pada saat ini melayani
kebutuhan ini.

Data farmakoepidemiologi digunakan untuk memastikan manfaat maksimal


pada risiko minimal untuk pengguna akhir dari obat. Tujuan dari menganalisis
laporan ADR spontan adalah untuk memaksimalkan deteksi masalah keamanan
yang belum diakui dan meminimalkan kemungkinan hilang sinyal keselamatan.
Pasien dan perspektif kesehatan masyarakat merupakan pusat penilaian dampak
dari laporan yang diberikan dari ADR diduga pada profil manfaat / risiko obat
ini. Perkembangan definisi kasus surveilans jelas dalam membangun
serangkaian kasus penting dalam memastikan bahwa evaluasi awal dari
keprihatinan keselamatan mencakup semua kasus yang mungkin menjadi obat-
terkait.

Standar profesional tertinggi harus diterapkan dalam desain dan pelaksanaan


studi pasca-lisensi. Sebuah protokol dengan tujuan yang jelas, sebuah komite
penasihat independen, dan peninjau etik akan membantu memastikan bahwa
studi ini menghasilkan data keselamatan berguna dan menghilangkan
kekhawatiran pasien dan profesional kesehatan yang beberapa studi keamanan
pasca-lisensi yang terutam
Gambar 8.1. kubus Jane: Interaksi obat regulasi, keamanan obat-obatan, dan
farmakoepidemiologi.

SIKLUS HIDUP OBAT

(Drug Life Cycle)

SEBELUM-PERIZINAN

Epidemiologi memberikan informasi terkait sejarah kunci pada Pengembangan


Obat

Dalam regulasi obat, pharmacoepidemiology sampai saat ini sebagian besar


telah digunakan sebagai bantuan untuk pharmacovigilance. Namun, ada juga
berbagai aplikasi dari metodologi epidemiologi jauh sebelum obat berlisensi
dan digunakan di pasar. Ketika sebuah perusahaan farmasi telah memilih target
penyakit potensial untuk mengejar dan pada tonggak kunci selama
pengembangan obat-obatan, teknik epidemiologi dapat digunakan untuk
memperkirakan dan mengukur ukuran potensi pasar, demografi penduduk yang
mengalami sakit, kebutuhan medis yang belum terpenuhi, dan bagaimana terapi
yang ada digunakan dalam pengobatan. Teknik-teknik tersebut juga dapat
diterapkan untuk mengevaluasi lebih lanjut faktor resiko yang terkait dengan
efek samping yang diamati selama periode ini. Misalnya, database pasien
memanjang seperti di Praktik Umum Penelitian Database di Inggris / General
Practice Research Database (GPRD) dapat dimanfaatkan (lihat Bab 22). Jika
mempertimbangkan mengembangkan obat baru untuk mengobati diabetes
mellitus, GPRD dapat digunakan untuk mengukur kejadian penyakit dan
prevalensi pada populasi sesuai dengan ukuran yang ditetapkan, dan oleh karena
itu ukuran pasar yang potensial UK GPRD dapat diekstrapolasi. Dengan cara
mengetahui umur dan jenis kelamin dari distribusi populasi sasaran, bersama-
sama dengan rekan-patologi umum, uji klinis dapat dirancang bahwa keduanya
layak (tidak mencoba merekrut 50% laki-laki untuk penyakit yang menyerang
pada 90% perempuan) dan relevan untuk kemungkinan penggunaan produk
klinis.

GPRD mencatat perawatan, serta diagnosis sehingga analisis penggunaan


narkoba yang ada dapat dibuat dengan rinci. Hal ini dapat menginformasikan
terkait keputusan tentang ukuran potensi pasar, tempat yang memungkinkan di
pasar, bagaimana kemungkinan terbaik perkembangan dari obat yang
digunakan, dan obat lain apa yang mungkin digunakan secara bersamaan.
Informasi ini memiliki potensi untuk digunakan dalam membuat keputusan
tentang obat-obatan yang harus dipelajari terkait interaksi dan pada kriteria
inklusi dan eksklusi uji coba.

Selama proses pengembangan obat-obatan secara tradisional, untuk bisa belajar


tentang keamanan produk dapat melalui pengumpulan data yang sistematis
berupa efek samping yang acak, dan uji klinis comparative. Namun, teknik
epidemiologi, termasuk metode yang lebih deskriptif, dapat melengkapi data uji
klinis. Misalnya, setelah masa acak dari percobaan klinis, pasien sering
melanjutkan terapi studi di unblinded "fase ekstensi". Meskipun data efek
samping kurang kuat daripada hasil dari penelitian secara acak, mereka
memberikan informasi tambahan yang berguna pada keamanan produk,
termasuk data paparan jangka panjang yang berharga. Perbandingan dapat
dibuat efek samping selama dari penelitian ini menggunakan cara acak,
mungkin dengan pasien bertindak sebagai kontrol mereka sendiri atau antara
pasien melanjutkan pengobatan aktif dan mereka memilih untuk menghentikan
pengobatan. Analisis keselamatan deskriptif serupa dapat dilakukan ketika
pasien menerima obat yang diteliti pada dasar "penggunaan yang merasa penuh
kasihan" atau “nama pasien”. Memang, beberapa pihak berwenang hanya akan
memungkinkan penggunaan tersebut jika protokol diletakkan di tempat tersebut
untuk pengumpulan data efek samping. Di pasar obat global, mungkin obat
investigational di satu negara atau wilayah dan sudah berlisensi dan dipasarkan
pada orang lain. Dalam situasi ini, data keamanan secara spontan melaporkan
ADR yang berasal dari daerah mana obat ini dipasarkan, bisa melengkapi data
acak dari daerah mana obat tetap diteliti. Ketika efek samping yang diamati
selama uji klinis dengan teknik epidemiologi, seperti studi kasus kontrol, dapat
digunakan untuk memahami lebih baik faktor-faktor resiko yang berkaitan
dengan efek samping. Informasi tersebut dapat menginformasikan perusahaan
dan regulator tentang populasi beresiko yang dapat digunakan untuk menjadi
lebih efektif dalam mengelola resiko pasca-lisensi. Akhirnya, sementara
penelitian acak dilakukan, studi epidemiologi penyakit yang sedang dirawat dan
juga terapi yang ada dapat dilakukan.

Teknik epidemiologi juga dapat digunakan untuk mengumpulkan dan


menganalisis data kemanjuran. Dalam beberapa situasi, misalnya ketika
penyakit ini sangat jarang atau ketika melakukan uji coba pembanding dapat
dinilai tidak etis, satu-satunya cara yang mungkin untuk mengumpulkan data
efikasi mungkin melalui teknik epidemiologi.

Ketika mempertimbangkan peran pharmacoepidemiology dalam penilaian


efikasi dan keamanan obat ini, pentingnya pembauran dengan indikasi harus
selalu diingat dalam analisis dan interpretasi studi tersebut (lihat Bab 40).
Ketika membandingkan pasien yang diobati dengan pasien yang tidak diobati,
pasien yang dirawat akan memiliki tingkat yang lebih tinggi dari penyakit yang
obatnya dimaksudkan untuk mengobati, meskipun penelitian efektivitas obat ini
dalam beberapa situasi dapat terjadi efek yang begitu dramatis, namun tidak ada
kelompok pembanding yang diperlukan. Pengacakan beroperasi dimaksudkan
untuk mengontrol pengganggu dalam studi efek.

Penilaian Keamanan

Untuk sebuah lisensi, keseimbangan manfaat dan resiko obat telah dinilai dapat
diterima untuk indikasi yang diberikan. Namun, regulasi sering menanyakan
tentang bagaimana atau mengapa masalah keamanan obat yang utama kemudian
timbul. Untuk mengetahui mengapa, maka pengetahuan kita tentang
keselamatan di perizinan diperlukan untuk sementara, bagian ini akan
mempertimbangkan tingkat dan sifat sebelum lisensi penilaian keamanan obat,
keterbatasan uji klinis, dan situasi di mana database keamanan yang lebih luas
mungkin diperlukan.

Uji klinis individu umumnya didukung untuk menjawab pertanyaan khasiat


tertentu dengan kriteria inklusi dan eksklusi yang ketat dan biasanya durasinya
terbatas. Meskipun tingkat ADR umum juga dapat diperkirakan, percobaan
tersebut tidak mungkin untuk mengamati ADR yang langka atau reaksi yang
hanya mengikuti paparan jangka panjang (lihat Bab 3). Selain itu, hanya karena
tidak ada yang salah, ini tidak berarti bahwa semuanya baik-baik saja; jika tidak
ada pasien n mengalami peristiwa buruk, maka 95% batas kepercayaan atas
adalah paling kurang 3 / n.5. Satu studi telah menunjukkan bahwa database
keselamatan manusia rata-rata untuk aplikasi obat baru adalah dengan rata-rata
1.480 subyek. Hal ini memberikan kita gambaran tentang frekuensi reaksi yang
terdeteksi dalam uji klinis.

Penilaian data keamanan uji klinis harus di diambil dan digunakan dengan
tujuan meminimalkan resiko kepada peserta sidang masa depan dan pasien.
Penilaian ini harus mengambil definisi kasus dengan seksama dan waktu
ketergantungan ke rekening. Sebuah laporan kasus tunggal dari reaksi (Susar)
dari percobaan klinis yang diduga obat tidak serius namun bisa merugikan dapat
mendorong penggunaan alat-alat analitik seperti pertambangan data dan strategi
deteksi sinyal lain pada data. Alat-alat analisis canggih dengan tampilan grafis
juga sedang dikembangkan dengan menggunakan data penyebut dan data
lainnya ke akun.
Penilaian resiko klinis yang baik tergantung atas rancangan yang memadai dan
dapat melakukan studi praklinis, studi farmakologi klinis, dan program uji klinis
untuk memastikan bahwa keselamatan data yang dihasilkan cukup untuk
memungkinkan lisensi produk. Ukuran database keselamatan manusia
diperlukan untuk pra-otorisasi yang tergantung pada banyak faktor, termasuk
produk, populasi, indikasi, durasi penggunaan obat, dan hasil praklinis dan
program farmakologi klinis.

Data keamanan, idealnya pada data keamanan pembanding dapat dikendalikan,


termasuk data keamanan jangka panjang, untuk memungkinkan perbandingan
angka kejadian dan untuk atribusi akurat efek samping. Data yang tersedia harus
memperpanjang rentang dosis dan dalam populasi yang beragam. Penilaian
resiko harus membahas interaksi potensial (baik obat-obat dan interaksi antara
makanan dan obat), sub-populasi demografi, dan efek dari penyakit penyerta.
Penilaian resiko harus disesuaikan dengan obat yang bersangkutan; masalah
mungkin timbul seperti masalah khusus pada keamanan perkembangan dalam
populasi anak, ADR kurang jelas atau berbahaya yang mungkin tidak biasanya
dilaporkan, atau masalah keamanan biologis khusus. Dalam beberapa kasus
studi keselamatan besar yang sederhana diperlukan sinyal keamanan yang
secara serius muncul dan tidak dapat diatasi dengan menggunakan data yang
ada (lihat Bab 39).

ICH pedoman E110 menguraikan ukuran manusia basis data yang diperlukan
untuk lisensi obat untuk kondisi yang tidak mengancam nyawa. ICH
merekomendasikan bahwa pada data setidaknya 1.500 pasien tersedia saat
perawatan berulang / kronis untuk penyakit yang dianggap tidak mengancam
kehidupan, dengan 300-600 pasien terkena selama lebih dari 6 bulan dan
sebanyak 100 pasien terkena selama lebih dari 12 bulan. Sebuah database yang
lebih besar diperlukan bila masalah lain timbul (lihat Tabel 8.2).

Sementara semua obat dinilai untuk keselamatan selama mereka develngunan,


tidak ada standar yang konsisten atau setuju untuk rencana pembangunan
keselamatan tertentu. Dewan Internasional Organisasi Ilmu Kedokteran / The
Council for International Organization of Medical Sciences (CIOMS) VI,
kelompok kerja penyusunan pedoman praktis pada proses developing dan
melaksanakan rencana pharmacovigilance selama pengembangan obat,
perencanaan dan keselamatan.

Tabel 8.2. Faktor-faktor yang dapat meningkatkan ukuran yang dibutuhkan dari
database manusia pra-lisensi

• Perlu lebih dalam memperkirakan kelangkaan ADR tertentu berdasarkan


praklinis, farmakologi, kelas, atau data lain

• Manfaat kecil, berupa manfaat yang dialami oleh sebagian kecil dari populasi
yang diperlakukan, atau keuntungannya tidak pasti

• Tingginya morbiditas kondisi / mortalitas

• Populasi sehat (misalnya vaksin)

• Alternatif yang aman sudah tersedia

PANDANGAN LEMBAGA PENGAWAS 109


Pengumpulan dan promosi akan pentingnya data keselamatan selama
pembangunan akan membantu dalam identifikasi resiko, penilaian, dan
pengambilan keputusan, akan lebih melindungi mata pelajaran uji klinis, dan
akan membentuk dasar dari spesifikasi keselamatan dan rencana yang
diperlukan pada saat perizinan. Bimbingan akan memberikan pertimbangan
untuk tanggung jawab dalam perusahaan, ketika rencana pembangunan
keselamatan harus dikembangkan, bagaimana harus dipertahankan, dan struktur
apa yang mungkin.

Peran Ilmiah (Regulatory)

Pengembangan ilmu kedokteran

Dalam kedua Uni Eropa dan Amerika Serikat, sistem yang ada bagi perusahaan
farmasi untuk mendapatkan nasihat ilmiah dan peraturan selama perkembangan
mereka dari obat. Di AS, FDA mendorong interaksi sering dan dialog ilmiah
dengan sponsor aplikasi seluruh siklus hidup produk. FDA saat ini sedang
melakukan penilaian formal, komprehensif dari nilai tambah, biaya, dan
dampak dari umpan balik yang lebih luas selama pengembangan obat. Di Uni
Eropa, saran ilmiah dan peraturan diberikan atas permintaan perusahaan untuk
menjawab pertanyaan spesifik pada desain studi atau persiapan permohonan
izin. Sampai saat ini, sudah relatif jarang bagi perusahaan untuk mencari atau
mendapatkan saran pada studi epidemiologi yang akan dilakukan selama
pengembangan produk atau dalam periode pasca-lisensi. Namun, saran tersebut
keduanya tersedia dan sangat recom-diperbaiki untuk meningkatkan kualitas
aplikasi lisensi dan perilaku pharmacovigilance dan karena itu untuk lebih
melayani masyarakat dengan memaksimalkan kesempatan kedokteran sukses
pada saat permohonan izin dan meminimalkan risiko setelah itu di pasar. saran
ilmiah dari regulator juga tersedia mengenai strategi minimalisasi risiko. Ketika
merencanakan studi pharmacoepidemiology, mencari saran terbaik dari
regulator dan para ahli dari luar dalam epidemiologi harus meningkatkan
kualitas penelitian dan membuat jelas hasil dan harapan seperti sebuah usaha.

Relevansi Pharmacoepidemiology ke Orphan Obat

Penyakit orphan adalah penyakit langka dan karena itu (logis) obat untuk
mendiagnosa, mencegah, atau mengobati penyakit langka obat orphan adalah
(contoh obat orphan yang ditunjuk di Uni Eropa dapat ditemukan di http:
//www.pharmacos.eudra .org / F2 / daftar / orphreg.htm). 1983 US Orphan Drug
Act12 menjamin pengembang produk orphan-ditunjuk beberapa insentif: 7
tahun eksklusivitas pasar menyusul persetujuan pasar AS dalam indikasi yang
sama, kredit pajak untuk

penelitian klinis dalam pengembangan produk, dan berhasil-bisa dana dari


produk orphan program hibah US. Selain itu, produk orphan-ditunjuk memiliki
pembebasan biaya permohonan persetujuan US FDA. undang-undang ini telah
sangat efektif dalam membawa produk untuk penyakit langka ke pasar. Selama
10 tahun sebelum Orphan Drug Act industri farmasi Amerika dikembangkan
sekitar 10 obat yatim piatu. Sebaliknya, antara tahun 1983 dan 2003, 242
produk yatim-ditunjuk telah menerima persetujuan pemasaran FDA. Selain
undang-undang AS telah membentuk dasar untuk hukum yatim berbasis insentif
serupa di wilayah lain, terutama Uni Eropa dan Japan.13

Pharmacoepidemiology memainkan peran sentral dalam bahan pertimbangan-


timbangkan obat yatim, pertama dalam menunjuk obat sebagai produk yatim
dan kedua dalam mendukung pengumpulan data menunjukkan keamanan dan
kemanjuran produk yang dibutuhkan untuk lisensi itu.

Dalam undang-undang AS, sebuah penyakit langka atau kondisi didefinisikan


sebagai penyakit atau kondisi yang mempengaruhi kurang dari 200 000 orang di
Amerika Serikat. Dalam Peraturan Uni Eropa pada Orphan Produk Obat, 14
definisi jarang diberikan sebagai "tidak lebih dari lima di 10 ribu orang dalam
komunitas." Dalam menerapkan untuk penunjukan orphan, perusahaan harus
sub-stantiate bahwa penyakit yang akan didiagnosis, dicegah, atau diperlakukan
memiliki prevalensi di bawah ambang batas hukum. pembuktian seperti
biasanya membutuhkan penerapan teknik farmasi-coepidemiologic. Sebagai
contoh, sebuah perusahaan dapat menggunakan database pasien membujur di
sebuah wilayah di mana mereka mencoba untuk membangun prevalensi dan
mencari database untuk semua kasus kondisi tertentu. Jumlah kasus di seluruh
negara atau wilayah kemudian dapat dihitung jika ada yang tahu jumlah
penduduk yang tercakup dalam database dan total populasi negara atau wilayah.
Survei dari pusat pengobatan spesialis terkadang telah digunakan untuk
membangun perkiraan prevalensi penyakit yang sangat langka, dan untuk
beberapa penyakit langka, pendaftar nasional atau regional ada yang dapat
membentuk dasar dari perhitungan prevalensi. Ini mungkin sangat berguna jika
penyakit ini sangat langka bahkan database yang sangat besar, seperti Inggris
GPRD, tidak mungkin mengandung kasus. Sebagai aturan umum, ahli com-
komite yang bertanggung jawab untuk penunjukan yatim membutuhkan tingkat
yang lebih besar dari presisi dalam prevalensi memperkirakan lebih dekat itu
adalah untuk ambang batas untuk penunjukan (yaitu, 5 di 10 000 di Uni Eropa).

Dalam Peraturan Uni Eropa pada Orphan Produk Obat, penunjukan juga
mensyaratkan bahwa "terdapat ada metode yang memuaskan dari diagnosis,
pencegahan atau pengobatan kondisi yang bersangkutan. . . atau jika metode
tersebut ada, bahwa produk obat akan bermanfaat signifikan untuk mereka yang
terkena dampak kondisi itu. "Di sinilah terletak dua peluang lebih lanjut untuk
pharmacoepidemiologist: untuk menetapkan bahwa tidak ada metode yang
memuaskan dari pengobatan ada, atau untuk menetapkan bahwa produk akan
bermanfaat signifikan (lebih didefinisikan sebagai "keuntungan klinis yang
relevan atau kontribusi besar untuk perawatan pasien"). Bagaimana mungkin ini
dibentuk? Sebuah titik awal yang wajar mungkin database pasien longitudinal.
Sebuah pencarian dari database tersebut untuk kasus yang ada penyakit yang
diikuti oleh pencarian untuk setiap pasien dengan penyakit yang untuk resep
atau intervensi medis dapat memberikan semua informasi yang diperlukan.

Tiga pilar regulasi obat yang berkualitas, aman, dan kemanjuran. Epidemiologi
mungkin memiliki peran untuk bermain dalam membangun keamanan dan
kemanjuran obat yatim. Kriteria lisensi diterapkan untuk obat-obatan anak
yatim yang sama dengan yang diterapkan pada obat lain. Namun, kelangkaan
pasien dan penyebaran mereka di area yang luas dapat membuat pelaksanaan
studi acak praktis, atau bahkan tidak mungkin. Acak, paralel, double-blind uji
con-dikendalikan mungkin sangat sulit, terutama jika tidak ada pengobatan yang
tersedia saat ini dan kondisi ini mengancam jiwa. Jika seperti desain studi tidak
memungkinkan maka alternatif desain harus dipekerjakan. Jika pedoman
peraturan yang ada pada desain studi tidak diikuti maka sangat disarankan untuk
mencari nasihat protokol dari pihak regulator yang berwenang sebelum mulai
mendaftarkan pasien. Beberapa desain persidangan alternatif yang telah
digunakan untuk mempelajari obat-obatan yatim dijelaskan below 13.

uji protokol terbuka, yang memungkinkan pasien untuk ditambahkan studi


toongoing, dianggap satu-satunya pilihan dengan penyakit yang sangat langka
di hari-hari awal AS Orphan Drug Act.13However, penggunaannya sekarang
berkecil sebagai, ketika mereka digunakan, itu hampir mustahil untuk kembali
ke studi terkontrol. Dalam uji coba penarikan acak semua pasien menerima obat
studi di fase open-label dan kemudian responden yang dipilih secara acak untuk
meneruskan salah satu pengobatan atau plasebo, yang kemudian dapat
dibandingkan. Desain ini tidak cocok untuk penyakit yang mengancam
kehidupan, untuk obat dengan waktu paruh panjang, atau untuk penyakit dengan
tanda-tanda variabel dan gejala. Dalam kontrol uji klinis sejarah, pasien yang
diberi obat inves-tigational dibandingkan dengan sejarah diketahui penyakit.
Karena mereka tidak memiliki kelompok plasebo mungkin lebih mudah untuk
merekrut pasien. Hasil penelitian tersebut bisa sangat sulit untuk menafsirkan
kecuali pengobatan baru memiliki pengaruh besar dan perjalanan penyakit itu
parah, tak kenal lelah, dan mapan. Bias meliputi interpretasi kondisi dan bias
temporal. Peran untuk pharmaco-epidemiologi dalam mendokumentasikan
sejarah diketahui penyakit jelas. Studi label terbuka juga telah bekerja, baik
penyidik dan pasien mengetahui identitas obat. Bias kemungkinan dalam
cobaan dan kesulitan mungkin terjadi seperti dalam evaluasi kemanjuran
produk. Namun, penelitian tersebut dapat secara signifikan menambah
pengetahuan tentang keamanan produk ini. Dalam uji coba crossover setiap
kelompok pasien menerima setiap perlakuan dua kali selama persidangan.
Rekrutmen mungkin lebih mudah karena semua pasien tahu bahwa mereka akan
(pada tahap tertentu) menerima pengobatan baru. Studi-studi ini sangat cocok
untuk kelompok-kelompok kecil pasien dengan penyakit menanggapi dengan
cepat, karena pasien yang sama dapat berfungsi baik sebagai pengobatan dan
subjek kontrol. Kesulitan akan terjadi ketika periode washout bagi pasien untuk
kembali ke baseline terlalu panjang (misalnya, obat memiliki paruh panjang)
atau washout tidak mungkin karena sifat progresif dari penyakit yang sedang
dirawat.

PERIZINAN OBAT

Sebelum obat dapat dipasarkan perlu untuk mendapatkan lisensi produk. Istilah
"Pemasaran Otorisasi" sekarang menggantikan "lisensi" di Uni Eropa, dan di
Amerika Serikat istilah "persetujuan" digunakan untuk obat-obatan dan istilah
"lisensi" digunakan untuk biologis. Dalam bab ini kita telah memilih untuk
menggunakan istilah "lisensi" dan "lisensi" sebagai sinonim dengan istilah-
istilah lain karena mereka umumnya akrab bagi pembaca. Lisensi obat
merupakan langkah kunci dalam hidup produk dan sistem perizinan adalah alat
utama yang regulator harus melindungi kesehatan masyarakat, memastikan
bahwa hanya obat-obatan yang memenuhi kriteria ketat kualitas, keamanan, dan
keampuhan mencapai pasar. Untuk mendapatkan lisensi produk, perusahaan
farmasi harus menyerahkan dokumentasi rinci yang berkaitan dengan produk
dan perkembangannya. berkas aplikasi diatur dalam hirarki piramida detail. Di
bagian atas hirarki adalah ringkasan laporan menyatukan informasi kunci
tentang keamanan, mutu, dan kemanjuran produk, bersama-sama dengan
penilaian secara keseluruhan dari keseimbangan manfaat dan risiko dari produk.
Di bawah ini dalam hirarki laporan individu mendokumentasikan semua hasil
dari berbagai farmasi, praklinis, dan studi klinis yang memberikan bukti untuk
mendukung kualitas, keamanan, dan kemanjuran produk. Di dasar hirarki duduk
data dari studi individu.

Teknis Dokumen Umum (CTD) adalah format antar-nasional sepakat untuk


aplikasi untuk lisensi. ICH M4E pedoman memberikan panduan yang sangat
berharga pada bagian klinis dari CTD.15 The CTD (Bagian 2.5.5) meminta
suatu "Sekilas Keselamatan." Ini harus menjadi analisis kritis singkat dari data
keamanan, mencatat bagaimana hasil dukungan dan membenarkan informasi
resep yang diusulkan. Sebuah analisis kritis terhadap keselamatan harus
mempertimbangkan efek samping karakteristik dari kelas farmakologis dan
pendekatan yang diambil untuk memantau efek yang sama, pendekatan khusus
untuk pemantauan.

PANDANGAN LEMBAGA PENGAWAS


efek samping tertentu (misalnya, mata, interval QT perpanjangan), toksikologi
hewan yang relevan, dan informasi kualitas produk. Temuan yang
mempengaruhi atau dapat mempengaruhi evalu-asi keselamatan di penggunaan
klinis harus dipertimbangkan dengan sifat populasi pasien dan tingkat paparan,
baik untuk obat dan kontrol perawatan tes. Keterbatasan database keselamatan,
misalnya, berkaitan dengan inklusi kriteria / eksklusi dan mempelajari
demografi subjek, harus dipertimbangkan, dan implikasi dari keterbatasan
tersebut sehubungan dengan memprediksi-ing keamanan produk di pasar harus
secara eksplisit dibahas. Bagian lain yang relevan dari CTD penting untuk
keselamatan termasuk bagian 2.7.4 "Ringkasan keselamatan klinis," yang
merupakan ringkasan dari data yang relevan dengan keselamatan dalam
populasi dimaksudkan, mengintegrasikan hasil laporan studi klinis individu.
Bagian 5.3.5 dari CTD harus berisi laporan studi efikasi dan keamanan individu,
dilakukan oleh sponsor, atau sebaliknya yang tersedia, termasuk semua selesai
dan semua studi yang sedang berlangsung dari obat baik dalam indikasi
diusulkan dan non-diusulkan. Panduan-line ICH E3 menjelaskan isi dari laporan
lengkap untuk studi berkontribusi bukti yang berkaitan dengan keamanan dan
efficacy.16

Pihak berwenang menilai berkas dan, didukung oleh komite ahli, membuat
keputusan tentang apakah obat dapat berlisensi. Serta membuat keputusan pada
keseimbangan keseluruhan manfaat dan resiko dari obat (dan karena itu apakah
lisensi dapat diberikan), pihak yang berwenang juga harus membuat keputusan
tentang bagaimana produk harus digunakan di pasar, termasuk indikasi dan
kontraindikasi untuk digunakan. Lisensi mencakup informasi diatur tentang
produk yang ditujukan untuk pengguna obat ini. Di Uni Eropa informasi ini
disebut Ringkasan Karakteristik Produk dan Pasien Informasi Leaflet. Di AS
informasi ini terkandung dalam insert paket. Target utama sisipan paket dokter,
apoteker, dan profesional kesehatan lainnya (sisipan paket kadang-kadang
disebut "label profesional"). Banyak produk AS juga datang dengan label
pasien, yang (seperti namanya) ditulis menjadi mudah dipahami oleh pasien,
konsumen, dan lainnya "berbaring" orang.

Studi epidemiologi atau bekerja yang dilakukan selama pengembangan produk


harus, jika relevan, dimasukkan dalam berkas yang diserahkan untuk
mendukung permohonan izin. Namun, peran epidemiologi dalam proses
perizinan berjalan lebih jauh dari ini. Semakin banyak, pihak berwenang sedang
membutuhkan bahwa langkah-langkah untuk memantau keamanan produk
sekali pada pasar dan langkah-langkah untuk meminimalkan risiko untuk pasien
dari prod-SLT didokumentasikan, dikaji, dan disepakati selama proses
perizinan.

ICH E2E pedoman "Pharmacovigilance Perencanaan" menyediakan metode


terstruktur untuk meringkas risiko yang terkait dengan obat dan untuk
menyajikan rencana pharmacovigilance ketika produk tersebut dipasarkan.
Pedoman ini dimaksudkan untuk membantu industri dan regulator dalam
kegiatan perencanaan pharmacovigilance, terutama dalam persiapan untuk
periode postmarketing awal obat baru. ICH pedoman menggunakan istilah
"spesifikasi keamanan," pertama kali diciptakan pada proyek strategi farmasi-
covigilance oleh otoritas UK, untuk dokumen menghadirkan risiko yang
teridentifikasi dari obat, potensi risiko teridentifikasi penting, dan berpotensi
berisiko populasi dan situasi yang belum diteliti pra-lisensi. Kotak 8.2
menyediakan

Non-Klinis
Masalahkeamanan non klinistidakdiselesaikanoleh data klinis (misalnya,
kekhawatirandaristudihewantoksisitas, studifarmasi-cologyumum, danstudiinteraksiobat).
Klinis
Keterbatasan database keselamatanmanusia (misalnya,
terkaitdenganukuranpopulasipenelitian, daninklusistudidankriteriaeksklusi)
harusdipertimbangkandanimplikasidariketerbatasantersebutsehubungandenganmemprediksike
amananproduk di pasarharusdidiskusikan .
Populasitidakbelajar di tahappra-lisensi (misalnya, anak-anak, orang tua,
Kotak 8.2. Spesifikasi keamanan: ringkasan struktur.

Ringkasan dari struktur yang diusulkan dari spesifikasi keselamatan. Spesifikasi


keselamatan dimaksudkan untuk membantu mengidentifikasi kebutuhan untuk
pengumpulan data tertentu dalam periode pasca-lisensi dan juga untuk
memfasilitasi pembangunan rencana pharmacovigilance. Rencana
pharmacovigilance didasarkan pada spesifikasi keselamatan. Ini menetapkan
metode yang diusulkan untuk memantau keamanan produk, termasuk kedua
"pharmacovigilance rutin," yaitu, metodologi seperti pelaporan spontan dan
periodik pembaruan keamanan laporan yang diperlukan perusahaan oleh
hukum, dan setiap studi khusus direncanakan sebagai hasilnya risiko atau
potensi risiko diidentifikasi dalam spesifikasi keselamatan. Kotak 8.3
memberikan ringkasan dari struktur yang diusulkan dari rencana
pharmacovigilance. Beberapa pihak berwenang cenderung membutuhkan
spesifikasi keselamatan dan rencana pharmacovigilance sebagai bagian dari
aplikasi untuk lisensi untuk entitas kimia baru dan produk bioteknologi yang
diturunkan. Selain itu, mereka mungkin diperlukan untuk aplikasi untuk
perubahan yang signifikan dalam produk didirikan (misalnya, bentuk baru
dosis, rute baru administrasi, atau proses manufaktur baru dari produk
bioteknologi yang diturunkan) dan untuk produk didirikan yang akan
diperkenalkan ke

RingkasanIsuKeselamatansedangberlangsung

Termasukrisiko yang teridentifikasipenting, potensirisiko, danhilanginformasi.

PraktekPharmacovigilancerutin

Praktek-praktekpharmacovigilance yang umumuntuksemuaprodukharusdijelaskan,


termasukkoleksilaporan ADR spontan, pelaporandipercepatdari ADR laporan,
pelaporanlaporanpembaruankeamananperiodik, deteksisinyal, evaluasimasalah,
memperbaruipelabelan, danpenghubungdenganpihakberwenang. Beberapa regulator
mungkinmemerlukangambarandariorganisasiperusahaandanpraktikuntukmelakukanphar
macovigilance.
Kotak 8.3. Rencana pharmacovigilance: ringkasan struktur.

populasi baru atau indikasi baru yang signifikan. Dari referensi box 8.2 dan 8.3
jelas bahwa epidemiologi memiliki peran sentral dalam pembangunan
spesifikasi keselamatan dan rencana pharmacovigilance.

Sedangkan ICH pedoman "Perencanaan Pharmacovigilance" menyediakan


metode terstruktur untuk mendokumentasikan profil risiko produk dan
pemantauan keamanan direncanakan, tidak berurusan dengan cara
meminimalkan risiko terhadap pasien (selain melalui pemantauan keamanan
yang efektif). Seperti yang dinyatakan sebelumnya, pihak berwenang
mendorong dan dalam beberapa kasus mengharuskan langkah-langkah untuk
meminimalkan risiko untuk pasien dari produk didokumentasikan, dikaji, dan
disepakati selama proses perizinan (lihat juga Bab 33). Di sini sekali lagi, ahli
epidemiologi yang dapat memainkan peran sentral. FDA telah mengeluarkan
rancangan pedoman merancang rencana minimalisasi risiko dan bagaimana ini
harus disampaikan kepada FDA untuk approval.Before menggambarkan
beberapa konsep kunci termasuk dalam bimbingan FDA, ada baiknya
mempertimbangkan sejenak beberapa terminologi yang digunakan (lihat juga
Kotak 8.1). Terminologi yang digunakan berbeda di berbagai daerah dan ini
dapat menyebabkan kebingungan. Sebagai contoh, manajemen risiko jangka
telah digunakan untuk berarti "keseluruhan proses dan con-tinuing
meminimalkan risiko di seluruh siklus hidup produk untuk mengoptimalkan
keseimbangan manfaat / risiko." Mengingat bahwa definisi WHO dari
pharmacovigilance adalah "ilmu dan kegiatan berkaitan dengan deteksi,
penilaian, di bawah-berdiri dan pencegahan efek samping atau masalah lain
yang terkait narkoba, "dapat dilihat bahwa ruang lingkup manajemen risiko
syarat dan pharmacovigilance tumpang tindih. Untuk alasan ini, kami lebih suka
menggunakan definisi yang luas dari pharma-covigilance seperti yang diusulkan
oleh WHO sambil menghindari manajemen risiko jangka sama sekali. Untuk
intervensi yang bertujuan untuk mengurangi risiko kita lebih suka, istilahnya
"minimalisasi risiko."

Dalam hal minimalisasi risiko (lihat juga Bab 33), draft pedoman FDA
merekomendasikan bahwa perusahaan mempertimbangkan mengirimkan
rencana pengurangan risiko ke FDA untuk diskusi dan kesepakatan yang sesuai.
rencana tersebut mungkin disampaikan selama pengembangan produk, pada
saat perizinan menilai-ment, atau dalam fase pasca-lisensi (terutama dalam hal
masalah keamanan obat yang muncul atau berubah). Pengajuan ideal untuk
regulator pada minimalisasi risiko akan memberikan latar belakang dari tujuan
pengurangan risiko dan pemikiran untuk pendekatan, tujuan sasaran dan tujuan,
alat yang diusulkan, alasan untuk mendukung mereka dan rencana
implementasi, dan rencana evaluasi. Draft pedoman FDA pada minimalisasi
risiko berisi beberapa konsep kunci penting untuk epidemiologi. Draft pedoman
FDA mengusulkan bahwa sponsor untuk produk harus mempertimbangkan
bagaimana untuk meminimalkan risiko dari penggunaan produk ini.
perencanaan minimalisasi risiko dapat meliputi label produk, penilaian risiko,
mengumpulkan data tentang dugaan ADRs, dan studi keamanan obat khusus
dan intervensi. Bagi banyak produk dengan ADRs yang diakui dan non-serius,
minimalisasi risiko mungkin hanya mencakup label produk dan hati-hati
postmar-marketing surveillance (pengumpulan data keselamatan dan penilaian
data tersebut). Namun, untuk produk lain, mungkin mereka yang memiliki
profil buruk didefinisikan keamanan, ADR serius, atau isu-isu keselamatan
yang muncul, rencana minimalisasi risiko yang lebih formal harus
dikembangkan dan disepakati dengan regulator. program minimalisasi risiko
harus memiliki satu atau pengurangan risiko lebih banyak gol sebagai titik
akhir. Tujuan pengurangan risiko terbaik akan disesuaikan dengan risiko
spesifik perhatian dan, idealnya, metode berbasis bukti akan digunakan untuk
menargetkan pencapaian proses kritis, perilaku, dan faktor manusia untuk
meningkatkan keselamatan. Tujuan minimalisasi risiko dijabarkan ke dalam
program minimalisasi risiko individu atau protokol. Sebuah rencana
minimalisasi risiko atau program akan menjadi rencana yang berkembang,
terus-menerus dievaluasi untuk sukses, dan diubah jika tujuan tidak terpenuhi
atau masalah keamanan berubah atau muncul. Secara umum, alat-alat yang
memfasilitasi atau menghambat resep, pengeluaran, atau penggunaan produk
untuk situasi yang paling tepat atau populasi pasien harus digunakan hanya
ketika pendekatan semacam ini diperlukan untuk mencapai tujuan program.
Tabel 8.3, berdasarkan bimbingan FDA, menggambarkan beberapa alat
minimalisasi risiko sedang digunakan.

Epidemiologi yang dapat memainkan peran sentral dalam pemilihan alat


minimalisasi risiko untuk memenuhi tujuan tertentu. Alat harus memiliki
kemungkinan tinggi mencapai tujuan mereka berdasarkan bukti efektivitas
dalam pengaturan lainnya. Faktor yang perlu dipertimbangkan dalam memilih
alat mungkin termasuk masukan dari pemangku kepentingan pada kelayakan
dan penerimaan alat, konsistensi dengan alat yang sudah digunakan,
didokumentasikan efek-iveness dalam mencapai tujuan tertentu, dan tingkat
variabilitas, validitas, dan kemampuan untuk memproduksi alat dan / atau hasil.
Beberapa penelitian telah mendokumentasikan bahwa komunikasi risiko
sebelumnya dan minimalisasi risiko intervensi untuk mengurangi masalah
keamanan telah bervariasi efektif. Evaluasi minimalisasi risiko, baik sebelum
dan setelah implementasi, karena itu penting untuk membuat upaya
berkelanjutan untuk meminimalkan risiko untuk pasien dan untuk memperbaiki
masalah atau kegagalan. Lebih dari satu metode evaluasi mungkin diperlukan
untuk menilai intervensi minimalisasi risiko, dan trade-off mungkin diperlukan
antara validitas, akurasi, ketepatan waktu, keterwakilan, bias, pemaksaan sosial,
dan biaya. Idealnya, langkah-langkah evaluasi akan menjadi hasil kesehatan
yang sebenarnya; mengukur akan menangkap hasil sendiri daripada pengganti.
Jika ukuran proses yang dipilih bukan hasil yang sebenarnya, penting untuk
meninjau bukti yang mendukung hubungan antara proses dan hasil akhir yang
menarik.

Tabel 8.3. Beberapa mungkin alat minimalisasi risiko

Pendidikan umum dan penjangkauan untuk para profesional kesehatan dan


pasien (di luar masukkan paket AS atau informasi produk Uni Eropa):

Surat kepedulian profesional kesehatan

Program latihan

Pendidikan kesehatan berlanjut

Pemberitahuan Umum (komunikasi dari pihak yang berwenang)

Panduan pengobatan

Sistem yang memandu keadaanindividu resep, pengeluaran, dan penggunaan:

Perjanjian Pasien / informed consent

Program Sertifikasi bagi praktisi


Pendaftaran dokter / apoteker / pasien dalam program keselamatan

Pasokan terbatas atau isi ulang produk

Kemasan produk khusus

Sistem untuk membuktikan bahwa langkah-langkah keamanan (misalnya,


fungsi hati pengujian) telah puas (mis, stiker pada resep, dokter
pengesahankemampuan)

Sistem akses dibatasi dirancang untuk menegakkan kepatuhan individu dengan


unsur-unsur program:

Resep hanya oleh dokter yang terdaftar

Pemberian hanya dengan apotek terdaftar atau praktisi

Pemberian Obat hanya untuk pasien dengan bukti kondisi yang aman digunakan
(misalnya, hasil tes lab)

Penarikan produk (langkah-langkah khusus bergantung pada kerangka hukum di


berbagai daerah):

Suspensi pemasaran dan penggunaan

Suspensi lisensi

Pencabutan lisensi

POST-PERIZINAN

Pada saat perizinan, karena keterbatasan uji klinis dalam simulasi kompleksitas
penggunaan "dunia nyata", kita umumnya memiliki pengetahuan yang tidak
lengkap tentang keamanan obat baru. Bagi kebanyakan obat-obatan, setelah
peluncuran ke pasar, paparan obat meningkat dari beberapa ratus atau ribuan
pasien terkena selama program devel-ngunan, puluhan atau ratusan ribu atau
bahkan jutaan pasien. Dengan meningkatnya globalisasi industri farmasi,
paparan massal ini dapat terjadi dalam beberapa bulan dari peluncuran produk.
Selanjutnya, jalan dikendalikan obat digunakan selama pengembangan beralih
ke anarki relatif resep sehari-hari, pengeluaran, dan penggunaan obat-obatan.
Dengan ketersediaan umum produk, kita belajar tentang efek obat dalam
praktek sehari-hari, termasuk ADR langka dan ADR yang hanya terjadi setelah
penggunaan jangka panjang, serta ADRs terkait dengan co-resep dengan obat
lain dan mereka yang unik untuk atau ditingkatkan oleh komorbiditas pada
populasi diperlakukan. Pengetahuan tambahan dari profil keamanan yang
digunakan klinis yang normal harus sistematis dikelola dan dievaluasi untuk
perlindungan pasien.

Peran ahli epidemiologi ini jauh lebih baik didirikan pada fase pasca-lisensi dari
kehidupan obat ini: epidemiologi yang memainkan peran sentral dalam
pharmacovigilance, tetapi mungkin juga terlibat dalam variasi, pembaharuan,
dan reklasifikasi obat (lihat Tabel 8.1). Selain itu, pemerintah yang semakin
meningkat-ingly membutuhkan data tentang efektivitas biaya (lihat Bab 41) dan
efektivitas relatif sebelum termasuk obat baru di formularium untuk digunakan
atau sebelum menyetujui untuk mengganti pasien untuk biaya obat. Di sini
sekali lagi epidemiologi yang mungkin memainkan peran dalam pengumpulan,
analisis, atau presentasi data.

pharmacovigilance

Pemantauan keamanan obat dipasarkan dikenal sebagai pharmacovigilance,


didefinisikan oleh WHO sebagai "ilmu dan kegiatan yang berkaitan dengan
deteksi, penilaian, pemahaman dan pencegahan efek samping atau obat lain
masalah terkait." Di sebagian besar wilayah dunia , undang-undang farmasi
menempatkan tanggung jawab khusus
di perusahaan farmasi untuk melakukan pharmacovigilance untuk produk
mereka. Misalnya, menurut hukum Uni Eropa, 23,24

perusahaan memegang Pemasaran Otorisasi (lisensi) untuk produk harus


memiliki sistem pharmacovigilance di tempat, termasuk "orang yang memenuhi
syarat" yang bertanggung jawab atas pelaksanaan pharmacovigilance, sistem
untuk mengumpulkan dan melaporkan dugaan ADRs, dan produksi dan
penyerahan kepada regulator periodik pembaruan keamanan reports.25 di
beberapa negara ada juga kewajiban hukum dari profesional perawatan
kesehatan tertentu untuk melaporkan dugaan ADR kepada pihak berwenang
(misalnya, di Perancis). Untuk memahami praktek pharmacovigilance akan
sangat membantu untuk memecahnya menjadi langkah-langkah proses. Tabel
8.4 memberikan rincian seperti itu. Bagian berikutnya menjelaskan langkah-
langkah secara lebih rinci dengan penekanan khusus pada aspek yang relevan
dengan epidemiologi.

Tabel 8.4. langkah-langkah proses pharmacovigilance

• Pengumpulan data
• Manajemen data
• Signal (safety issue) deteksi
• Penilaian risiko dan kuantifikasi
• Manfaat / penilaian risiko dan pengambilan keputusan
• Aksi untuk mengurangi risiko atau meningkatkan manfaat
• Komunikasi risiko atau intervensi
• Audit (pengukuran hasil intervensi)
Pengumpulan dan Pengelolaan Data

Data pada keamanan obat dari semua sumber yang tersedia perlu dikumpulkan
dan dikelola secara sistematis agar dapat mendeteksi kemungkinan bahaya
keamanan obat seefektif mungkin. Penilaian selanjutnya muncul data yang
memungkinkan kita untuk mendeteksi dan menilai keparahan masalah
keamanan yang sebelumnya tidak dikenal, serta perubahan frekuensi,
keparahan, atau faktor risiko untuk masalah keamanan yang diketahui. aspek-
aspek pharmacovigilance, yang dikenal sebagai deteksi sinyal dan evaluasi
sinyal, dijelaskan dalam bagian tertentu kemudian.

perusahaan farmasi memiliki kewajiban untuk mengumpulkan semua data yang


relevan dengan keamanan produk mereka dan untuk menyerahkan data tersebut
kepada regulator sejalan dengan bimbingan dan undang-undang. Regulator
memantau data ini untuk sinyal tetapi juga mengumpulkan dan data keamanan
layar pada produk obat untuk deteksi sinyal independen dari perusahaan
farmasi. pengumpulan data keselamatan dilakukan sepanjang masa pasca-lisensi
dari produk, sampai produk tersebut dihentikan atau ditarik, seperti masalah
keamanan baru dapat dan telah muncul setiap saat, bahkan dengan produk
mapan.

Pengumpulan dan pengelolaan data harus sistematis, menggabungkan jaminan


kualitas dan kontrol tindakan, memanfaatkan sumber daya yang diperlukan,
keterampilan, dan peralatan untuk memastikan akses yang tepat terhadap data
untuk deteksi sinyal. Proses telah berevolusi dan telah diharmonisasikan dalam
pengetahuan bahwa pra-lisensi dan pasca-lisensi konsep pelaporan keselamatan
klinis dan praktek saling bergantung dan bahwa laporan perlu ditransfer secara
efisien kepada pihak yang berbeda. Hasilnya adalah bahwa ada definisi secara
luas setuju, standar, isi, dan kondisi untuk kasus pelaporan, termasuk untuk
transmisi elektronik untuk kasus individual laporan. Proyek menetapkan standar
komunikasi elektronik untuk menjamin integritas informasi dan pertukaran data
antara perusahaan farmasi dan otoritas. Ada juga standar yang telah disepakati,
konten, dan format untuk laporan pembaruan keamanan periodik (PSURs)
untuk perusahaan yang disampaikan kepada regulator pada titik-titik waktu
yang tetap dari perizinan. Data keselamatan lainnya dan sinyal keamanan
potensial akan menjadi perhatian dari regulator melalui proses yang melibatkan
aplikasi untuk mengubah lisensi produk (variasi), komitmen pasca-lisensi dan
tindak lanjut langkah-langkah (yang disepakati pada saat perizinan), skrining
rutin literatur yang diterbitkan , komunikasi antara regulator, dan pasien dan
pertanyaan profesional kesehatan.

Luasnya obat digunakan berarti bahwa mekanisme yang berbeda diperlukan


untuk mengumpulkan data keselamatan dan eksposur yang relevan di berbagai
domain, termasuk pra-skripsi dan non-resep pengaturan dan pengaturan
perawatan yang berbeda (seperti perawatan darurat, rumah sakit, perawatan
primer, swasta , militer, perawatan paliatif, pelayanan kontrasepsi, rumah
perawatan perumahan, layanan psikiatri, bangsal darurat). jamu dan obat
tradisional dapat menimbulkan masalah keamanan di mana standar data dan
ketersediaan yang limited.26 particu-larly

Peraturan dan Etika dalam Penelitian

Pharmacovigilance Uni Eropa memberikan panduan tentang prinsip-prinsip


penting untuk diterapkan dalam berbagai in situ-negosiasi terkait pelaksanaan
studi yang mengevaluasi keamanan produk berlisensi dan disponsori atau
sebagian disponsori oleh industri farmasi. Tingkat dan tujuan studi pasca-lisensi
keselamatan, desain, perilaku, hubungan dengan pihak berwenang, promosi
obat-obatan, partisipasi dokter, dan pembayaran dan etika isu dibahas. Di AS,
FDA telah menerbitkan pedoman bagi industri berjudul "Good Clinical
Practice:. Bimbingan Konsolidasi" Good Clinical Practice(GCP) adalah etika
dan ilmiah standar kualitas internasional untuk merancang, melaksanakan,
merekam, dan pelaporan uji coba yang melibatkan partisipasi dari subyek
manusia, berlaku untuk kedua uji klinis dan studi postmarketing. Kesesuaian
dengan standar ini memberikan jaminan publik bahwa hak, keamanan, dan
kesejahteraan subyek percobaan dilindungi, konsisten dengan prinsip-prinsip
yang memiliki asal mereka dalam Deklarasi Helsinki, dan bahwa data
percobaan klinis yang kredibel. FDA telah mengembangkan sebuah website
yang membahas hal-hal yang berkaitan dengan perlindungan subjek manusia
dan memberikan bimbingan untuk melakukan uji klinis dengan obat diteliti dan
informasi untuk memenuhi peraturan dari FDA. Website ini berisi link ke
bimbingan GCP disebutkan di atas, serta peraturan yang sesuai.

Untuk studi pasca-lisensi prospektif dilakukan, peraturan mengharuskan standar


tertinggi dari perilaku profesional dan kerahasiaan harus selalu dijaga dan setiap
perundang-undangan nasional yang relevan pada perlindungan data harus
diikuti (lihat juga Bab 38). hak pasien untuk kerahasiaan adalah yang
terpenting. Identitas pasien dalam dokumen studi harus dikodifikasikan, dan
hanya orang yang berwenang harus memiliki akses ke informasi pribadi yang
dapat diidentifikasi jika prosedur verifikasi data yang menuntut pemeriksaan
rincian tersebut. Rincian pribadi diidentifikasi harus selalu dijaga dalam
keyakinan. Referensi ke sebuah komite etik diperlukan jika pasien harus
didekati untuk informasi, penyelidikan tambahan harus dilakukan, atau jika
diusulkan untuk mengalokasikan pasien sistematis untuk perawatan. Sejak Mei
2004, di Uni Eropa, studi intervensi jatuh di bawah Uni Eropa Clinical Trials
Directive. Studi keamanan pasca-lisensi yang uji klinis acak atau studi
observasional di mana intervensi atas dan di atas praktek klinis yang normal
terjadi tunduk pada persyaratan dalam legis-lation. Di AS, Laporan Belmont
adalah dasar pondasi yang standar saat ini untuk perlindungan subyek manusia
beristirahat. Banyak penelitian biomedis yang dilakukan di Amerika Serikat
diatur baik oleh aturan yang berjudul "Kebijakan Federal untuk Perlindungan
Subyek Manusia" (juga dikenal sebagai "Aturan umum," yang dikodifikasikan
untuk HHS di sub-bagian A dari Judul 45 CFR bagian 46) dan / atau
perlindungan FDA manusia subyek Peraturan di 21 CFR bagian 50 dan 56.
FDA memiliki peraturan perlindungan subjek manusia tambahan, yang berlaku
untuk penelitian yang melibatkan produk diatur oleh FDA. Meskipun subjek
manusia peraturan membutuhkan-KASIH, yang berlaku untuk sebagian Federal
didanai dan beberapa penelitian yang didanai swasta, termasuk perlindungan
untuk membantu memastikan privasi subyek dan kerahasiaan informasi,
maksud dari Peraturan Privasi, antara lain, adalah untuk melengkapi
perlindungan ini dengan mengharuskan entitas tertutup untuk menerapkan
langkah-langkah khusus untuk melindungi privasi informasi kesehatan
diidentifikasi secara individual. kerahasiaan pasien juga merupakan tema yang
berulang dalam bimbingan GCP AS sebelumnya direferensikan.Penelitian
dilakukan terhadap catatan medis yang ada juga harus mempertimbangkan
perlindungan data, penganoniman, persetujuan, dan kerahasiaan. 1998 Data
Protection Act, pelaksanaan Inggris dari direktif Uni Eropa yang relevan,
menekankan perlunya persetujuan oleh orang, karena berasal data. Dewan
Medis Inggris Umum diikuti laporan sebelumnya pada kerahasiaan dengan
pedoman yang menyatakan persetujuan biasanya diperlukan sebelum
pengungkapan informasi identitas untuk keperluan seperti penelitian dan
epidemiologi. Mana tidak praktis bagi orang yang memegang catatan baik untuk
mendapatkan persetujuan tegas untuk pengungkapan atau anonim catatan, data
yang dapat diungkapkan untuk penelitian, peserta yang tersedia telah diberi
informasi tentang akses ke catatan mereka, dan tentang hak mereka untuk
mengajukan keberatan. Keberatan harus dihormati. Biasanya pengungkapan
tersebut akan dibuat untuk memungkinkan orang luar tim peneliti untuk
catatananonim, atau untuk mengidentifikasi peserta yang dapat diundang untuk
berpartisipasi dalam studi.

Di Inggris ada juga sistem "Caldicott guardians": tanggung jawab utama di


antaranya adalah untuk menyepakati dan meninjau protokol internal untuk
perlindungan dan penggunaan informasi yang dapat diidentifikasi yang
diperoleh dari pasien. Beroperasi di peran strategis dan penasehat, wali harus
puas bahwa protokol ini mengatasi kebutuhan nasional bimbingan / kebijakan
dan hukum dan bahwa operasi mereka dimonitor. Di Inggris, UU Kesehatan dan
Sosial Perawatan 2001 termasuk klausul yang memungkinkan Peraturan harus
dibuat untuk memungkinkan pengungkapan informasi untuk tujuan tertentu
(yang telah disetujui oleh badan hukum independen, Pasien informasi Grup
Penasehat). Ini memberikan dasar yang aman dalam hukum untuk
pengungkapan mana tidak praktis untuk memperoleh persetujuan pasien.

Pandangan Data Komisaris Perlindungan UK adalah bahwa data pribadi yang


telah disesuaikan tetap data pribadi dalam arti Data Protection Act 1998,
asalkan kunci untuk memecahkan kode itu tetap ada. Dengan demikian, data
yang dikodekan jatuh dalam lingkup Data Protection Act bahkan jika kunci
untuk memecahkan kode itu tidak dapat diakses oleh peneliti. Pandangan
beberapa peneliti adalah bahwa interpretasi ini, jika secara luas dipegang dan
ditegakkan, akan membahayakan banyak kegiatan surveilans penting untuk
perlindungan kesehatan individu dan peneliti secara keseluruhan. masyarakat
juga menganggap bahwa ada kebutuhan untuk menemukan keseimbangan
antara memfasilitasi penting penelitian dan melindungi kerahasiaan pasien, dan
bahwa antar-pretation dari Undang-Undang Perlindungan data tahun 1998 dan
bagaimana hal itu mempengaruhi pemberian perawatan kesehatan dan
penelitian epidemiologi membutuhkan klasifikasi. lanjut Di AS, para peneliti
melakukan tinjauan retrospektif catatan medis harus juga mengambil langkah-
langkah untuk memastikan privasi pasien dan perlindungan catatan medis
terkait. Lihat Bab 38 untuk informasi lebih lanjut tentang masalah etika dalam
melakukan penelitian farmakoepidemiologic.

Deteksi Sinyal

Sebuah sinyal didefinisikan oleh WHO sebagai "melaporkan informasi pada


hubungan kausal mungkin antara peristiwa yang merugikan dan obat, hubungan
yang tidak diketahui atau tidak lengkap didokumentasikan sebelumnya.
Biasanya lebih dari satu laporan diperlukan untuk menghasilkan sinyal,
tergantung pada keseriusan acara dan kualitas informasi. "36 Volume IX dari
peraturan yang mengatur Produk Obat untuk Manusia dan Hewan Gunakan di
Uni Eropa menganggap sinyal menjadi "masalah keamanan yang berpotensi
serius yang berhubungan dengan produk ditunjukkan oleh serangkaian ADR tak
terduga atau serius atau perubahan tingkat keparahan, karakteristik atau
frekuensi efek samping yang diharapkan." 27 secara historis, kebanyakan sinyal
keselamatan kedokteran telah datang dari spontan melaporkan ADR dicurigai.
Namun, masalah keamanan utama dapat dideteksi dari salah satu sumber data
yang relevan dengan keselamatan obat ini. Sebagai contoh, studi toksisitas baru
dilakukan pada obat didirikan lama telah menyebabkan tindakan pengaturan
penting. Salah satu contoh adalah karsinogenisitas dengan pencahar stimulan
danthron. uji klinis acak baru juga telah mengangkat pertanyaan keamanan
tentang produk didirikan. Sebagai contoh, studi ALLHAT bahwa dibandingkan
antihipertensi yang berbeda menunjukkan kematian yang lebih tinggi, terutama
dari gagal jantung, pada kelompok yang mendapat satu terapi dibandingkan
dengan perawatan pembanding. Contoh dapat diberikan dari salah satu sumber
data yang dibahas dalam bab ini.

Laporan spontan
Metodologi deteksi sinyal yang umum digunakan oleh lembaga regulatori
berdasarkan laporan spontan diduga ADR harus dipertimbangkan dalam
konteks kekuatan dan kelemahan dari sistem pengawasan seperti itu (lihat juga
Bab 9 dan 10). Digunakan untuk menghasilkan informasi tentang ADR langka
dan tidak diketahui sebelumnya, laporan spontan dikumpulkan terutama melalui
sistem surveilans pasif di mana pelaporan diduga ADR untuk peraturan penulis-
tanggung bersifat sukarela bagi para profesional kesehatan (di kebanyakan
negara) tapi hukum bagi pemegang lisensi. Di beberapa negara, terutama
Amerika Serikat, laporan ADR diduga juga diterima langsung dari pasien.

laporan ADR spontan yang paling berguna di mana reaksi tidak biasa dan tak
terduga di indikasi yang sedang dirawat dan di mana ADR terjadi dalam
hubungan temporal dekat dengan dimulainya pengobatan atau mengikuti
kenaikan dosis. Dari sudut pandang peraturan, ini adalah laporan dugaan ADR
dan fitur unik dari sistem pelaporan spontan adalah bahwa kecurigaan wartawan
telah ditangkap. Penilaian laporan ADR individu dapat menunjukkan apakah
mungkin ada penjelasan alternatif untuk reaksi diamati selain obat. Kualitas
buruk dan / atau informasi yang tidak lengkap dalam laporan kasus sering
membuat interpretasi hubungan kausal antara produk dan reaksi yang diamati,
serta generalisasi yang lebih luas, sulit. Jumlah kasus ADR yang dilaporkan
tidak menjadi indikator yang baik dari sinyal sebagai chan-neling pasien
berisiko tinggi untuk terapi baru juga menyebabkan peningkatan pelaporan
dengan agen baru. ADR cenderung dicurigai dan dilaporkan secara spontan di
mana reaksi memiliki onset berbahaya, reaksi terjadi hanya mengikuti
pengobatan jangka panjang, atau di mana penyakit ini dirawat memiliki insiden
tinggi hasil yang serupa. Selain itu, mereka ADRs yang disebabkan oleh
kurangnya efikasi tidak dapat dianggap sebagai ADRs dan karena itu tidak
dilaporkan. laporan ADR spontan bersifat sukarela untuk kesehatan profesi-als
di sebagian besar negara. Pengurangan pelaporan adalah fitur dari semua sistem
pelaporan tersebut. Frekuensi pelaporan untuk obat yang diberikan bervariasi
dari waktu ke waktu, dengan waktu dari pemasaran pertama, dan dengan
periode aktivitas media sekitarnya produk.

Perbandingan Pemantauan Resep-Event (PEM) (lihat Bab 12) hasil penelitian


untuk sampel 10 obat di Inggris dengan laporan ADR diduga dari UK basis data
keselamatan peraturan (Gesit) menunjukkan bahwa hingga 32,1% dari reaksi
berlabel serius yang dilaporkan kepada regulator dibandingkan dengan 6,5%
untuk reaksi berlabel non-serius. Reaksi berlabel serius berlabel dan non-serius
yang signifi-cantly lebih mungkin melaporkan dari yang non-serius berlabel
reaksi. Studi ini telah baru-baru ini diperbarui selama 15 obat baru dipasarkan;
53% dari kejadian diklasifikasikan sebagai ADR serius telah dilaporkan secara
spontan kepada otoritas UK.

Sebuah pola yang sama dari pelaporan diamati di Perancis, meskipun tidak
dilaporkan muncul Alasan lebih besar. untuk tidak dilaporkan termasuk
kurangnya waktu, kurangnya bentuk laporan, dan kesalahpahaman bahwa
keyakinan mutlak bahwa obat menyebabkan peristiwa penting dalam keputusan
untuk mengirim laporan.Mengingat variabilitas dalam pelaporan dan banyak
faktor yang mempengaruhi pelaporan, itu diterima dengan baik bahwa tingkat
pelaporan tidak dapat digunakan untuk memperkirakan tingkat insiden dan
perbandingan tarif pelaporan antara obat-obatan atau negara mungkin tidak
dapat diandalkan atau informatif. Komite UK Keselamatan Obat (CSM) telah
berhati-hati dalam menggunakan laporan ADR spontan saja sebagai dasar untuk
kegiatan peraturan utama kecuali bukti telah com-pelling dan tidak dapat
dijelaskan oleh faktor-faktor lain selain peningkatan toksisitas.

Umumnya, laporan ADR spontan diperiksa oleh review manual sistematis


setiap laporan yang diterima. Sebagai bantuan untuk sinyal deteksi, skrining
algoritma berdasarkan sistem deteksi sinyal otomatis dikawinkan telah
dieksplorasi. Metode tersebut telah disebut sebagai data mining. Meskipun
metodologi pendekatan berbeda, sistem otomatis menggunakan deteksi sinyal
kuantitatif pharmacovigilance menilai sejauh mana jumlah kasus yang diamati
berbeda dari jumlah kasus yang diharapkan sebagai ukuran ketidakseimbangan.
Perbandingan antara metode WHO data mining (Bayesian kepercayaan jaringan
propagasi saraf (BCPNN) komponen informasi) dan pelaporan rasio odds,
proporsional rasio pelaporan (PRR), Yule Q, probabilitas Poisson, dan uji chi-
square menunjukkan bahwa langkah-langkah yang berbeda secara luas
dibandingkan ketika empat atau lebih kasus per kombinasi obat-reaksi telah col-
lected. Tujuan dari ini bantuan statistik adalah untuk menyediakan sarana
membandingkan frekuensi kombinasi obat-acara dengan semua kombinasi
lainnya seperti dalam database yang sedang dipertimbangkan, dengan potensi
untuk deteksi dini sinyal potensi obat-acara diasosiasikan-negosiasi. Setiap
sinyal tersebut harus dikonfirmasi oleh evaluasi rinci oleh dokter yang terampil
dan ahli epidemiologi dari laporan kasus yang dihasilkan signal.46 Rinci
descrip-tions dari PRR itu, empiris Bayes mean geometrik, yang BCPNN
komponen informasi, dan metode lainnya telah diterbitkan.

sistem pengkodean dan pengambilan juga dapat mempengaruhi pola deteksi


sinyal. Misalnya, dalam peraturan obat, kamus medis disebut MedDRA
digunakan yang dikembangkan khusus untuk tujuan coding efek samping dan
reaksi. Namun, deteksi sinyal membutuhkan pengetahuan tentang kamus dan
strukturnya. MedDRA diatur dalam struktur hirarki dengan istilah tingkat yang
lebih rendah (LLTs) dikumpulkan bersama di bawah istilah disukai (PTS), yang
pada gilirannya dikelompokkan bersama di bawah istilah level yang lebih tinggi
(HLTs), akhirnya mencapai tingkat tertinggi dalam hirarki, kelas organ sistem
(SOC). deteksi sinyal di PT tingkat mungkin encer sinyal potensial dengan
mencari database untuk hanya satu dari sejumlah istilah yang terkait secara
klinis. Sebaliknya, kombinasi dari PTS dibawa bersama di tingkat yang lebih
tinggi dalam hirarki dapat membatasi kemampuan untuk mendeteksi sinyal,
sebagai PTS yang mewakili konsep medis yang berbeda atau Condi-tions yang
sangat berbeda dalam kepentingan klinis mereka dapat dikelompokkan
bersama-sama, terutama di tertinggi tingkatan dalam hirarki.

Konsep istilah kritis (misalnya, sindrom Stevens-Johnson, anemia aplastik) juga


telah digunakan dalam deteksi sinyal, di mana istilah ini sering menunjukkan
toksisitas obat-terkait serius; laporan termasuk hal penting memerlukan
perhatian khusus dan harus dipilih untuk perhatian khusus, terlepas dari hasil
data mining atau angka dari laporan yang diterima.

Prioritas: Dampak Analisis Konsep

Evaluasi sinyal terperinci menggunakan semua data yang relevan adalah


kompleks dan sumber daya intensif. Oleh karena itu regulator harus
memprioritaskan sinyal. Dampak potensial dari masalah keamanan pada
kesehatan masyarakat adalah dasar untuk prioritas regulator 'tapi, sampai saat
ini, penghakiman dampak telah berdasarkan kriteria kualitatif dan subjektif.
Kriteria tersebut antara lain "SNIP": regulator akan memprioritaskan sinyal
yang relatif kuat yang dinilai menjadi baru, secara klinis penting, dan memiliki
potensi untuk pencegahan.

Regulator Inggris telah mengembangkan dan diujicobakan, alat kuantitatif baru


untuk sinyal memprioritaskan, tujuannya adalah untuk difokuskan pada evaluasi
sinyal yang lebih rinci tentang isu-isu yang mempunyai bukti kuat dan dimana
tindakan ini yang paling mungkin memiliki dampak pada kesehatan masyarakat
. Kedua bukti dimensi yaitu kekuatan dan dampak kesehatan masyarakat-yang
mencetak atas dasar berbagai komponen. Komponen untuk skor bukti kekuatan
adalah: (i) PRR diterapkan pada data pelaporan spontan dan 95% batas
kepercayaan yang lebih rendah (ini adalah cara memperhitungkan baik besarnya
sinyal dan tingkat presisi dari estimasi) , (ii) kekuatan / kelemahan dari
serangkaian kasus yang dipertimbangkan, dan (iii) reaksi hal biologis dapat
diterima diduga berdasarkan sejumlah faktor yang mendukungnya. Komponen
skor dampak kesehatan masyarakat adalah: (i) jumlah kasus yang ADR pada
populasi per tahun sejak ADR pertama dilaporkan obatnya, (ii) konsekuensi
kesehatan potensial dari ADR (fatal dan nonfatal) , dan (iii) urutan besarnya
tingkat pelaporan untuk kombinasi obat-reaksi selama tahun sebelumnya.
Sebuah penyilangan-klasifikasi bukti kekuatan dengan dampak kesehatan
masyarakat dapat memberikan bantuan dalam memprioritaskan sinyal. Hasil
numerik dari enam variabel telah dikategorikan ke dalam empat kelompok
disarankan dengan tindakan konsekuensial (Gambar 8.2). Tabel angka dan
memotong poin telah diturunkan secara empiris. Sedangkan faktor tambahan
yang mendukung hal yang dapat diterima seperti efek kelas atau mekanisme
membantu mendalilkan jika ada,

BUKT
I

Kekuatan Kelemahan

Majo
r A B
Priorita Ada
s tinggi: kebutuhan

mengump
Evaluasi ulkan
ketidakhadiran mereka tidak menghalangi
lebih lanjut informasi
sinyal mencetak prioritas tinggi. Analisis
kepekaan tes kategorisasi ketahanan Diperlu lebih
dalam kaitannya dengan masing-masing kan banyak
dari enam variabel input.

KESEHATAN MASYARAKAT
Priorot
as Tidak ada
Evaluasi sinyal dan Kuantifikasi Risiko C rendah: D tindakan

Untuk
IMPLIKASI

tindaka dibenarka
Langkah-langkah awal evaluasi masalah
n n
keamanan obat potensial akan fokus pada
penilaian kausalitas, identifikasi setiap pada
kemungkinan penyebab lain dari efek waktu
samping yang dilaporkan, dan menilai
saat ini
risiko untuk kedua individu dan
masyarakat, baik dari segi frekuensi dan
Mino
keseriusan reaksi.
r
Ketika sinyal dari ADR diduga muncul
dari laporan spontan, setiap kasus serupa lainnya dilaporkan sebelumnya,
membentuk serangkaian kasus, juga harus dievaluasi. Mengembangkan definisi
kasus dan menentukan tingkat hirarki kamus yang akan digunakan sangat
penting untuk identifikasi kasus tambahan. Dari perspektif regulasi, pengawasan
definisi kasus harus mendukung kepekaan lebih khusus. Strategi pencarian
harus direproduksi dalam pandangan sifat dinamis dari database pelaporan.
Pemberitaan menilai, jumlah laporan ADR yang diterima dibagi dengan taksiran
penggunaan (exposure) terhadap produk, dapat berguna untuk generasi
hipotesis. Namun, mereka tunduk pada banyak keterbatasan. Pembilang adalah
subjek yang dikenal berubah-ubah dan di bawah-pemastian. Pilihan penyebut
harus didikte oleh pertanyaan keamanan obat-obatan; misalnya, semua
penggunaan rute tertentu dari administrasi atau semua digunakan pada anak-
anak. Laporan CIOMS Kelompok Kerja V "Tantangan saat ini di
pharmacovigilance: pendekatan pragmatis" memberikan penjelasan yang baik
dari faktor dalam pemilihan, dan keterbatasan format penyebut yang berbeda
seperti jumlah kemasan, jumlah unit, jumlah hari orang-pengobatan, jumlah
pasien, atau jumlah penulis resep.60 Pilihan ideal penyebut, seperti jumlah
pasien, mungkin tidak tersedia untuk semua sektor pasar, seperti berbasis rumah
sakit, perawatan primer, atau penggunaan non-resep. Pencocokan pembilang
dan penyebut berarti mengambil setidaknya periode waktu dan lokasi geografis
ke kumpulan catatan kejadian. Sementara stratifikasi lebih lanjut berdasarkan
usia, jenis kelamin, atau kovariat lainnya yang diinginkan, sering tidak mungkin
dimana hanya data pada volume yang tersedia dijual.60 (Lihat juga Chapter 27.)

Idealnya, studi sistematis harus ditinjau untuk memperkirakan kejadian ADR


dan estimasi sekitar interval kepercayaan. Perhitungan perkiraan frekuensi
menggunakan pasien-waktu sebagai penyebut berasumsi bahwa tingkat bahaya
konstan; tiga model fungsi hazard (tingkat kejadian sesaat) diringkas. Dalam
model hazard berbentuk puncak, bahaya meningkat pesat selama periode awal
dan kemudian turun pada tingkat garis dasar (misalnya, clozapine-diinduksi
agranulositosis). Dalam model hazard konstan mencapai tingkat dataran tinggi
tak lama setelah awal pengobatan (misalnya, perdarahan saluran cerna atas
berhubungan dengan NSAID). Terakhir, dalam model tingkat bahaya terus
meningkat dari waktu ke waktu (misalnya, HRT dan kanker payudara). Selain
itu, dengan menggunakan satu sisi atas 95% selang kepercayaan mencerminkan
ketidakpastian dalam data dan memberikan skenario terburuk. FDA juga telah
menyusun Assessment konsep Risiko kertas Data pengamatan:
Pharmacovigilance Praktik yang Baik dan Penilaian Pharmacoepi-
demiological, yang berfokus pada kualitas kasus pelaporan, pendekatan untuk
61
sinyal interpretasi, dan pelaksanaan studi observasional, dan pedoman risiko
akhir-akhir ini, dibahas lebih rinci dalam Chapter 33.

Evaluasi laporan spontan harus mempertimbangkan faktor-faktor demografis


seperti usia, jenis kelamin, ras, atau sub kelompok lainnya, efek dari dosis
paparan, durasi, efek dari waktu (seperti waktu kalender, atau siklus hidup
produk), efek obat lain , kondisi komorbiditas, dan / atau target populasi.
Karena sifat dari data, laporan ADR spontan umumnya tidak memungkinkan
kesimpulan langsung pada asosiasi antara ADR tertentu dan obat dalam
populasi. Namun, beberapa faktor dalam laporan kasus yang memperkuat
asosiasi termasuk adanya re-tantangan positif, de-tantangan positif, dan tidak
adanya penyebab alternatif yang jelas. Klasifikasi telah diturunkan untuk
penilaian kemungkinan kausalitas di laporkan.36 spontan individu (penilaian
kausalitas dibahas secara rinci dalam Chapter 36. Jika masalah keamanan
menjamin penilaian rinci, evaluasi harus diperlebar untuk mempertimbangkan
semua data yang tersedia, termasuk praklinis, farmakologi klinis, uji klinis,
studi pharmacoepidemiology, dan efek kelas.

Pengkajian Data dari


Sumber non-spontan
Data yang digunakan dalam penilaian risiko regulasi yang kritis ditinjau
kembali, mengingat keterbatasan data yang berasal dari sumber-sumber pada
tingkat yang berbeda dari bukti hirarki.62 Sumber data pharmacoepidemiologic
(selain laporan spontan), dan kekuatan dan kelemahan mereka untuk risiko
penilaian, dianggap bawah.

Pengamatan aktif

Pelaporan spontan diduga ADRs dan pelaporan intensif diduga ADR melalui
fasilitasi menggunakan sistem online atau dibangun pengingat resep atau
dispensing sistem adalah bentuk pengawasan "pasif". Pemastian penuh dari
pengalaman paparan menjumlahkan populasi tidak tersedia. Dimana pemastian
penuh pemanfaatan obat dalam populasi tertentu tersedia, tingkat ADR dapat
segera ditentukan untuk kelompok dibawah pertimbangan. PEM mencoba untuk
melaksanakan seperti pengamatan aktif berdasarkan populasi (lihat Chapter 12).
Unit Penelitian Keselamatan Obat (DSRU) adalah pusat untuk PEM di Inggris.
Studi PEM adalah dokter umum (komunitas) dan paparan didasarkan pada data
resep ditiadakan di Inggris. Berikut dispensing resep dari studi obat, dokter
umum akan dikirim pertanyaan-naires untuk memastikan efek samping yang
terkena dalam populasi. Rata-rata ukuran kohort dari DSRU PEM adalah sekitar
11 000 pasien. PEM menghasilkan tingkat kejadian untuk acara dilaporkan
selama pengobatan. tingkat respons untuk kuesioner berada di kisaran 60%
.63,64 Variasi pada proses ini sekarang dilakukan oleh Jepang dan New
Zealand.65,66

Registrasi
Regristrasi atau pendaftaran adalah kumpulan peristiwa sistematis yang
ditentukan atau eksposur produk pada populasi pasien yang ditetapkan untuk
periode waktu tertentu. Registrasi juga membutuhkan protokol tujuan yang
detail, latar belakang, metode penelitian, perekrutan pasien dan tindak lanjut,
ukuran sampel yang diproyeksikan, metode pengumpulan data, manajemen, dan
analisis. Pendaftaran dapat memiliki sejumlah fungsi. Pendaftaran yang paling
sering digunakan sebagai alat pengumpulan informasi dan menghasil hipotesis,
terutama pada paparan obat-obatan selama kehamilan dan untuk obat-obatan
anak yatim, di mana informasi yang didapat mungkin sangat terbatas (pra-
lisensi). Mereka juga dapat bertindak sebagai dasar pertumbuhan penduduk
untuk studi yang berkaitan (dengan menghubungkan catatan medis untuk
pertumbuhan penduduk kota, pergerakan pasien dan mortalitas dapat dilacak
secara anonim) atau sebagai penyedia data penyebut pada populasi terkena
(misalnya Pendaftaran Imunisasi Anak Australia) 0,67 pendaftaran awal
kehamilan terkena, sebelum pengetahuan tentang hasil kehamilan,
memungkinkan evaluasi dari hasil kehamilan dalam kaitannya dengan eksposur
dan contoh yang dapat ditemukan dalam kaitannya dengan asma, rheumatoid
arthritis, dan epilepsi treatments.68-71 Potensi keterbatasan data pendaftaran
diakui, keterbatasan ini termasuk ukuran dan keterwakilan sampel. Namun,
jenis laporan pendaftaran dapat menjadi cara yang berharga dan hemat biaya
untuk mengumpulkan data mengenai penggunaan obat-obatan selama
kehamilan ketika metode pengumpulan data lainnya (misalnya, studi kohort)
tidak sesuai atau feasible.72 Populasi penduduk berdasarkan pendaftaran yang
merupakan kelahiran cacat juga ada tapi mungkin menderita
underascertainment.73 Salah satu contoh dari pendaftaran peristiwa-diinduksi
obat adalah pendaftaran obat bagi menderita aritmias jantung.74 Informasi yang
dikumpulkan oleh registri atau pendaftar akan digunakan untuk
mengembangkan profil rinci dari orang yang paling berisiko untuk terkena effek
obat aritmia dan untuk menentukan apakah tes genetik dapat dikembangkan
yang dapat mengidentifikasi pasien yang berisiko prospectively.74 Contoh lain
dari registry peristiwa obat-diinduksi adalah National Registry AS Obat-
Induced Ocular Side Effects.75

Pendaftaran juga dapat digunakan sebagai alat pengujian hipotesis, misalnya


melihat peningkatan risiko keganasan pada pasien transplantasi dan kemudian
76,77
menilai faktor risiko yang mungkin terjadi dan dalam penyelidikan efek
terapi penggantian hormon pada kolorektal cancer.78

Selain penyakit dan paparan pendaftar, informasi berpotensi berguna untuk


penilaian keselamatan obat bisa eksis di register dari uji klinis (misalnya,
www.trialscentral.org dan www.controlled-trials.com), studi keamanan (MHRA
studi keselamatan register) , dan Registry vaksin trials.79 Pendaftaran juga dapat
digunakan sebagai alat minimalisasi risiko. Pendaftar Clozapine diciptakan
untuk meminimalkan risiko agranulositosis fatal sekunder untuk pengobatan.
Pendaftaran pasien dengan menghubungkan hasil tes darah dan pengeluaran
obat membantu mencegah pengobatan ulang pada pasien yang sebelumnya
menderita penekanan sumsum tulang atau pada pasien dengan jumlah sel darah
putih yang rendah. Jadi satu
registry clozapine, agranulositosis turun menjadi 0,38% dari tingkat pra-registry
antara 1% dan 2% .80,81 Dalam upaya untuk mencegah eksposur janin untuk
thalidomide, program dasar pendaftaran telah dibentuk untuk mengatur resep,
dispensing, dan penggunaan obat. Hal ini memerlukan pendaftaran semua
berpartisipasi resep, apotek, dan pasien

Studi observasional komparatif

Studi observasional komparatif dapat dilakukan untuk sejumlah alasan. Sebagai


contoh, sebuah perusahaan dapat melakukan penelitian observasional kohort
untuk mengevaluasi profil keamanan umum penggunaan produk dalam kondisi
normal. Studi keamanan khusus dapat ditugaskan atau dilakukan untuk
mengatasi masalah keamanan terkait obat-spesifik. Dalam situasi seperti ini
tujuannya adalah untuk mengevaluasi risiko dengan dibandingkan perbedaan
paparan atau tidak ada paparan. Dahulu, studi tersebut biasanya dilakukan
dalam menanggapi keprihatinan keselamatan teridentifikasi. Perusahaan
mungkin juga diperlukan untuk melaksanakan studi observasional komparatif
umum atau khusus untuk mengukur risiko yang diketahui atau memperluas
basis data keselamatan sebagai syarat perizinan produk. Perusahaan tidak hanya
pihak yang terlibat dalam melakukan studi tersebut; akademisi dan regulator
juga dapat komisi atau melakukan studi.

Skala waktu dan kualitas penelitian adalah pertimbangan penting bagi regulator
ketika membuat keputusan. Regulator menghadapi tantangan besar dalam
mengatasi potensi besar masalah kesehatan masyarakat yang mendesak; data
berbasis populasi berkualitas baik sangat berguna bila tersedia atau jika itu
layak untuk mendapatkan data dalam jangka waktu yang singkat. Penggunaan
rekam medis tervalidasi otomatis atau klaim database menawarkan cara yang
relatif cepat untuk pengujian hipotesis secara populasi (lihat Bab 13-22). Hal ini
diakui bahwa pemanfaatan yang tepat dari database ini membutuhkan komputer
canggih dan ahli analis epidemiologi yang berpengalaman. Perlu dicatat bahwa
tujuan utama dari database ini adalah perawatan pasien atau asuransi, populasi
database yang terus berubah, dan sifat administrasi database, hal ini mungkin
tidak mengandung informasi yang dibutuhkan untuk menjawab pertanyaan
tentang paparan obat dan hasil medis. 83-87

Prinsip desain, keuntungan, dan kerugian dari berbagai jenis studi banding,
seperti studi kohort dan case-kontrol, dibahas dalam Bab 3, dan tidak akan
dibahas di sini. Namun, ada sejumlah kekhawatiran yang pantas dari perspektif
regulasi. Semua studi ini, baik berbasis lapangan atau menggunakan catatan
medis, studi banding khusus atau umum, harus dirancang hati-hati dan
dilakukan untuk kualitas tinggi. Studi keselamatan umum telah dikritik
sebelumnya karena perekrutan yang buruk dan digunakan sebagai alat
pemasaran. Studi-studi ini harus memiliki protokol rinci yang menguraikan
tujuan dan sasaran terukur, latar belakang, implikasi ukuran sampel, pemikiran,
dan definisi dari sumber populasi, populasi penelitian dan basis penelitian, hasil
dan paparan definisi, dan rencana analisis. Isu-isu seperti bias dan
membingungkan (terutama penyaluran pasien) dan kelompok pembanding yang
tepat perlu pertimbangan yang sangat rinci pada tahap desain studi.

Ketika menilai temuan dari studi pharmacoepidemiology, berbagai faktor harus


dipertimbangkan. Ini termasuk bagaimana penawaran studi dengan pengguna
baru dan yang sudah ada / pengguna umum,88 kasus dengan "penyebab langsung
alternatif," atau subjek dengan kontraindikasi.89,90 Isu-isu lain yang akan dinilai
meliputi desain, sampel keterwakilan, sumber data dan kualitas , pengukuran
dan kehandalan, diagnosis, kelompok perbandingan, hasil, subjek yang hilang /
pengujian bias, dosis, durasi dan / atau variasi lain dalam efek paparan, kovariat,
usia / masa / kohort, dan teknik statistik.91-94 Pembauran indikasi adalah
perhatian khusus ketika menafsirkan penelitian. Jika indikasi adalah gangguan
medis yang merupakan predisposisi penelitian, ketidakseimbangan dalam risiko
yang mendasari profil antara kelompok dirawat dan kelompok pembanding
dapat menghasilkan hasil bias.95,96 Metode studi baru yang menggunakan teknik
seperti analisis case-series, case-crossover, atau case-time control mungkin
tepat tergantung pada pertanyaan penelitian yang ditangani.97-102 (Lihat Bab 48.)

Tidak semua masalah keamanan obat saat ini setuju untuk belajar menggunakan
teknik epidemiologi formal. Hal ini dapat terjadi di mana kedua hasil dan
paparan yang langka.

PANDANGAN LEMBAGA PENGAWAS


Fibrosis dengan derivatif ergot (mis, pergolid). Lebih baik dan lebih besar
keterkaitan data resep di kedua perawatan primer dan sekunder yang
dibutuhkan. Studi banding terbaru yang telah berkontribusi untuk pengambilan
103
keputusan peraturan termasuk Million Women Study di HRT,
104 105
fenilpropanolamin dan stroke, anti-psikotik dan perpanjangan QT, dan
vitamin K dan kanker anak.106

Clinical Trials, Large Simple Safety Trials, dan Meta-analisis

Sebuah studi Large Simple Safety Trials, yang merupakan studi klinis yang
dirancang untuk menilai hasil keamanan relatif sedikit dalam sejumlah besar
pasien, memiliki peran pada pra dan pasca-lisensi (lihat Bab 39). Pre-lisensi,
percobaan keselamatan sederhana yang luas dapat diindikasikan mana sinyal
keselamatan perhatian dalam database uji klinis yang muncul yang tidak lain
juga dibahas atau di mana obat ini dimaksudkan sebagai produk pencegahan
pada individu tanpa gejala. Pasca-lisensi, uji klinis menyediakan sumber sinyal
dari masalah keamanan, misalnya ketika uji klinis dilakukan untuk tujuan
memperluas indikasi untuk pengobatan. percobaan besar lainnya dapat
dilakukan dengan tujuan pemeriksaan masalah keamanan tertentu. Peraturan
pedoman medis, statistik, dan masalah desain dalam uji klinis diuraikan dalam
pedoman ICH.107-112 Meta-analisis juga dapat menyediakan sintesis data yang
berguna, ketika menilai kekhawatiran keamanan obat (lihat Bab 44). Ini juga
mengalami penilaian yang ketat oleh regulator. 113

Hipotesis

Pengujian kesetaraan juga dapat diterapkan untuk farmakoepidemiologi.


Tujuannya mungkin untuk menguji risiko zat tertentu dengan risiko yang
diketahui atau dengan obat lain.114 Untuk menunjukkan bahwa produk tes tidak
berbeda bermakna dari produk referensi, perbedaan terbesar yang dapat diterima
secara klinis, sehingga perbedaan besar ini akan menjadi masalah dalam
praktek, yang ditetapkan sebelumnya sebagai Δ. Selama dua risiko yang akan
dianggap setara, interval kepercayaan dua sisi 95% dari perbedaan antara kedua
produk harus seluruhnya berada Δ dan -Δ. Pendekatan ini memungkinkan
kesetaraan kesimpulan, bukan pendekatan yang biasa digunakan untuk menguji
perbedaan dan menyimpulkan kesetaraan ketika hipotesis nol maka
kesetaraantidak ditolak. Pendekatan kesetaraan belum banyak digunakan di
pharmacovigilance. Faktor-faktor yang perlu dipertimbangkan adalah pra
spesifikasi batas kesetaraan dan apa yang merupakan nilai ambang risiko yang
relatif dapat diterima atau perbedaan risiko, sensitivitas, dan ukuran studi.

Jika penelitian tidak menunjukkan perbedaan atas dasar pengujian hipotesis


konvensional, ini tidak berarti bahwa risiko adalah sama; sifat data
farmakoepidemiologi mungkin menemukan predisposisi tidak ada perbedaan
yang diberikan "kebisingan" seperti kesalahan klasifikasi non-diferensial, yang
beroperasi untuk hasil bias nol. Kebanyakan regulator menilai penelitian pada
interpretasi hasil yang mencakup nilai nol, mencatat ini sebagai data
meyakinkan atau karena keterbatasan data. Namun, ketika menafsirkan
penelitian kita harus mengajukan pertanyaan: "apakah bukti ini tidak ada atau
tidak adanya bukti?" Rothman dan Greenland115 memberikan beberapa saran
tentang pertanyaan ini, mencatat bahwa ketelitian interval kepercayaan
menggambarkan apa ukuran efek data konsisten dan menyarankan penggunaan
fungsi nilai P.

Sumber Data lainnya


Ada minat yang cukup besar dalam bagaimana penelitian farmakoepidemiologi
dan farmakogenetik dapat digunakan untuk menjelaskan variabilitas yang
diamati dalam menanggapi obat pada populasi pasien dengan polimorfisme
dalam profil genetik.(lihat Bab 37). Utilitas utama ini memaksimalkan
keseimbangan manfaat / risiko untuk pasien secara individual untuk zat yang
diberikan.116,117

Seperangkat kriteria mengingatkan kita untuk melihat di luar bukti indeks ketika
115
menilai asosiasi kausal. Seperti diperiksa di Rothman dan Greenland,
perhatian untuk kriteria tersebut diperlukan.

Studi latar belakang dalam penyakit sasaran (morbiditas dan mortalitas) dan
pemanfaatan obat (kovariat yang berhubungan dengan paparan) juga akan
memberikan regulator informasi penting ketika menilai masalah keamanan.

Manfaat/ resiko Penilaian

Penilaian kesetimbangan dari keuntungan dan kerugian dilakukan sepanjang


hidup obat, yaitu pada saat pengembangan, permohonan izin, dan terus
dilakukan hingga setelah tahap perizinan. Prinsip pokok dari keuntungan /
kerugian penilaian pada setiap tahan adalah sama.Namun, data yang mungkin
tersedia akan berbeda secara substansial.Setiap tahun prodak ditarik dari
pasaran karena alasan keamanan. Di masa lalu, walaupun regulator dan
perusahan sering menggunakan metode keuntungan/ kerugian penilaian yang
berbeda dan mendapatkan kesimpulan yang sangat berbeda juga. Perbedaan ini
telah terjadi pada regulator dan perusahan di beberapa negara, Contohnya
termasuk penarikan dari tolcarpone, troglitazone, dan trofoflaxin dari pasar di
Eropa, sementara di USA penggunaan dari prodak tersebut dibatasi.
FARMAKOEPIDEMIOLOGI

pemantauan telah diperkenalkan. Perbedaan ini jelas menunjukkan penilaian


yang berbeda dari keseimbangan manfaat dan risiko di dua daerah tersebut.
Kurangnya standarisasi penilaian manfaat / risiko menyebabkan CIOMS
mendirikan sebuah kelompok kerja untuk menghasilkan pedoman penilaian
manfaat / risiko standar.

Pada fase pasca perizinan, walaupun masalah keamanan telah diidentifikasi, dan
evaluasi telah menghasilkan penilaian bahwa obat dapat menjadi ancaman yang
signifikan terhadap kesehatan masyarakat, oleh karena itu penting untuk
melanjutkan penilaian manfaat / risiko secara menyeluruh. penilaian manfaat /
risiko dapat dibuat dengan mengikuti rencana yang sistematis dan memastikan
bahwa semua data yang dianggap relevan. Bagian-bagian kunci dari penilaian
dicantumkan pada Tabel 8.5.

Penyakit yang sedang dirawat dan obat yang diteliti akan berdampak besar pada
keseimbangan manfaat dan risiko. Sebagai contoh, jika penyakit ini terbatas,
seperti influenza pada orang dewasa muda yang sehat, ADR serius akan
berdampak negatif terhadap keseimbangan manfaat dan risiko. Sebaliknya,
penyakit dengan angka kematian yang tinggi, ADR serius mungkin masih
dipertimbangkan oleh manfaat yang diberikan obat. Selain menggambarkan
riwayat alami penyakit, juga penting untuk menggambarkan demografi
penyakit, termasuk insiden dan prevalensi. Hal ini memungkinkan semua
kelompok pasien yang terkena dipertimbangkan, serta dampak kesehatan
masyarakat dari manfaat dan risiko yang akan dinilai.

populasi yang dirawat juga perlu dipertimbangkan. Ketika digunakan dalam


praktek klinis normal, obat tidak boleh digunakan dalam batas-batas indikasi
berlisensi. Misalnya, obat dapat digunakan pada anak-anak meskipun hanya
memiliki indikasi pada orang dewasa. Hal ini penting untuk mempertimbangkan
Tabel 8.5. elemen kunci dari manfaat penilaian / risiko

(1) Deskripsi penyakit sasaran

(2) Deskripsi populasi dirawat

(3) Deskripsi tujuan intervensi

(4) Dokumentasi terapi alternatif dan manfaat dan risiko

(5) Evaluasi tingkat keberhasilan

(6) Evaluasi jenis risiko

(7) Kuantifikasi resiko dan identifikasi faktor risiko

(8) Dampak risiko pada individu dan populasi

(9) Perbandingan manfaat dan risiko dengan terapi alternatif / tidak ada
perawatan

(10) Pertimbangan semua manfaat dan risiko dengan indikasi dan populasi

(11) Penghakiman pada keseimbangan manfaat dan risiko dan cara untuk
memaksimalkan manfaat dan mengurangi risiko

keseimbangan manfaat dan risiko dalam semua populasi harus diberlakukan.


Perbedaan mungkin terjadi dalam bagaimana obat-obatan yang ditangani oleh
populasi yang berbeda, misalnya, mengurangi metabolisme pada orang tua dan
beberapa kelompok etnis. Khasiat juga mungkin berbeda antara kelompok-
kelompok, contoh meningkatkan inhibitor ACE dalam menurunkan tekanan
darah pada kelompok etnis yang berbeda.

Sama seperti sifat penyakit yang sedang dirawat penting, tujuan dari intervensi
juga harus dijelaskan. Obat dapat digunakan untuk pencegahan, pengobatan,
sebagai bagian dari prosedur, atau untuk diagnosis. Faktor-faktor ini akan
berdampak pada keseimbangan manfaat dan risiko. Misalnya, obat yang
digunakan untuk mencegah penyakit pada individu sehat harus memiliki profil
keamanan yang sangat mapan, terutama jika penyakit yang dicegah adalah
langka atau tidak serius.

Alternatif terapi untuk pengobatan yang sedang dievaluasi harus diidentifikasi.


Untuk beberapa kondisi ada pengobatan khusus yang dapat menjadi alternatif.
Bagi sebagian besar penyakit, bagaimanapun, akan ada obat alternatif yang
tersedia dan dalam beberapa intervensi bedah mungkin efektif, misalnya,
operasi untuk prolaps diskus intervertebralis sebagai alternatif untuk analgesik
jangka panjang. Untuk beberapa kondisi, terutama kondisi psikologis dan
kronis, obat komplementer dan terapi psikologis dapat dibentuk alternatif.
Setelah alternatif utama untuk perawatan di bawah evaluasi telah diidentifikasi,
profil manfaat dan risiko harus dipertimbangkan

Istilah "efficay" biasanya digunakan untuk mengartikan keuntungan dalam


pengaturan uji klinis, sedangkan "efektivitas" biasanya digunakan untuk
mengartikan keuntungan dalam kondisi penggunaan normal. Untuk sebagian
besar obat-obatan, evaluasi manfaat dalam penggunaan klinis yang normal
belum dilakukan dan percobaan efikasi klinis harus digunakan sebagai
"pengganti" manfaat. Kekokohan premarketing Data efikasi sering jauh dengan
yang tersedia untuk risiko, sebagai uji klinis dirancang pertama dan terutama
untuk menunjukkan kemanjuran produk. pertimbangan penting ketika menilai
manfaat adalah apakah keberhasilan telah dibuktikan dalam hal hasil klinis.
Misalnya, ketika banyak dari agen antiretroviral yang berlisensi untuk
mengobati infeksi HIV dan AIDS, hanya tanda pengganti endpoint klinis yang
tersedia, seperti peningkatan jumlah limfosit CD4 dan pengurangan viral load
RNA HIV. Hanya memiliki morbiditas dan mortalitas Data dikonfirmasi
manfaat utama dari obat-obatan ini dalam hal morbiditas dan mortalitas dalam
pengobatan orang yang terinfeksi HIV. Ketika masalah besar keamanan terjadi
untuk obat dimana data yang kuat tentang manfaat klinis tersedia, penghakiman
pada keseimbangan manfaat dan risiko yang mungkin berbeda dari obat dimana
hanya data menggunakan pengganti endpoint klinis yang ada.

BEBERAPA PANDANGAN MENURUT BADAN PENGAWAS

Durasi dan efek dari suatu obat harus dipertimbangkan. Untuk penyakit kronis,
khasiat awal dapat ditandai, tetapi jika dalam hal ini tidak berkelanjutan, maka
manfaat keseluruhan obat kemungkinan bisa menjadi sangat terbatas. Hal ini
mungkin terjadi karena takifilaksis atau untuk penyaki infeksi, perkembangan
resistensi.

Faktor lain yang dapat dipertimbangkan adalah apakah obat yang dievaluasi
dapat digunakan untuk terapi pilihan pertama atau kedua. Misalnya, obat yang
digunakan sebagai obat kemoterapi pilihan pertama di mana alternatif yang ada
mungkin dinilai memiliki keseimbangan yang berbeda dari manfaat dan risiko
obat kemoterapi yang hanya diindikasikan pada pasien yang telah gagal dengan
semua pengobatan. Konsep terapi pilihan pertama dan kedua sering digunakan
dalam hal membatasi penggunaan obat-obatan dengan masalah keamanan
utama.

Tingkat keberhasilan harus didokumentasikan untuk setiap indikasi (apakah


diizinkan atau tidak) dan masing-masing populasi sudah terobati. Misalnya,
ACE inhibitor diindikasikan untuk pencegahan penyakit pasca infark-miokard,
gagal jantung, hipertensi, dan untuk mencegah kerusakan ginjal pada pasien
dengan diabetes mellitus. Data kematian yang sudah ada menunjukkan manfaat
dari ACE-inhibitor di beberapa orang namun tidak semua dengan indikasi ini.
Oleh karena itu, jika masalah keamanan utama muncul, keseimbangan manfaat
dan risiko mungkin akan berbeda untuk indikasi yang berbeda

Setelah hubungan sebab dan akibat telah ditetapkan antara efek samping dan
produk obat, keseriusan dan tingkat keparahan penyakit akan membantu dalam
penilaian pengaruh individu dan populasi terhadap resiko yang
dipertimbangkan.

Sedangkan penyakit yang serius biasanya berhubungan dengan hasil akhir suatu
ADR (misalnya, sebuah reaksi yang berakibat fatal atau mengakibatkan dirawat
di rumah sakit), penyakit parah juga penting. Misalnya, kenaikan kecil dalam
tes fungsi hati tidak diindikasikan sebagai penyakit liver sedangkan kenaikan
sepuluh kali batas atas normal maka bisa menjadi pertanda sakit liver. Tak satu
pun dari reaksi-reaksi yang diduga bisa dianggap serius oleh pengertian secara
umum. Namun, yang terakhir, menjadi parah, mungkin merupakan suatu risiko
kesehatan yang penting. Dalam rangka mengidentifikasi cara untuk mengurangi
risiko, penting untuk mencoba menyelidiki apakah risiko terkait dengan
kelompok pasien tertentu, dosis tertentu, hasil dari interaksi, atau apakah ada
tanda peringatan dini. Tabel 8.6 menguraikan bagaimana faktor yang harus
dikurangi yang dapat menimbulkan risiko dan bagaimana keseimbangan antara
manfaat dan risiko obat yang dapat dipertahankan dengan memberikan
keuntungan.

Frekuensi efek samping haruslah dipertimbangkan. Frekuensi akan berpengaruh


pada keseimbangan manfaat / risiko bagi seorang individu, seperti pengaruh
toksisitas obat pada populasi. Dengan mempertimbangkan toksisitas baru yang
memberikan manfaat / risiko, penting juga untuk mempertimbangkan profil efek
samping obat. Akan sangat luar biasa untuk obat yang hanya memiliki satu
standard ADR dan risiko keseluruhan dari obat yang jelas akan tergantung pada
ADR baru maupun yang sedang dievaluasi dan masalah keamanan yang dikenal
dengan obat itu.

Seperti yang didokumentasikan terapi alternatif, akan sangat membantu ketika


menilai risiko untuk memilih salah satu obat pembanding, mungkin dari kelas
dan indikasi yang sama, perbandingan secara langsung head-to-head. Hal ini
sulit, namun, karena mungkin bukan merupakan pembanding yang jelas dan
bahkan jika ada, bukti manfaat dan risiko mungkin berbeda baik secara
kuantitatif dan kualitatif. Jika pembanding dapat dipilih maka manfaat dan
risiko harus dibandingkan antara dua obat dengan semua indikasi dan di semua
populasi

Setelah dijelaskan target penyakit dan populasi yang diobati, tujuan dari
intervensi dan terapi alternatif, dan dievaluasi manfaat dan risiko, maka perlu
dicoba untuk menilai keseimbangan keseluruhan risiko dan manfaat obat.
Manfaat dan risiko di semua indikasi dan populasi perlu dipertimbangkan.
Keseimbangan keseluruhan mungkin sangat sulit untuk dinilai: jenis bukti yang
tersedia untuk manfaat mungkin sangat berbeda dengan yang tersedia untuk
risiko. Konsep jumlah dibutuhkan untuk pengobatan yang memberikan manfaat
dan konsep jumlah yang dibutuhkan yang dapat memberikan risiko membantu
untuk mengukur dan membantu dalam perbandingan. Namun, bila
memungkinkan, beberapa perkiraan jumlah ADR serius yang akan terjadi untuk
memberikan hadil outcome pisitif harus dicoba. Misalnya, ketika mengevaluasi
keseimbangan manfaat dan risiko dari agen trombolitik dalam pengobatan
infark miokard akut, perkiraan jumlah kasus-kasus serius pada perdarahan per
infark dapat dihitung.

Tabel 8.6. Kemungkinan perlindungan untuk meminimalkan risiko

Faktor Perlindungan
Pada pasien ADR hanya terjadi pada kelompok pasien tertentu,
risiko misalnya, orang tua, gagal jantung. Penggunaan obat dalam
kelompok ini dapat dikontraindikasikan
Dosis ADR hanya terjadi pada dosis tinggi atau paling serius pada
dosis yang lebih tinggi: mengurangi dosis maksimum yang
ditetapkan harus mengurangi risiko (tetapi
mempertimbangkan dampak dari penurunan efikasi
manfaat atau keseimbangan risiko)
interaksi Jika risiko meningkat atau hanya terjadi setelah interaksi
farmakodinamik atau farmakokinetik, maka kontraindikasi
penggunaan bersama obat yang dapat berinteraksi harus
mengurangi risiko
tanda-tanda Bagi efek samping, mendeteksi reaksi awal dapat
peringatan dini mencegah hasil akhir pengobatan yang serius, sehingga
mengurangi risiko. Contohnya, pemantauan enzim hati
dengan obat-obatan hepatotoksik dan pemantauan fungsi
ginjal dengan obat-obatan nefrotoksik
Ditinjau dari penilaian merupakan sebuah langkah penting untuk memastikan
kualitas, dan melibatkan berbagai ahli tambahan untuk menghasilkan keputusan
yang lebih seimbang. Di Inggris, saran dari ahli Komite Keselamatan Obat
biasanya dicari, pemerintahan yang independen, pakar komite penasihat ilmiah
pada obat-obatan. Pada tingkat Uni Eropa, Komite Produk Obat Manusia
dikonsultasikan. FDA memiliki sejumlah "komite penasehat," yang memberikan
saran kepada FDA terkait dengan keamanan dan efektivitas produk. Salah satu
dari komite ini, Keamanan Obat dan Manajemen Risiko (DSaRM) komite
penasihat, disewa khusus untuk memberikan bimbingan tentang hal-hal yang
berkaitan dengan keamanan obat dan manajemen risiko. DSaRM terdiri dari
dokter, apoteker, dan lain-lain dengan keahlian di berbagai bidang, termasuk
farmakoepidemiologi, farmakoterapi, kognisi medis, kebijakan kesehatan dan
isu-isu keselamatan konsumen, manajemen risiko, dan kesalahan dalam
pengobatan.
Teknik analisis keputusan resmi dapat digunakan untuk mendukung penilaian
dan harus membantu mereka yang bertanggung jawab dalam pengambilan
keputusan agar memikirkan dampak dari pilihan yang berbeda untuk tindakan
pengaturan

Tindakan untuk Mengurangi Risiko atau Meningkatkan Manfaat dan


Komunikasi

Setelah penilaian manfaat / risiko biasanya akan diperlukan untuk mengambil


tindakan baik untuk meningkatkan manfaat dari obat dengan meningkatkan
penggunaan rasional atau untuk mengurangi risiko dengan cara ditingkatkandi
mana ia digunakan, yang biasanya melibatkan pendidik praktisi dan konsumen,
namun pada kesempatan yang membutuhkannya dengan cara membatasi
penggunaannya.

Istilah "tindakan pengaturan" biasanya digunakan untuk merujuk pada tindakan


yang diambil dalam kaitannya dengan lisensi. Namun, di sini kita menggunakan
definisi yang lebih luas yang mencakup semua langkah yang dapat diambil oleh
regulator atau perusahaan untuk meningkatkan keseimbangan manfaat / risiko.
tindakan pengaturan mungkin sukarela, misalnya perusahaan secara sukarela
menyerahkan variasi atau membatalkan lisensi. Sebaliknya, pihak otoritas dapat
mengambil tindakan wajib. Bila mungkin hasil regulasi yang diinginkan harus
dicapai melalui tindakan sukarela. tindakan wajib lebih cenderung
menyebabkan litigasi dan harus disediakan untuk ancaman kesehatan
masyarakat yang utama di mana kesepakatan untuk tindakan sukarela dengan
perusahaan tidak dapat dicapai.

Ketika mengambil keputusan tentang tindakan hukum yang sesuai, prinsip


membimbing tertentu harus diingat:

• Objektivitas: penilaian dan pengambilan keputusan harus berdasarkan bukti


dan bebas dari konflik kepentingan.
• Ekuitas: harus ada ekuitas tindakan regulasi pada produk jika penilaian risiko
dan khususnya penilaian manfaat / risiko yang sama untuk produk yang
berbeda.

• Akuntabilitas: pengambil keputusan bertanggung jawab untuk keputusan dan


tindakan pengaturan diambil.

• Transparansi: dalam batas-batas peraturan daerah tentang kerahasiaan


komersial dan perlindungan data, pengambilan keputusan dan tindakan yang
diambil harus transparan kepada pemangku kepentingan.

Jika jumlah keseluruhan manfaat dan risiko yang dinilai negatif, maka produk
tersebut akan ditarik kecuali strategi minimalisasi risiko dapat diidentifikasi
yang akan ayunan keseimbangan jauh dari risiko atau terhadap manfaat. Tabel
8.6 memberikan beberapa contoh bagaimana risiko mungkin diminimalkan dan
Tabel 8.7 memberikan contoh dari bagaimana tindakan peraturan mungkin
akan dianggap.

Komunikasi yang efektif tentang isu-isu keselamatan adalah penting jika ADR
harus dicegah. Komunikasi tentang masalah keamanan perlu direncanakan dan
tim komunikasi biasanya akan perlu dibentuk. Pesan yang akan disampaikan
harus ditargetkan, dimengerti, terbuka, informa-tive, dan seimbang. Di masa
lalu, dokumen komunikasi sering ditulis oleh orang-orang ahli obat-obatan
keamanan bertanggung jawab untuk mengevaluasi masalah keamanan. Namun,
dalam rangka untuk memastikan bahwa pesan-pesan yang jelas, ringkas, dan di
bawah-standable, adalah bijaksana untuk melibatkan spesialis komunikasi
secara tertulis dokumen dan, jika waktu memungkinkan, pesan user-tes sebelum
didistribusikan. pesan yang berbeda namun kompatibel mungkin diperlukan
untuk profesional perawatan kesehatan, pasien, dan media. Metode yang dipilih
untuk mendistribusikan pesan akan tergantung pada urgensi komunikasi dan
target audiens. Waktu komunikasi, terutama untuk masalah keamanan yang
mendesak seperti penarikan produk, adalah penting. Jika media membawa
masalah keamanan obat utama yang mengarah ke pasien konsultasi profesional
perawatan kesehatan mereka dan orang-orang profesional belum diberi
pengarahan terlebih dahulu, maka regulator dan perusahaan farmasi akan dinilai
telah gagal baik profesional dan pasien. Ini bisa menjadi tantangan besar tetapi
harus menjadi tujuan kami ketika merencanakan komunikasi keselamatan. Bagi
mereka yang tertarik pada topik ini, pembahasan yang lebih lengkap dapat
ditemukan ditempat lain . ini sangat mudah untuk non-spesialis untuk salah
mengutip dan menggambarkan data, termasuk data epidemiologi, dalam
dokumen komunikasi, dan epidemiologi memiliki peran dalam memeriksa
dokumen-dokumen tersebut untuk akurasi . Selain itu, dengan memberi nasihat
tentang pengumpulan data, termasuk metode survei, epidemiologi mungkin
memiliki peran dalam memverifikasi informasi yang telah diterima, dipahami,
dan diikuti.

Tabel 8.7 Menempatkan pengamanan ke dalam tindakan untuk menanggapi


risiko

12
Pandagan lembaga pengawas 5

Table 8.7. Putting safeguards into action in response to a risk

Aksi Komentar

Mungkin tepat untuk ADR non-serius di mana kausalitas


Terus pasif tidak didirikan

pengawasan
Aktif
mengumpulkan Jika kausalitas tidak didirikan, mekanisme tidak jelas,
data lebih lanjut atau faktor risiko tidak teridentifikasi

Menambahkan
peringatan kepadaUntuk reaksi yang kurang serius, terutama mereka yang
produk tidak dapat dihindari, peringatan kesehatan

profesional dan pasien mungkin satu-satunya tindakan


informasi yang diperlukan. Perubahan dapat dilakukan untuk setiap

dari bagian berikut dari informasi produk: peringatan,


interaksi,

kehamilan dan menyusui, efek samping, praklinis

Batasi indikasi, mengurangi dosis maksimum,


contraindicate digunakan dalam mereka yang berisiko
Perubahan produk tinggi, saran

Informasi
mengurangi resiko Monitoring, dll. Lihat tabel 8.6

Ancaman mendesak untuk kesehatan masyarakat dan


penilaian awal menunjukkan keseimbangan manfaat dan
Suspensi lisensi risiko

adalah negatif. Namun, evaluasi lebih lanjut atau studi


diperlukan sebelum keputusan akhir. idealnya,

perusahaan akan dibujuk untuk secara sukarela menjamin


bahwa semua pemasaran dan penggunaan produk

akan berhenti daripada menggunakan kekuatan wajib


Suspensi dariSebagai suspensi lisensi, tapi bernama penggunaan pasien
marketing dandianggap juga menyajikan tidak dapat diterima
penggunaan

bahaya. Sekali lagi, perusahaan akan idealnya dibujuk untuk


secara sukarela menjamin bahwa semua pemasaran

dan penggunaan produk akan berhenti

evaluasi lebih lanjut tidak dianggap berguna dan


Pencabutan lisensi keseimbangan manfaat dan risiko tidak dapat

dibuat menguntungkan. Idealnya, perusahaan akan


dibujuk untuk secara sukarela membatalkan lisensi

Perubahan statusJika membatasi ketersediaan produk untuk profesional


legal perawatan kesehatan tertentu dapat mengurangi risiko atau

meningkatkan manfaat

Spesifik untuk
meminimalisir Dalam keadaan luar biasa (terutama dimana produk memiliki
faktor resiko manfaat yang luar biasa, tetapi juga besar)

risiko) mungkin dibenarkan untuk mengembangkan


program pengurangan risiko rinci tertentu. Ini mungkin
program melibatkan

program pendidikan, pendaftar, bentuk pasien


persetujuan, distribusi terbatas, dll Lihat Tabel 8.3

Audit (PengukuranHasilIntervensi)
Hal ituditekankandalambagian yang menggambarkanpemikiran FDA
saatinipadaminimalisasirisikoperencanaan yang
evaluasikeberhasilanrencanaminimalisasirisikosangatpentinguntukperlindungan
kesehatanmasyarakat. Sama, evaluasi (audit)
darikeberhasilanataudampakdaritindakanpengaturandiambildalammenanggapim
asalahkeamanantertentuadalahtugaspentingdariperusahaandan regulator
untukumum.
Tujuanutamadarisebagianbesartindakanadalahuntukmenginformasikandanmeng
ubahperilaku, baikituresepataupengeluaranperilakuataukebiasaanmasyarakat.
Tujuan-
tujuaninibisasangatsulituntukmencapaidaniniadalahmengapakitatidakbisaberasu
msibahwatindakankitasudahefektif.
epidemiologimemilikiperansentraldalammengukurdanmenilaidampakintervensir
egulasi, danuntukalasaninisatubabterpisahdidedikasikanuntuktopikini (lihat Bab
33).

KegiatanPeraturanLainnya

Selainpharmacovigilance, adaperan lain untukepidemiologi di fasepasca-


lisensidarikehidupankedokteran. Bagibanyakobat-
obatanpenggunaanterapiberlisensiawalhanya yang
pertamadariberbagaiberkembangnyapenggunaan.
kegunaanlebihlanjutmungkindalampopulasi yang berbedadenganpenyakit yang
sama (misalnyaanak-anak, orang tua, atauindividudengankomorbiditas),
padapopulasidenganpenyakit yang samatetapidaritingkatkeparahan yang
berbedaataupadatahap yang berbedadalamevolusipenyakitini, dalampenyakit
yang samatetapisebagaibagiandarirejimenpengobatan yang berbeda,
ataubahkanuntukmengobatipenyakit yang samasekaliberbeda.
Epidemiologiyang mungkinmemilikiperandalammengidentifikasipoten-
esensialpenggunaanbaruuntukobat. Denganmempelajaripenyakit,
demografipenduduk yang terkenadampak, saatmengobati-ment,
dansejarahalamdaripenyakit, penggunaanpotensitambahandapatdiidentifikasi.
Selainmencaripendapatahlidanmemahamifarmakologidariobat, penggunaan
database
pasienmemanjangbisasangatinformatifdalammengidentifikasipotensipenggunaa
nbaru. Samasepertidenganlisensiawal, untukmendapatkanindikasibaruberlisensi,
perusahaanakanperluuntukmendapatkan data yang mendukungpenggunaan yang
amandanefektifobat di daerahpenyakitbaruataupopulasi. Di UniEropa, proses
regulasidikenalsebagaivariasilisensiadalahmetodebiasamenambahkanindikasiter
apibaru, walaupunperusahaandapatmemilihuntukmendapatkanlisensibaru yang
terpisah. Proses
variasidigunakantidakhanyauntukmengubahlisensiberkaitandenganindikasibarut
etapiuntuksetiapperubahan, baikituberkaitandengankualitas (misalnya,
penyimpanan), keamanan, ataukhasiat.

Di beberapawilayahdunialisensihanyaberlakuuntukjangkawaktu. Misalnya, di
UniEropa, setelah 5 tahunlisensiharusdiperbaharui. Padakesempatan, inihanya
proses administrasi. Namun, semakinbanyak, regulator
menggunakanalatperaturaniniuntukmelakukankeamanandankemanjuranulasanle
ngkapdariprodukdan, terutamajikamasalahkeamananutamatelahmunculselama 5
tahunsebelumnya, untukmelakukanpenilaianmanfaat / risikopenuh. Selama 5
tahun, selainmasalahkeamananbaru yang muncul,
evolusipenyakitinimungkintelahberubah (berpikirinfeksi HIV padatahun 1980
dibandingkandengantahun 1990-an) ataubaru, terapilebihaman,
ataulebihefektifmungkintersedia (sekalilagi, memikirkan HIV), yang
mungkinmemilikidampak yang
besarpadapenggunaandanmungkinmanfaatkeseimbangan / risikoobat.
epidemiologimungkinmemainkanperandalammendokumentasikansejarahalamsa
atinipenyakit, penggunaansaatiniobat, danterapialtern-ative,
dandalammengumpulkan data untukmendukungpenggunaanterusobatnya
(mungkindengancara yang berbeda).

Ukuranpengaturantambahanadalahkontroldistribusiobat,
termasukapakahitudapatdiperolehhanyadenganresepdaridokter yang terdaftar,
apakahdapatdibagikanolehapotekertanparesep,
atauapakahitudapatdibelitanpaintervensidarisetiapprofesionalperawatankesehata
n. klasifikasi yang berbeda status resep yang di gunakan di berbagaidaerah di
dunia (dan di UniEropaantaranegara-negara yang berbeda). Namun,
sebagianbesarnegaramengontroldistribusiobat-
obatandenganmenggunakanbeberapaklasifikasiresep. Perusahaan
perlumenerapkankepihakberwenanguntukmengubah status resep; di
beberapanegarainidisebutsebagaireklasifikasi. Perusahaan
mungkininginmemilikiobatmerekadigunakantanparesep,
karenahalinidapatmeningkatkanpenjualan, tetapihanyajenistertentukondisi,
gejala, ataupenyakit yang tepatuntukpengobatan non-resep.
faktorpenyakittermasukapakahitumudahdidiagnosistanpaintervensidaridokterda
napakah misdiagnosis dapatmemilikikonsekuensiserius. Faktorutama yang
berhubungandenganobat-obatanitusendiriadalahapakahaman
(danprofilkeamananmapan) dansederhanauntukmengambil. Hal
inijugaharusdiingatbahwaprofildaripopulasimenerimaobatdapatberubahsecara
dramatis ketikaintervensidaridokterdikecualikan. epidemiologi yang
mungkinmemainkanperandalammenetapkanbahwaobatdapatdigunakansecaraam
andanefektiftanpaintervensidaridokter. Sebagaicontoh, epide-
miologistdapatmengumpulkan data
tentangbagaimanapenyakitinididiagnosisdankemampuanpendudukuntukmendia
gnosadiri, ataukomorbiditaskemungkinanhadirdalam orang-orang yang
mungkinmemperolehobat-obatandan co-perawatan yang
merekadapatmenggunakan (yang
mungkinberinteraksidenganbarudireklasifikasiobat). Jikaobat yang
direklasifikasiuntukpenggunaan non-resep,
masalahkeamananbarumungkinmunculdankewaspadaanbarudalampemantauank
eamananbiasanyaakandiperlukan. Hal inimungkinsangatmenantang, seperti, di
banyaknegara, doktertetapwartawanutamadiduga ADR. Contohobat yang
sebelumnyaresep-satunya yang sekarangtersediatanparesep (di beberapanegara)
termasukasamlambungobatpenekanseperti cimetidine dan ranitidine, obat anti-
inflamasinonsteroidseperti ibuprofen, beberapakortikosteroidtopikal,
beberapatopikal anti-viral seperti acyclovir, dankeduaantijamurtopikaldan oral
termasukflukonazol.

KESIMPULAN

Bab inimenyajikangabungandilihatdaritiga regulator yang beroperasi di


berbagaidaerahdenganpendekatan yang
berbedauntukpenggunaanpharmacoepidemiologydalamperaturanobat. Kami
telahmengambilcakupan yang
luasdanmencobauntukmempertimbangkansemuabanyakdanberagamantarmukaa
ntarakeduanya. prinsip kami
telahperanpharmacoepidemiologysepanjangsiklushidupdariobat,
daripembangunan, melaluilisensi, untukpemasaranuntukpenggunaanumum.
Kami telahmenjelajahidampakdariberbagaijenis data padaregulasi.
Pharmacoepidemi-ology
memilikiperansentraldansemakindikenaldalamregulasiobat-obatan,
penggunaannyamendasarisemakinbanyakkeputusanperaturan.
Tantanganutamakedepanadalahmeningkatkankekokohandankekayaan data
pharmacoepidemiologicatasmanakeputusandidasarkan. Masalahteknis, ilmiah,
danhukum yang menantang, termasukkebutuhanuntukakses data yang
cepatdananalisis (untukmasalahkeamanan yang mendesak), kekuatanstatistik,
berurusandengan bias danmembingungkan, memperoleh data
darisektorpasarkesehatan di manasaatinimerekakurang,
danpersetujuandankerahasiaan
(melindungiindividutetapitidakdenganmengorbankanmerugikanmasyarakat).
Meskipuntantanganini, kami
percayapenggunaanpharmacoepidemiologyadalahmembuatkontribusipentingunt
ukregulasi yang lebihbaikdanperlindungan yang
lebihbaikdarikesehatanmasyarakat.

PENOLAKAN

Ulasaninibukanmerupakan saran regulasi formal dandalamsemuakasusundang-


undangfarmasi yang relevandanbimbingan formal
harusberkonsultasiuntukkewajibanfarmasibagipemegangizinataupelamar.
Selanjutnya, pendapat yang
dikemukakanadalahdaripenulisdantidakselalumewakilipendapatdariorganisasi
yang penulisbekerja.
9
Spontaneous Reporti
ng in the United States
SYED RIZWANUDDIN AHMAD1, ROGER A. GOETSCH2 and NORMAN
S. MARKS1
1 Office of Drug Safety/DDRE, Silver Spring, Maryland, USA; 2 Office of
Drug Safety/DSRCS, Rockville, Maryland, USA.

DESKRIPSI

Sejarah Aturan Keamanan Farmasi

FDA adalah suatu lembaga pertama yang berwenang terhadap


perlindungan konsumen di Amerika Serikat. Dari pendahulunya, lembaga Biro
Narkoba, didirikan dalam rangka untuk melaksanakan Undang-Undang yang
bertindak dalam pengendalian Biologis kontrolpada 1902. Berikut hukum
pengawasan obat pada tahun 1906, 1938, dan 1962, dari hasil perhatian publik
secara luas tentang keamanan obat, makamasyarakat menuntut Kongres AS bisa
mengatasi krisis yang dirasakan, yang bisa mengancam kesehatan dan
kehidupan anak-anak.Setiap hukum atau perubahan secara bertahap
memperkuat kemampuan FDA untuk secara efektif memantau keamanan
postmarketing obat dan produk medis lainnya.
Undang-undang tahun 1902 telah disahkan oleh Kongres AS mendapat
reaksikemarahan publik dari ratusan kasus pasca-vaksinasi tetanus dan kematian
beberapa anak-anak karena tetanuscontaminated antitoksin difteri. Hukum
keamanan obat yang pertama ini diperlukan lisensi tahunan produsen dan
distributor serta pelabelan pada semua produk dengan nama produsen. Baik
keamanan premarketing dan kemanjuran maupun postmarketing yang
keamanan produk tersebut yang diatur oleh pemerintah.
Efek samping Kesalahan pemberian Kualitas produk
Yang tidak dapat obat cacat
dapat dihindari dihindari
atau dicegah
Peristiwa merugikan yang dapat
dicegah

Ketidakpastian
Terjadi kerusakan pada tubuh atau
hidup
kematian
- Efek samping
timbul secara
tiba-tiba
- penggunaan
obat
Gambar 9.1. Sumber risiko dari produk medis
- populasi

Undang-Undang Obat dan Makananpada tahun 1906 yang dilakukan di


antara negara-negara lain yang melarangperdagangan obat dan makananyang
disalahartikan dan dipalsukan. Pada keamanan obat setelah dikonsumsi tidak
segera ditangani. Contohnya, pada tahun 1934 lembaga mulai menginvestigasi
pada produk yang mengandung dinitrophenol, suatu komponen dalam proses
diet bertanggung jawab atas meningkatnya tingkat metabolisme yang berbahaya
sehingga mengakibatkan tingkat kematian dan kerusakan pada tubuh. Namun,
Kantor Pengawasan Obat tidak bisa mengambil kembali produk, dan hanya bisa
sebatas pada menunjukanketerangan peringatan. Keamanan obat setelah
dikonsumsi tidak dibahas tuntas sampai tahun 1930-an, diminta Kongres untuk
segera bertindak.
Masalah dengan obat-obatan berbahaya yang luar kontrol dari FDA.
Bencana obat mujarab sulfanilamidemendapat perhatian nasional dengan di
1937. Massengill Co memperkenalkan bentuk sediaan oral beraroma yang baru
sebagai anti-infektif "obat wonder"dengan menggunakan pelarut yang belum
teruji, dietilenglikol. Maka FDA bertindak untuk mengatasi masalah dan
menghapus produk bermasalah yang bisa menyebabkan kematian pada banyak
anak-anak dari rak-rak apotek dan lemari obat, persiapan telah menyebabkan.
Meskipun Efek beracun dari dietilenglikol yang dicatatditahun1931, tanpa
adanya peraturan keamanan obat, satu-satunya beban yang bisa dibawa ke
dalam perundang-undangan tahun 1906 adalah produkmisbranding, karena
tidak terdapat alkohol dalam "obat mujarab".
Pada bulan Juni tahun 1938, Undang-undang Federal pada Makanan, Obat
dan Kosmetik yang disahkan oleh Kongres AS. Hukum sangat diperlukan untuk
obat baru yang harus diuji untuk keamanan sebelum pemasaran secara luas,
hasil yang akan disampaikan kepada FDA di NDA. Hukum ini juga diperlukan
pada obat yang memiliki label yang memadai untuk penggunaan yang aman.
Sekali lagi, tidak ada pemantauan keamanan postmarketing yang di masukan
dalam undang-undang.
Selama pada tahun 1950, ada ekspansi yang cepat dari industri farmasi dan
peningkatan jumlah produk baru. Sebuah spektrum luas antibiotik baru yaitu
kloramfenikol, telah disetujui oleh FDA pada awal tahun 1949 sebagai "obat
yang aman dan efektif bila digunakan seperti yang dianjurkan "(standar untuk
persetujuan undang-undang tahun 1938). Namun, pada sejumlah kecil pasien
yang mengkonsumsi obat kloramfenikol untukuji klinis pada pra-persetujuan
untuk mengamati efek samping yang serius tapi jarang terjadi pasien kurang
dari 1 dalam 1000 pasien. Dalam waktu enam bulan persetujuan, laporan dalam
literatur medis di AS dan Eropa menyarankan asosiasi aplastik yang fatal
menyebabkan anemia pada penggunaan kloramfenikol.
Pada Juni pada tahun 1952, untuk mengumpulkan data yang diperlukan
untukmengevaluasi masalah ini, FDA memerintahkan staf di semua kantor yang
ada di 16 kabupaten untuk menghubungi setiap rumah sakit, jurusan kedokteran,
dan klinik di kota-kota dengan populasi 100.000 atau lebih untuk
mengumpulkan informasi pada setiap kasus anemia aplastik atau hasil tes darah
lainnya. Diskrasia dikaitkan dengan kloramfenikol. Dalam waktu empat hari
kontak di lapangan, tambahan 217 kasus chloramphenicolassociated
diskrasiapada darah telah diidentifikasi.
Keterlambatan pada mengidentifikasi dan tindakan regulasi pada laporan
kasus anemia aplastik yang terkait dengan Penggunaan kloramfenikol
menunjukkan bahwa perlunya untuk memantau efek samping yang akan
menyusul setelah obat baru di pasaran. Menanggapi kebutuhan ini akan hal ini
maka American Medical Association(AMA) membentuk suatu Komite diskrasia
darah, yang akan mulai mengumpulkan laporan kasus obat-induced
bloodrelated penyakit pada tahun 1954. Pada saat itu, AMA memiliki potensi
sebagai sumber informasi dari lebih dari 7.000 rumah sakit dan 250.000 dokter.
Program AMA diperluas pada tahun 1961 untuk yang lebih komprehensif
"pendaftaran pada Efek Samping" pada program ini dihentikan pada tahun 1971
karenaupaya secara pararel oleh FDA.
Pada tahun 1956, FDA dibawah pengawasan obat ADR, yang bekerja
sama dengan masyarakat Amerika, Rumah Sakit, Apoteker (tenaga kesehatan),
asosiasi nasional, catatan pustakawan medis, dan AMA. Pada
Program pelaporan dimulai dengan 6 rumah sakit dan pada tahun 1965
yang telah berkembang menjadi lebih dari 200 rumah sakit pendidikan yang
telah dilaporkan oleh FDA dalam waktu sebulan. Selain itu, laporan yang
diterima oleh FDA dari rumah sakit federal yang dipilih (Departemen
Pertahanan, Veteran Administrasi, Tenaga Kesehatan Masyarakat) dan
menerbitkan laporan yang akan dimusnahkan dari literatur medis dan diterima
dari WHO (World Health organization). Pada tahun 1962 perubahan undang-
undang obat, makanan dan kosmetik oleh Kefauver-Harris. Tahun 1938
dijelaskan bahwa diperlukan bukti khasiat sebelum persetujuan obat baru yang
akan dipasarkan. Untuk pertama kalinya, hukum juga mengamanatkan bahwa
produsen farmasi harus melaporkan efek samping yang akan terjadi kepada
FDA untuk setiap produk mereka harus memiliki tanda NDA, sebagian besar
produk yang masuk dalam resep diperkenalkan sejak tahun 1938.
FDA mulai menyimpan dataefek samping dari hasil laporan pada tahun
1967, dan pada awal 1968 yang diterima semua kode yang akan memasukkan
semua data dari FDA dalam suatu Formulir yang terdiri dari 1639 Obat.
Laporan ke Sistem Pelaporan spontan (SRS), tapi SRS digantikan pada bulan
November 1997 karena terdapat kekurangan. Pada sistem Pelaporan Kegiatan
(AERS), informasi terkomputerisasi database yang mendukung pengawasan
keselamatan postmarketing FDA untuk semua program obat yang disetujui dan
terapi produk biologis. AERS adalah internasional kompatibel sistem yang
dirancang sebagai alat pharmacovigilance untuk menyimpan dan laporan
keamanan untuk di analisis lebih lanjut.
Pada tahun 1991, ada lima bentuk yang berbeda untuk produsen dan tenaga
profesional kesehatan untuk melaporkan masalah produk medis ke agen. Pada
tahun 1993, kemudiandikutip dari Komisaris FDADavid A.Kessler, MD,
kebingungan dengan berbagai bentuk semua program maka akan
diluncurkannya program MedWatch Adverse pada tahapan pelaporan kegiatan
FDA. Sebuah halaman yang melaporkan secara sukarela, pada Formulir
FDAberjumlah 3.500(The "MedWatch") diperkenalkan bahwa untuk
melaporkan suatu efek samping terkait dengan semua produk medis kecuali
vaksin, dan segala bentuk FDA yang telah disetujuiakan disediakan untuk
digunakan oleh wartawan (lihat Gambar 9.2 dan 9.3). Program MedWatch
bertanggung jawab terhadap tugas untukmemfasilitasi, mendukung, dan
mempromosikan proses pelaporan secara sukarela. Sejak tahun 1993, lebih dari
200.000 laporan secara sukarela telah diterima dari tenaga profesional
keperawatan kesehatan dan konsumen, kode, dan masuk ke dalam database
FDA AERS (lihat Gambar 9.4).
PERSYARATAN PELAPORAN REGULASI
Di AS, AE pelaporan oleh penyedia layanan kesehatan individu dan
konsumen bersifat sukarela. Namun, produsen, pengepakan, dan distributor
obat-obatan yang disetujui FDA (obat-obatan dan produk biologis) semua
memiliki persyaratan pelaporan wajib diatur oleh regulasi. Secara historis,
produk farmasi hanya nonbiologic dengan NDAs disetujui (yaitu, semua resep
dan beberapa obat over-the-counter) yang tunduk pada persyaratan pelaporan
wajib. Pada tahun 1994, persyaratan ini diperluas untuk mencakup produk
biologi.
Itu Perlu ditekankan bahwa peraturan ini ditujukan untuk produsen
farmasi, tetapi juga menyediakan kerangka kerja yang berguna untuk pelaporan
oleh praktisi baik FDA dan / atau produsen. Di AS, sebagian besar profesional
kesehatan dan konsumen melaporkan AE untuk produsen daripada langsung ke
FDA. Pola ini tidak terlihat di banyak negara lain, di mana konsumen dan
profesional kesehatan melaporkan langsung ke badan kesehatan publik
pemerintah.
PERSYARATAN SEKARANG
tujuan utama dari persyaratan pelaporan postmarketing FDA adalah untuk
memberikan deteksi cepat awal sinyal tentang, masalah keamanan yang
sebelumnya tidak diketahui berpotensi serius dengan obat dipasarkan, terutama
dengan obat yang baru dipasarkan. Untuk memahami persyaratan peraturan,
yang pertama perlu mendefinisikan beberapa istilah. Definisi ini revisi yang
berlaku efektif pada bulan April 1.998.
Pengalaman buruk adalah setiap AE terkait dengan penggunaan produk
obat atau biologis pada manusia, apakah atau tidak dianggap produk terkait,
termasuk yang berikut: AE terjadi dalam perjalanan penggunaan produk dalam
praktek profesional, seorang AE terjadi dari overdosis produk, apakah disengaja
atau disengaja, seorang AE terjadi dari penyalahgunaan produk, AE terjadi dari
penarikan produk, dan setiap kegagalan tindakan farmakologis yang diharapkan.
Pengalaman buruk yang tak terduga berarti setiap AE yang tidak
tercantum dalam label saat ini untuk produk. Ini termasuk peristiwa yang
mungkin gejalanya dan pathophysiologically dihubungkan dengan peristiwa
yang tercantum dalam label, tetapi berbeda dari acara tersebut karena beratnya
yang lebih besar atau spesifisitas.
Pengalaman samping yang serius adalah setiap AE terjadi pada setiap
dosis yang menghasilkan salah satu hasil sebagai berikut: kematian, a / cacat
lahir AE, rawat inap rawat inap atau perpanjangan rawat inap yang ada, terus-
menerus atau signifikan cacat / ketidakmampuan, atau anomali kongenital yang
mengancam jiwa . peristiwa medis penting yang mungkin tidak mengakibatkan
kematian, mungkin tidak lifethreatening, atau mungkin tidak memerlukan rawat
inap dapat dianggap sebagai AE serius ketika, berdasarkan penilaian medis
yang tepat, mereka dapat membahayakan pasien atau subyek dan mungkin
memerlukan intervensi medis atau bedah untuk mencegah salah satu hasil yang
tercantum dalam definisi ini. Contoh peristiwa medis tersebut termasuk
bronkospasme alergi yang membutuhkan perawatan intensif di ruang gawat
darurat atau di rumah, diskrasia darah atau kejang yang tidak mengakibatkan
rawat inap rawat inap, atau pengembangan ketergantungan obat atau
penyalahgunaan narkoba.
Tabel 9.1 menguraikan persyaratan pelaporan wajib US mengenai obat-
obatan. Dengan peraturan, perusahaan diwajibkan untuk melaporkan kepada
FDA semua kejadian buruk yang mereka menjadi sadar dan untuk memberikan
informasi selengkap mungkin. Meskipun pelaporan farmasi yang diamanatkan,
masih mengandalkan terutama pada informasi yang diberikan kepada mereka
oleh profesional kesehatan baik melalui pelaporan sukarela dan literatur ilmiah.
Dalam kasus over-the-counter (OTC) obat, laporan hanya diwajibkan
pada produk OTC dipasarkan dengan NDA disetujui, termasuk obat-obatan
resep yang menjalani beralih status OTC. Laporan saat ini tidak diperlukan
untuk obat OTC lainnya (misalnya, bahan obat yang lebih tua yang dipasarkan
tanpa NDA), meskipun pelaporan sukarela dianjurkan untuk acara yang serius.
Kedua resep dan obat bebas membutuhkan keselamatan FDA dan review
khasiat sebelum pemasaran, tidak seperti suplemen diet (termasuk vitamin,
mineral, asam amino, tumbuhan, dan zat lain yang digunakan untuk
meningkatkan total asupan makanan). Secara hukum, 18 produsen produk-
produk yang terakhir tidak perlu membuktikan keamanan atau khasiat, tapi itu
tempat hukum yang sama
tanggung jawab pada FDA untuk menunjukkan bahwa produk tertentu
tidak aman atau menyajikan risiko serius bagi kesehatan masyarakat. Selain itu,
produsen produk ini tidak perlu melaporkan AE kepada FDA. Akibatnya,
directto- FDA pelaporan sukarela oleh para profesional kesehatan dan pasien
mereka dari efek samping serius yang berhubungan dengan dan mungkin kausal
terkait dengan suplemen makanan sangat penting.

Prioritas: Konsep Analisis Dampak

evaluasi sinyal lengkap menggunakan semua data yang relevan adalah


kompleks dan sumber daya intensif. Oleh karena itu regulator harus
memprioritaskan sinyal. Dampak potensial dari masalah keamanan pada
kesehatan masyarakat adalah dasar bagi regulator '
prioritas tetapi, sampai saat ini, penghakiman dampak telah berdasarkan kriteria
kualitatif dan subjektif. Kriteria tersebut antara lain "Snip": regulator akan
memprioritaskan sinyal yang relatif kuat yang dinilai tidak baeru, secara klinis
penting, dan memiliki potensi untuk Pencegahan.

regulator Inggris telah mengembangkan dan diujicobakan, alat kuantitatif


baru untuk sinyal memprioritaskan, yang tujuannya adalah untuk fokus evaluasi
sinyal lebih rinci tentang isu-isu yang ada bukti kuat dan mereka di mana
tindakan yang paling mungkin memiliki dampak pada publik kesehatan. Kedua
dimensi bukti-kekuatan dan kesehatan masyarakat dampak-yang mencetak atas
dasar berbagai komponen. Komponen untuk skor kekuatan bukti adalah: (i)
PRR diterapkan pada data pelaporan spontan dan 95% batas kepercayaan yang
lebih rendah (ii) adalah cara memperhitungkan kedua besarnya sinyal dan
tingkat presisi dari estimasi, (ii) kekuatan / kelemahan dari serangkaian kasus
yang dipertimbangkan, dan (iii) masuk akal biologis reaksi diduga berdasarkan
sejumlah faktor pendukung masuk akal. Komponen skor dampak kesehatan
masyarakat adalah: (i) jumlah kasus yang ADR pada populasi per tahun sejak
ADR pertama dilaporkan obatnya, (ii) konsekuensi kesehatan potensial dari
ADR (fatal dan nonfatal) , dan (iii) urutan besarnya tingkat pelaporan untuk
kombinasi obat-reaksi selama tahun sebelumnya. Sebuah salib-klasifikasi
kekuatan bukti dengan dampak kesehatan masyarakat dapat memberikan
bantuan dalam memprioritaskan sinyal. Hasil numerik dari enam variabel telah
dikategorikan ke dalam empat kelompok dengan tindakan konsekuensial
disarankan (Gambar 8.2). Tabel scoring dan cut-off poin telah diturunkan secara
empiris. Sedangkan faktor tambahan yang mendukung masuk akal seperti efek
kelas atau mekanisme mendalilkan membantu jika ada, ketidakhadiran mereka
tidak menghalangi sinyal mencetak prioritas tinggi. Analisis sensitivitas tes
ketahanan kategorisasi dalam kaitannya dengan masing-masing dari enam
variabel input.

Evaluasi sinyal dan Kuantifikasi Risiko

Langkah-langkah awal evaluasi masalah keamanan obat potensial akan


fokus pada penilaian kausalitas, identifikasi setiap kemungkinan penyebab lain
dari efek samping yang dilaporkan, dan menilai risiko untuk kedua individu dan
masyarakat, baik dari segi frekuensi dan keseriusan reaksi.

Ketika sinyal dari ADR diduga muncul dari laporan spontan, setiap kasus
serupa lainnya dilaporkan sebelumnya, membentuk serangkaian kasus, juga
harus dievaluasi. Mengembangkan definisi kasus dan menentukan tingkat
hirarki kamus yang akan digunakan sangat penting untuk identifikasi kasus
tambahan. Dari perspektif regulasi, pengawasan definisi kasus harus
mendukung sensitivitas lebih spesifisitas. strategi pencarian harus direproduksi
dalam pandangan sifat dinamis dari database pelaporan. tarif melaporkan,
jumlah ADR laporan yang diterima dibagi dengan taksiran penggunaan
(exposure) terhadap produk, dapat berguna untuk generasi hipotesis. Namun,
mereka tunduk pada banyak keterbatasan. Pembilang tunduk variabilitas dikenal
dan underascertainment. Pilihan denominator harus didikte oleh pertanyaan
keamanan obat-obatan; misalnya, semua penggunaan rute tertentu administrasi
atau semua menggunakan pada anak-anak. Laporan CIOMS Kelompok Kerja V
"Tantangan saat ini di pharmacovigilance: pendekatan pragmatis" memberikan
penjelasan yang baik dari faktor dalam pemilihan, dan keterbatasan format
denominator yang berbeda seperti jumlah kemasan, jumlah unit, jumlah hari
orang-pengobatan, jumlah pasien, atau jumlah prescriptions.60 pilihan ideal
denominator, seperti jumlah pasien, mungkin tidak tersedia untuk semua sektor
pasar, seperti hospitalbased, perawatan primer, atau penggunaan non-resep.
pembilang dan penyebut berarti mengambil setidaknya periode waktu dan
lokasi geografis ke rekening. Sementara lanjut stratifikasi berdasarkan usia,
jenis kelamin, atau kovariat lainnya yang diinginkan, sering tidak mungkin di
mana hanya data pada volume yang dijual adalah available.60 (Lihat juga Bab
27.)
Idealnya, studi sistematis harus ditinjau untuk memperkirakan kejadian
ADR dan interval kepercayaan sekitar estimasi. Perhitungan perkiraan frekuensi
menggunakan pasien-waktu sebagai denominator berasumsi bahwa tingkat
bahaya konstan; tiga model fungsi hazard (tingkat kejadian sesaat) diringkas.
Dalam model hazard puncak berbentuk, meningkat bahaya pesat selama periode
awal dan kemudian turun baseline tingkat (misalnya, clozapine-diinduksi
agranulositosis). Dalam model hazard konstan tingkat mencapai dataran tinggi
tak lama setelah awal pengobatan (misalnya, saluran cerna bagian atas
perdarahan yang berhubungan dengan NSAID). Terakhir, dalam model tingkat
bahaya meningkatkan bahaya terus meningkat dari waktu ke waktu (misalnya,
HRT dan kanker payudara). Selain itu, dengan menggunakan atas satu sisi 95%
confidence interval mencerminkan ketidakpastian dalam data dan memberikan
skenario terburuk. FDA juga telah menyusun Assessment konsep Risiko kertas
Data pengamatan: Praktek Pharmacovigilance Baik dan Penilaian
Pharmacoepidemiological, yang berfokus pada kualitas kasus pelaporan,
pendekatan untuk sinyal interpretasi, dan pelaksanaan studi observasional, 61
dan baru-baru pedoman risiko , dibahas secara lebih rinci dalam Bab 33.

Evaluasi laporan spontan harus mempertimbangkan faktor-faktor


demografi seperti usia, jenis kelamin, ras, atau subkelompok lainnya, efek dari
dosis paparan, durasi, efek dari waktu (seperti waktu kalender, atau siklus hidup
produk), efek obat lain, komorbiditas kondisi, dan / atau target populasi. Karena
sifat data, laporan ADR spontan umumnya tidak memungkinkan kesimpulan
langsung pada asosiasi antara ADR tertentu dan obat dalam populasi. Namun,
beberapa faktor dalam laporan kasus yang memperkuat asosiasi termasuk
adanya re-tantangan positif, positif de-tantangan, dan tidak adanya jelas
penyebab alternatif. Klasifikasi telah diturunkan untuk penilaian kemungkinan
kausalitas di reports.36 spontan individu (assessment Kausalitas dibahas secara
rinci dalam Bab 36.) Jika masalah keamanan waran penilaian rinci, evaluasi
harus diperlebar untuk mempertimbangkan semua tersedia
data, termasuk praklinis, farmakologi klinis, uji klinis, studi
pharmacoepidemiology, dan efek kelas.

Pengkajian Data dari Sumber non-spontan

Data yang digunakan dalam penilaian risiko regulasi yang kritis Ulasan,
mengingat keterbatasan pikiran data yang berasal dari sumber-sumber pada
tingkat yang berbeda dari bukti hierarchy.62 Sumber pharmacoepidemiologic
data (selain laporan spontan), dan kekuatan dan kelemahan mereka untuk
penilaian risiko, yang dianggap bawah.

Surveillance aktif

pelaporan spontan diduga ADRs dan pelaporan intensif diduga ADR


melalui fasilitasi menggunakan sistem online atau pengingat dibangun ke resep
atau sistem dispensing adalah bentuk pengawasan "pasif". pemastian penuh
pengalaman paparan dari populasi enumerated tidak tersedia. Mana pemastian
penuh pemanfaatan obat dalam populasi tertentu tersedia, tingkat ADR dapat
segera ditentukan untuk kelompok bawah pertimbangan. PEM mencoba untuk
melaksanakan surveilans aktif populationbased tersebut (lihat Bab 12). Unit
Penelitian Keselamatan Obat (DSRU) adalah pusat untuk PEM di Inggris. Studi
PEM adalah dokter umum (masyarakat) berbasis dan paparan didasarkan pada
data resep ditiadakan di Inggris. Berikut dispensing resep dari obat studi, dokter
umum dikirim kuesioner untuk memastikan efek samping pada populasi
terkena. Ukuran kohort rata studi DSRU PEM adalah sekitar 11 000 pasien.
PEM menghasilkan tingkat insiden untuk acara dilaporkan selama pengobatan.
tingkat respons untuk kuesioner berada di kisaran 60% .63,64 Variasi pada
proses ini sekarang dilakukan oleh Jepang dan Selandia Baru.

Registry
Pendaftar adalah kumpulan sistematis peristiwa ditentukan atau eksposur
produk pada populasi pasien yang ditetapkan untuk periode waktu tertentu.
Registry juga membutuhkan protokol merinci tujuan, latar belakang, metode
penelitian, perekrutan pasien dan tindak lanjut, ukuran sampel yang
diproyeksikan, dan metode pengumpulan data, manajemen, dan analisis.
Pendaftar dapat melayani sejumlah fungsi. Pendaftar yang paling sering
digunakan sebagai pengumpulan informasi dan hipotesis menghasilkan alat,
terutama pada paparan obat-obatan selama kehamilan dan untuk obat-obatan
anak yatim, di mana informasi mungkin sangat terbatas pra-lisensi. Mereka juga
dapat bertindak sebagai dasar penduduk untuk studi linkage (dengan
menghubungkan catatan medis untuk register penduduk kota, gerakan pasien
dan mortalitas dapat dilacak secara anonim) atau sebagai penyedia data
denominator pada populasi terkena (misalnya Anak Australia Imunisasi
Register) 0,67 Awal pendaftaran kehamilan terkena, sebelum pengetahuan
tentang hasil kehamilan, memungkinkan evaluasi calon dari hasil kehamilan
dalam kaitannya dengan eksposur, dan contoh yang dapat ditemukan dalam
kaitannya dengan asma, rheumatoid arthritis, dan epilepsi treatments.68-71
Potensi keterbatasan registry Data diakui. Ini termasuk ukuran dan keterwakilan
sampel. Namun, jenis laporan registri dapat menjadi cara yang berharga dan
hemat biaya untuk mengumpulkan data mengenai penggunaan obat-obatan
selama kehamilan ketika metode pengumpulan data lainnya (misalnya, studi
kohort) yang tidak sesuai atau feasible.72 berbasis Penduduk cacat lahir
pendaftar juga ada tapi mungkin menderita underascertainment.73 contoh dari
registri peristiwa obat-diinduksi adalah registri dari arrhythmias.74 jantung
medicineinduced informasi yang dikumpulkan oleh registri akan digunakan
untuk mengembangkan profil rinci dari orang yang paling berisiko untuk obat-
induced aritmia dan untuk menentukan apakah tes genetik dapat dikembangkan
yang dapat mengidentifikasi berisiko pasien prospectively.74 contoh lain dari
registri peristiwa obat-diinduksi adalah National Registry AS Obat-Induced
Ocular Side Effects.75

Pendaftar juga telah digunakan sebagai alat pengujian hipotesis, misalnya


melihat peningkatan risiko keganasan pada pasien transplantasi dan kemudian
menilai faktor risiko yang mungkin, 76,77 dan dalam penyelidikan efek terapi
penggantian hormon pada cancer kolorektal.
Selain penyakit dan paparan pendaftar, informasi berpotensi berguna
untuk penilaian keselamatan obat bisa eksis di register dari uji klinis (misalnya,
www.trialscentral.org dan www.controlled-trials.com), studi keamanan (MHRA
studi keselamatan register) , dan Registry vaksin trials.79 juga dapat digunakan
sebagai alat minimalisasi risiko. pendaftar Clozapine diciptakan untuk
meminimalkan risiko agranulositosis fatal sekunder untuk pengobatan.
Pendaftaran pasien dan menghubungkan hasil tes darah ke pengeluaran obat
membantu mencegah pantas pengobatan ulang pada pasien yang sebelumnya
menderita penekanan sumsum tulang atau pada pasien dengan jumlah sel darah
putih yang rendah saat ini. Dalam satu registry clozapine, agranulositosis turun
menjadi 0,38% dari tingkat pra-registry antara 1% dan 2% .80,81 Dalam upaya
untuk mencegah eksposur janin untuk thalidomide, program registri berbasis
telah dibentuk untuk mengatur resep, dispensing, dan penggunaan obat. Hal ini
memerlukan pendaftaran semua berpartisipasi resep, apotek, dan patients.82

Studi observasional komparatif

studi observasional komparatif dapat dilakukan untuk sejumlah alasan.


Sebagai contoh, sebuah perusahaan dapat melakukan penelitian kohort
observasional untuk mengevaluasi profil keamanan umum produk dalam
kondisi normal penggunaan. Studi keamanan khusus dapat ditugaskan atau
dilakukan untuk mengatasi masalah keamanan terkait obat-spesifik. Dalam
situasi seperti ini tujuannya adalah untuk mengevaluasi risiko dibandingkan
dengan eksposur yang berbeda atau tidak ada paparan. Di masa lalu, studi
tersebut biasanya dilakukan dalam menanggapi keprihatinan keselamatan
diidentifikasi. Perusahaan juga mungkin diperlukan untuk melaksanakan studi
observasional komparatif umum atau khusus untuk mengukur risiko yang
diketahui atau memperluas basis data keselamatan sebagai syarat perizinan
produk. Perusahaan tidak hanya pihak yang terlibat dalam melakukan studi
tersebut; akademisi dan regulator juga dapat komisi atau melakukan studi.

Waktu skala dan kualitas penelitian pertimbangan penting bagi regulator


ketika membuat keputusan. Regulator menghadapi tantangan besar dalam
kebutuhan untuk mengatasi potensi besar masalah kesehatan masyarakat
mendesak; data berbasis populasi berkualitas baik sangat berguna bila tersedia
atau jika itu layak untuk mendapatkan mereka dalam jangka waktu yang
singkat. Penggunaan divalidasi otomatis rekam medis atau klaim database
menawarkan cara yang relatif cepat pengujian hipotesis secara populasi (lihat
Bab 13-22). Hal ini diakui bahwa pemanfaatan yang tepat dari database ini
membutuhkan komputer kuat dan terampil dan berpengalaman ahli
epidemiologi dan analis. Perlu dicatat bahwa tujuan utama dari database ini
adalah perawatan pasien atau asuransi, populasi database yang terus berubah,
dan, karena sifat administrasi database, mungkin tidak mengandung informasi
yang dibutuhkan untuk menjawab pertanyaan tentang pajanan obat dan medis
outcomes.83-87

Desain pokok dan keuntungan dan kerugian dari berbagai jenis studi
banding, seperti studi kohort dan kasus-kontrol, yang dibahas dalam Bab 3, dan
tidak akan
dibahas di sini. Namun, ada sejumlah kekhawatiran yang berkhasiat
menyebutkan dari perspektif regulasi. Semua studi ini, baik berbasis lapangan
atau menggunakan yang sudah ada catatan medis, studi banding khusus atau
umum, harus hati-hati dirancang dan dilakukan untuk kualitas tinggi. studi
keselamatan umum telah dikritik sebelumnya karena perekrutan miskin dan
digunakan sebagai alat pemasaran. Studi-studi ini harus memiliki protokol rinci
menguraikan tujuan dan sasaran terukur, latar belakang, implikasi ukuran
sampel, pemikiran, dan definisi dari populasi sumber, populasi penelitian dan
basis penelitian, hasil dan paparan definisi, dan rencana analisis. Isu-isu seperti
bias dan membingungkan (terutama penyaluran pasien) dan kelompok
pembanding yang tepat perlu pertimbangan yang sangat rinci pada tahap desain
studi.

Ketika menilai temuan dari studi pharmacoepidemiology, berbagai faktor


harus dipertimbangkan. Ini termasuk bagaimana penawaran studi dengan
pengguna baru dan yang sudah ada / lazim pengguna, 88 kasus dengan
"penyebab langsung alternatif," atau subyek dengan contraindications.89,90 Isu-
isu lain yang akan dinilai meliputi desain, sampel keterwakilan, sumber data
dan kualitas, pengukuran dan kehandalan, diagnosis, kelompok perbandingan,
hasil, mata pelajaran yang hilang / pengujian Bias, dosis, durasi dan / atau
variasi lainnya dalam eksposur, kovariat, efek usia / masa / kohort, dan
techniques.91-94 statistik Confounding oleh indikasi adalah perhatian khusus
ketika menafsirkan penelitian. Jika indikasi adalah gangguan medis yang
merupakan predisposisi acara yang diteliti, setiap ketidakseimbangan dalam
profil risiko yang mendasari antara diperlakukan dan kelompok pembanding
dapat menghasilkan results.95,96 bias metode studi Baru yang menggunakan
teknik seperti kasus seri analisis, kasus-Crossover , atau kasus-time control
mungkin tepat tergantung pada pertanyaan penelitian yang addressed.97-102
(Lihat Bab 48.)
Tidak semua masalah keamanan obat saat ini setuju untuk belajar
menggunakan teknik epidemiologi formal. Hal ini dapat terjadi di mana kedua
hasil dan paparan yang langka, seperti dalam mungkin fibrosis dengan derivatif
ergot (mis, pergolid). Lebih baik dan lebih besar keterkaitan data resep di kedua
perawatan primer dan sekunder yang dibutuhkan.
studi banding terbaru yang telah berkontribusi untuk pengambilan
keputusan peraturan termasuk Juta Perempuan Belajar di HRT, 103
fenilpropanolamin dan stroke, 104 antipsikotik dan perpanjangan QT, 105 dan
vitamin K dan cancer kecil

Clinical Trials, Besar Sederhana Trials Keselamatan, dan Meta-


analisis

Sebuah studi keselamatan yang sederhana besar, yang merupakan studi


klinis yang dirancang untuk menilai relatif sedikit hasil keamanan dalam
sejumlah besar pasien, memiliki peran untuk bermain sebelum dan postlicensing
(lihat Bab 39). Pre-lisensi, percobaan keselamatan yang sederhana besar dapat
diindikasikan mana sinyal keselamatan perhatian dalam database uji klinis telah
muncul yang tidak lain juga dibahas atau di mana obat ini dimaksudkan sebagai
produk pencegahan pada individu tanpa gejala. Pasca-lisensi, uji klinis
menyediakan sumber sinyal dari masalah keamanan, misalnya ketika uji klinis
dilakukan untuk tujuan memperluas indikasi untuk pengobatan. percobaan besar
lainnya dapat dilakukan dengan tujuan pemeriksaan masalah keamanan tertentu.
pedoman peraturan tentang kesehatan, statistik, dan masalah desain dalam uji
klinis diuraikan dalam ICH guidelines.107-112 Metaanalyses juga dapat
memberikan sintesis yang berguna data, ketika menilai kekhawatiran keamanan
obat (lihat Bab 44). Ini juga mengalami penilaian yang ketat oleh regulators.113

hipotesis
pengujian kesetaraan juga dapat diterapkan untuk
pharmacoepidemiology. Tujuannya mungkin untuk menguji risiko zat tertentu
dengan risiko yang diketahui atau dengan medicine.114 lain Untuk
menunjukkan bahwa produk tes tidak bermakna berbeda dari produk referensi,
perbedaan terbesar yang dapat diterima secara klinis, sehingga perbedaan besar
dari ini akan menjadi masalah dalam praktek, yang ditetapkan sebelumnya
sebagai Δ. Selama dua risiko yang akan dianggap setara, interval kepercayaan
twosided 95% dari perbedaan antara kedua produk harus seluruhnya berada + Δ
dan -Δ. Pendekatan ini memungkinkan kesimpulan dari kesetaraan, bukan
pendekatan yang umum digunakan pengujian perbedaan dan menyimpulkan
kesetaraan ketika hipotesis nol kesetaraan tidak ditolak. Pendekatan kesetaraan
belum banyak digunakan di pharmacovigilance. Faktor-faktor yang perlu
dipertimbangkan adalah prespecification batas kesetaraan dan apa yang
merupakan nilai ambang risiko yang dapat diterima relatif atau perbedaan
risiko, sensitivitas, dan ukuran studi

Jika penelitian tidak menunjukkan perbedaan atas dasar pengujian


hipotesis konvensional, ini tidak berarti bahwa risiko adalah sama; sifat data
pharmacoepidemiologic mungkin predisposisi menemukan tidak ada perbedaan
yang diberikan "kebisingan" seperti kesalahan klasifikasi non-diferensial, yang
beroperasi untuk hasil bias nol. Kebanyakan regulator menilai penelitian akan
berhati-hati pada interpretasi hasil yang mencakup nilai nol, mencatat ini
sebagai meyakinkan atau karena keterbatasan data. Namun, ketika menafsirkan
penelitian kita harus mengajukan pertanyaan: "bukti ini tidak adanya atau tidak
adanya bukti?" Rothman dan Greenland115 memberikan beberapa saran tentang
pertanyaan ini, mencatat bahwa ketepatan selang kepercayaan menggambarkan
apa ukuran efek data konsisten dengan dan menyarankan penggunaan fungsi
nilai P.
Sumber Data lainnya
Ada minat yang cukup besar dalam bagaimana pharmacoepidemiologic
dan penelitian farmakogenetik dapat digunakan untuk menjelaskan variabilitas
yang diamati dalam menanggapi obat pada populasi pasien dengan
polimorfisme dikenal dalam profil genetik mereka (lihat Bab 37). Utilitas utama
ini adalah memaksimalkan keseimbangan manfaat / risiko untuk pasien secara
individual untuk substance.116,117 diberikan

The Hill seperangkat kriteria mengingatkan kita untuk melihat di luar


bukti indeks ketika menilai asosiasi kausal mungkin. Seperti diperiksa di
Rothman dan Greenland, 115 perhatian untuk kriteria tersebut diperlukan.

studi latar belakang dalam penyakit sasaran (morbiditas dan mortalitas)


dan pemanfaatan obat (kovariat yang berhubungan dengan paparan) juga akan
memberikan regulator dengan informasi penting ketika menilai masalah
keamanan.

Manfaat / Penilaian Risiko Penilaian

keseimbangan manfaat dan risiko dilakukan sepanjang kehidupan obat,


melalui pengembangan obat-obatan, pada saat permohonan izin, dan kemudian
terus menerus dalam fase pasca-lisensi. Prinsip-prinsip yang mendasari
penilaian manfaat / risiko yang sama pada semua tahap. Namun, data yang
mungkin tersedia akan berbeda secara substansial. Setiap produk tahun ditarik
dari berbagai pasar di seluruh dunia untuk reasons.118 keselamatan Di masa
lalu, namun, regulator dan perusahaan memiliki sering
menggunakan metode yang berbeda dari manfaat penilaian / risiko dan
mencapai conclusions.119 sangat berbeda Perbedaan ini bahkan telah terjadi
antara regulator yang berbeda di negara yang berbeda. Contohnya termasuk
penarikan dari pasar Eropa tolcapone, troglitazone, dan trovafloxacin,
sementara di AS penggunaan produk ini awalnya dibatasi
 Sebuah berita berjudul , " pasca pemasaran Expedited Keselamatan
Laporan - 15 - Day Siaga laporan , " telah ditambahkan ke publik Map
92S - 0251 pada 22 Mei 2002. berita ini memungkinkan untuk pelaporan
elektronik sukarela 15 - hari ( dipercepat ) laporan keamanan tanpa
pengajuan kertas yang dibutuhkan.
 Sebuah draft Pedoman untuk Industri berjudul , " Menyediakan Kiriman
peraturan di Electronic Format – pasca pemasaran Periodik Merugikan
Obat Experience Laporan” diterbitkan pada tanggal 24 Juni 2003.

Sampai dengan akhir tahun 2003, hampir 20% dari semua laporan dipercepat
diserahkan secara elektronik, dan FDA mendorong perusahaan untuk
berpartisipasi dalam proses sukarela ini, menggantikan obatan Menonton (
3500A ) laporan. Untuk memfasilitasi upaya ini , FDA sebagai tuan rumah
melakukan pertemuan dua kali setahun dengan perwakilan dari perusahaan
farmasi besar. Tujuan dari pertemuan ini adalah untuk membahas elektronik
pelaporan AE, termasuk cara-cara untuk merangsang pelaporan elektronik
meningkat dalam industri. Penjelasan mengenai proses bagaimana FDA
menangani ini Laporan akan disediakan pada bagian selanjutnya dari bab ini.

Perubahan terbaru
Dalam beberapa tahun terakhir, telah ada upaya internasional yang signifikan
untuk standarisasi lingkungan peraturan farmasi di seluruh dunia melalui
naungan Konferensi Internasional tentang Harmonisasi (ICH) Persyaratan
Teknis Pendaftaran Farmasi untuk Manusia. Upaya ini menuju harmonisasi
internasional memiliki dampak langsung pada bagaimana FDA saat menulis
ulang peraturan tentang pelaporan AE. AERS diluncurkan pada bulan
November 1997 dan merupakan sistem internasional kompatibel sesuai penuh
dengan inisiatif ICH.
Inisiatif yang secara langsung mempengaruhi pasca pemasaran surveilans
adalah :
 M1 IMT (International Medical Terminologi): AERS menggunakan kamus
medis untuk Regulatory Kegiatan (MedDRA) sebagai alat coding untuk
melaporkan reaksi yang merugikan / merugikan acara istilah melalui
laporan keselamatan kasus individu.
 M2 Estri (Standar Elektronik untuk Transfer Informasi Peraturan): AERS
menggunakan standar Estri penyampaian laporan keselamatan kasus
individu dalam bentuk elektronik melalui electronic data interchange (EDI)
gateway.
 E2B (M) (Data Elemen untuk Penularan Individu Case Reports
Keselamatan): AERS telah menerapkan format data E2B ke dalam
database, dan akan menggunakan E2B sebagai standar untuk pengajuan
elektronik.
 E2C PSUR (Periodic Keselamatan Perbarui Laporan): mendefinisikan
format standar untuk pengelolaan data keselamatan klinis untuk PSURs
untuk obat dipasarkan. Awalnya, PSURs akan diserahkan di atas kertas,
dan FDA telah menerbitkan pedoman untuk memungkinkan ringkasan ini
akan dikirim dalam elektronik untuk elektronik Central Dokumen Ruangan
(eCDR).

Badan telah melakukan upaya besar dalam pelaksanaandari pelaporan


elektronik Laporan Individual Kasus Keselamatan(ICSRs) berdasarkan ICH
E2B (M), M1 (MedDRA), dan M2standar, dan untuk memperjelas dan merevisi
peraturan mengenaipersyaratan pelaporan keselamatan pra dan postmarketing
untukobat dan biologis produk manusia. Dalam Daftar Federal 7 Oktober 1997
(62 FR 52237), FDA menerbitkan aturan akhir amandemen peraturan untuk
pelaporan keselamatan dipercepat. Aturan akhir ini mengimplementasikan
inisiatif ICH E2A pada pengelolaan data keselamatan klinis. Berdasarkan E2A,
aturan akhir memberikan definisi yang diterima secara internasional dari
"serius," membutuhkan pengajuan MedWatch 3500A untuk pengajuan kertas,
membutuhkan laporan dipercepat dalam 15 kalender daripada bekerja hari
kerangka waktu, dan menyelaraskan prosedur pelaporan pra dan postmarketing
serta pelaporan internasional dan domestik. Berkenaan dengan peraturan
pelaporan keselamatan postmarketing untuk obat manusia dan produk biologis
berlisensi, Badan menerbitkan aturan yang diusulkan dalam Federal Register 27
Oktober 1994 (59 FR 54046), untuk mengubah persyaratan ini, serta yang lain,
untuk melaksanakan internasional standar, dan untuk memfasilitasi pelaporan
pengalaman buruk.
Untuk membantu produsen farmasi memahamipersyaratan baru, pada
27 Agustus, 1998 FDA menerbitkan sebuah bimbingan sementara untuk
industri, "postmarketing Pengalaman buruk Pelaporan Obat Manusia dan Izin
Produk Biologi:. Klarifikasi Apa yang harus Laporkan"
Dalam Daftar Federal 5 November 1998 (63 FR 59746), Badan
menerbitkan sebuah Lanjutan. Pemberitahuan Usulan pembuatan peraturan
untuk memberitahu produsen yang sedang mempertimbangkan menyiapkan
aturan yang diusulkan yang akan mengharuskan mereka untuk menyampaikan
laporan kasus individu secara elektronik menggunakan terminologi standar
medis, elemen data standar, dan standar transmisi elektronik seperti yang
direkomendasikan oleh ICH di M1, M2, dan E2B (M) inisiatif. FDA
menerbitkan map Umum 92A-0251, "Electronic Penyampaian pascapemasaran
Expedited Periodik Individu Kasus Laporan Keselamatan," yang
memungkinkan perusahaan farmasi untuk menyampaikan laporan kepada FDA
secara elektronik.
Pada bulan Maret 2001, Badan mengeluarkan "Pedoman untuk Industri:
Pelaporan pascapemasaran Keselamatan Manusia Obat dan Produk Biologi
Termasuk Vaksin," yang menggantikanyang Maret 1992 dokumen.
The November 2001 Pedoman untuk Industri "ElektronikPenyampaian
pascapemasaran Expedited Laporan Keselamatan, "menggambarkan bagaimana
perusahaan farmasi dapat mengajukan ICSRs menggunakan EDI gerbang dan
media fisik (misalnya, CD-ROM) dan lampiran untuk ICSRs hanya
menggunakan media fisik.
Pada bulan Mei 2002, FDA mengeluarkan Pedoman untuk Industri
"Menyediakan Kiriman Regulatory di Electronic Format postmarketing
Periodik Merugikan Laporan Obat Experience,"yang menjelaskan bagaimana
perusahaan farmasi dapat mengajukan ICSRs periodik dengan dan tanpa
lampiran dan informasi deskriptif (termasuk PSURs) menggunakan media fisik.
Pada bulan September 2003, FDA mengeluarkan Pedoman untuk
Industri "Menyediakan Kiriman Regulatory dalam Laporan Tahunan Elektronik
Format untuk NDAs dan ANDAs," yang menjelaskan bagaimana perusahaan
farmasi dapat mengirimkan informasi deskriptif (Termasuk PSURs)
menggunakan media fisik.
Pada tanggal 1 Oktober 2003, FDA ditransfer produk tertentutanggung
jawab pengawasan dari Pusat Evaluasi Biologis dan Penelitian (CBER) ke
CDER. Konsolidasi ini memberikan kesempatan yang lebih besar untuk lebih
mengembangkandan mengkoordinasikan kegiatan ilmiah dan peraturan
antaraCBER dan CDER, mengarah ke lebih efisien dan konsistenProgram
ulasan untuk obat manusia dan biologis. FDA percaya bahwa dengan lebih
banyak obat dan produk biologis yang dikembangkan untuk lebih luas penyakit,
interaksi tersebut diperlukan untuk kedua tindakan lembaga efisien dan
konsisten. Di bawah struktur baru, produk biologis dipindahkan ke CDER akan
terus diatur sebagai biologis berlisensi.

USULAN MODIFIKASI
FDA bekerja pada lebih lanjut modifikasi keselamatan pasca pemasaran
persyaratan pelaporan. Reaksi obat merugikan serius (SADR) peraporan usulan
aturan ini diharapkan akan diterbitkan dalam nearfuture, yang berfokus pada
laporan kualitas, standardizes terminologyto "Reaksi merugikan obat", dan
mendorong aktif queryby perawatan kesehatan profesional di perusahaan yang
berbicara langsung dengan reporter laporan awal yang merugikan. Ini
memerlukan, minimal, garis fokus pertanyaan yang dirancang untuk menangkap
informasi relevan klinis, mengikuti dan penentuan keseriusan, dan
mendefinisikan data minimum ditetapkan untuk keselamatan laporan. Aturan
yang diusulkan akan juga menerapkan ICH E2C: International PSUR, yang
status containsmarketing, inti pelabelan (perusahaan inti data sheet(CCDS); inti
perusahaan keamanan informasi (CCSI) adalah Informasi keselamatan di CCD),
perubahan status keamanan sejak lastreport, paparan data klinis penjelasan
kasus, baris data (narasi ringkasan reportswhich keselamatan kasus individu
memberikan demografis, obat, dan informasi acara) Daftar dan tabel, status
postmarketing surveillancesafety studi , analisis kritis secara keseluruhan, dan
penilaian. 27 Oktober 1994 awal usulan amandemen pasca pemasaran periodik
AE persyaratan pelaporan akan bereproposed dalam aturan diusulkan ini saat
ini, berdasarkan bimbingan topik ini dikembangkan oleh ICH.
Seperti disebutkan sebelumnya, OTC produk tanpa arenot NDA subjek
pelaporan. Untuk membawa produk tersebut ke dalam jaring pengaman
thepostmarketing, FDA rencana untuk menerbitkan OTCADR pelaporan
mengusulkan aturan. Pertimbangan sedang givento kebutuhan ADR laporan
untuk OTC monographdrugs, karena kebanyakan dipasarkan OTC obat-obatan
kekurangan approvedNDA. Review FDA dipasarkan OTC obat-obatan
withoutapproved NDAs (ANDAs) telah dicapai throughrulemaking menetapkan
kondisi dalam obat-obatan monographsfor obat OTC dalam kelas terapeutik
(misalnya, pencahar). AnOTC obat monografi menentukan kondisi (yaitu,
ingredientsand konsentrasi, pengujian prosedur, dosis, pelabelan dan modus
administrasi) di mana obat OTC adalah generallyrecognized sebagai aman dan
efektif dan tidak misbranded.
Dalam upaya untuk memperluas kemampuan lembaga untuk memantau
andimprove penggunaan Brankas manusia dan biologis produk bothduring uji
klinis dan setelah produk di pasar, FDA pada tanggal 14 Maret 2003 diterbitkan
aturan diusulkan, berjudul "Persyaratan pelaporan keselamatan untuk obat
manusia dan Produk biologi " ("The Tome"), yang akan mengharuskan
perusahaan ke file dipercepat laporan dugaan ADR kecuali perusahaan produk
tidak menyebabkan reaksi.
Untuk dianjurkan penggantian laporan pengalaman buruk obat periodik
(21 CFR 314.80) dengan PSURs. Sekarang, CDER mendorong industri untuk
mengirimkan pengabaian toallow penyerahan PSURs bukan laporan obat
periodik pengalaman buruk. PSURs adalah dalam format yang diusulkan oleh
ICH persyaratan teknis untuk pendaftaran farmasi untuk digunakan manusia,
E2C topik. PSUR merangkum data keselamatan yang diterima oleh sponsor
untuk anapplication dari sumber-sumber di seluruh dunia untuk jangka waktu
tertentu. Jumlah PSURs yang diterima tergantung pada thenumber dari
NDAs/ANDAs dipasarkan. PSUR untuk matenhances pasca pemasaran obat
dan terapi keamanan hayati karena memerlukan informasi tambahan dan
analisis (misalnya data paparan pasien) tidak diperlukan dalam laporan
pengalaman obat periodik yang merugikan. Data tambahan review kami ini
meningkat pasca pemasaran keselamatan.

PENGUMPULAN DATA: PROGRAM MEDWATCH


pengawasan sistem pasca pemasaran nasional yang efektif tergantung
pada sukarela melapor kejadian buruk, kesalahan pengobatan dan masalah
kualitas produk oleh pesisir kesehatan profesional konsumen FDA, baik secara
langsung maupun melalui manu-facturer. Profesional kesehatan individu
maupun perawatan rumah sakit diminta oleh hukum Federal atau peraturan
untuk menyerahkan laporan AE pada obat-obatan, meskipun Undang-Undang
Federal doesrequire rumah sakit dan fasilitas lain yang"pengguna" deathsand
laporan cedera serius yang terjadi dengan perangkat medis.
Banyak organisasi kesehatan merekomendasikan dan promotethe
pelaporan AEs ke FDA. Rumah sakit monitoringby kejadian merugikan
termasuk dalam Joint Commission on theAccreditation kesehatan organisasi
(JCAHO) berdiri-risiko ARDS untuk keselamatan pasien yang dikeluarkan pada
tahun 2003. Dalam rangka untuk akreditasi maintainfull, JCAHO membutuhkan
setiap International Rescue Committee-tion perawatan kesehatan untuk
memantau untuk kejadian buruk yang melibatkan perangkat
pharmaceuticalsand, dengan obat pemantauan menjadi fungsi
continualcollaborative. Standar JCAHO menunjukkan bahwa medicalproduct
AE pelaporan harus dilakukan setiap hukum/peraturan yang berlaku, termasuk
negara Federal tubuh.
FDA mendorong semua penyedia perawatan kesehatan (dokter, apoteker,
perawat, dokter gigi, dan lain-lain) untuk mempertimbangkan adverseevent
pelaporan ke FDA sebagai bagian dari mereka profesional responsi-
meningkatkan kemampuan sumber. Masyarakat Amerika Pharmacistshas sistem
Kesehatan mengeluarkan pedoman ADR pengawasan dan pelaporan.
Asosiasi pengobatan Amerika dan Asosiasi Dental
Amerika menganjurkan dokter dan partisipasi dokter gigi partisipasi merugikan
sistem pelaporan sebagai kewajiban. Since1994, penulis jurnal asosiasi
pengobatan Amerika telah mengistruksikan buruk reaksi harus obat atau
perangkat dilaporkan kepada badan pemerintah, Selain itu untuk mengirimkan
informasi tersebut untuk publikasi. Kumite editor jurnal kesehatan internasional
memiliki revisi "Seragam persyaratan untuk naskah dikirim untuk jurnal
biomedis " juga mendorong pelaporan yang tepat waktu pada bahaya kesehatan
masyarakat yang mendesak.
Mengingat pentingnya penting postmarketing pengawasan, MedWatch,
informasi keselamatan FDA dan merugikan program pelaporan acara, didirikan
pada 1993. Pengawasan FDA sementara pasca pemasaran mendahului program
MedWatch, inisiatif penjangkauan profesional perawatan kesehatan dan pasien
ini dirancang untuk mempromosikan dan memfasilitasi proses pelaporan secara
sukarela oleh penyedia layanan kesehatan dan pasien mereka.
MedWatch program ini memiliki empat tujuan. Yang pertama adalah
meningkatkan kesadaran obat, perangkat, dan produk diinduksi penyakit lainnya
medis dan pentingnya pelaporan. Diajarkan ahli kesehatan bahwa tidak ada obat
atau produk lainnya tanpa risiko dan didorong untuk mempertimbangkan
produk medis menyebabkan ketika menilai masalah klinis pasien. Tujuan ini
dicapai melalui penjakauan pendidikan, yang meliputi presentasi profesional,
publikasi dan program pendidikan berkelanjutan.
Kedua tujuan MedWatch adalah untuk menjelaskan apa yang harus berep
orted. Profesional kesehatan dan pasien yang berusia untuk membatasi laporan
serius AEs, memungkinkan FDA dan produsen untuk fokus pada yang paling
berpotensi peristiwa penting. Kausalitas bukanlah sebuah prasyarat bagi
pelapor; kecurigaan bahwa produk medis yang mungkin berkaitan dengan suatu
peristiwa yang cukup serius untuk memberitahu FDA atau produsen.
Tujuan ketiga adalah untuk membuatnya mudah dan sederhana untuk sub
mita laporan serius AE, obat kesalahan, atau produk quality
problem langsung ke FDA. Formulir satu halaman adalah digunakan untuk
pelaporan diduga masalah dengan semua manusia menggunakan produk medis
(kecuali vaksin) diatur oleh badan obat-obatan, biologi, peralatan medis, nutrisi
khusus (contoh : makanan suplemen, susu formula) dan kosmetik. Ada dua
versi dari bentuk (Lihat Gambar 9.2 dan 9.3). Bentuk FDA 3500 digunakan
untuk pelaporan suka rela, sementara bentuk FDA 3500A digunakan untuk
wajib melaporkan. Kedua bentuk tersedia di FDA situs Medwatch
(http://www.fda.gov/medwatch) dan mungkin bedownloaded sebagai bentuk-
bentuk fillabe untuk menyimpan dan mencetak. Ongkos kirim dibayar FDA
3500 formulir dapat dikembalikan ke FDA melalui surat atau fax ke 1-800 FDA
0178.

Pada tahun 1998, program MedWatch dilaksanakan versi online sukarela


FDA 3500 formulir untuk melaporkan melalui Internet (lihat
www.fda.gov/medwatch). Pada tahun 2003, sekitar 40% dari langsung
(sukarela) laporan yang diterima dari penyedia dan konsumen dikirim ke FDA
melalui aplikasi online ini. Selain itu, MedWatch menyediakan sejumlah 800
telepon bebas pulsa, 1-800-FDA-1088, untuk wartawan yang ingin
menyampaikan laporan secara lisan kepada seorang kesehatan MedWatch
profesional..

Vaksin adalah satu-satunya produk medis FDA yang digunakan manusia


yang tidak diatur dilaporkan pada formulir pelaporan MedWatch. Laporan
mengenai vaksin dikirim ke vaksin yang merugikan peristiwa sistem pelaporan
(VAERS) pada formulir VAERS-1, tersedia dengan menghubungi 1-800-822-
7967 atau dari situs VAERS di www.fda.gov/cber/vaers/vaers. htm. VAERS
adalah FDA / Pusat Pengendalian Penyakit dan Pencegahan Program untuk
pelaporan wajib oleh dokter efek samping terkait vaksin (lihat juga Bab 30).

FDA mengakui bahwa keprofesionalitas kesehatan yang memiliki


memprihatinan mengenai kerahasiaan mereka sebagai wartawan, dan bahwa
pasien yang kasusnya mereka melaporkan. Dalam rangka mendorong pelaporan
efek samping, peraturan FDA menawarkan perlindungan substansial terhadap
pengungkapan identitas dari kedua wartawan dan pasien. Pada tahun 1995,
peraturan mulai berlaku memperkuat perlindungan melawan pengungkapan
oleh preempting hukum penemuan negara terhadap laporan sukarela yang
diselenggarakan oleh farmasi, biologi, dan perangkat medis manufacturers.33
Selain itu, Asuransi Kesehatan Portabilitas dan Akuntabilitas Act (HIPAA)
Peraturan Privasi (lihat www.fda.gov/medwatch/ hipaa.htm) khusus
memungkinkan apoteker, dokter, atau rumah sakit untuk terus melaporkan efek
samping dan informasi lain yang berkaitan dengan kualitas, efektivitas, dan
keamanan produk peraturan FDA (lihat juga Bab 38).

Produsen yang berpartisipasi dalam FDA "MedWatch ke Produsen"


Program (MMP) disediakan dengan salinan laporan serius yang

disampaikan langsung kepada FDA untuk entitas molekul baru (lihat


www.fda.gov/medwatch). Untuk memudahkan memperoleh informasi tindak
lanjut, para profesional kesehatan yang melaporkan langsung ke FDA diminta
untuk menunjukkan apakah mereka lebih suka bahwsa identitas mereka tidak
diungkapkan melalui MMP untuk produsen produk yang terlibat dalam kasus
yang dilaporkan. Ketika preferensi seperti ditunjukkan, informasi ini tidak akan
dibagikan.

Tujuan keempat MedWatch adalah untuk memberikan informasi


keselamatan yang tepat waktu dan berguna secara klinis pada semua produk
medis FDA yang diatur untuk profesional perawatan kesehatan dan pasien
mereka. Keinginan FDA dalam menginformasikan profesional kesehatan
tentang temuan keselamatan baru tidak hanya untuk memungkinkan mereka
menggabungkan informasi keselamatan baru dalam praktek sehari-hari, tetapi
juga untuk menunjukkan bahwa pelaporan sukarela memiliki dampak klinis
yang pasti.
Sebagai informasi baru menjadi tersedia melalui "Dear Health Letters
Profesional," nasihat kesehatan masyarakat dan peringatan keamanan, itu
diposting di situs MedWatch dan pemberitahuan langsung dari postingan
dikirim melalui email ke pelanggan dari listserve MedWatch. Listserve ini
mencapai keprofesionalan perawatan kesehatan, konsumen, dan media. Pada
tahun 2004, MedWatch disebarluaskan informasi keselamatan baru di lebih dari
45 obat atau produk trapi biologis sebagai "peringatan keamanan" untuk lebih
dari 45.000 pelanggan individu. Satu dapat berlangganan listserve MedWatch
dengan mengunjungi website (http:// www.fda.gov/medwatch/elist.htm).
MedWatch juga memiliki jaringan lebih dari 160 kesehatan peduli yang
handall, terorganisasi media konsumen perawatan kesehatan dan pelayanan
kesehatan yang telah bersatu dengan FDA sebagai MedWatch Partners. Masing-
masing organisasi bekerja dengan MedWatch untuk mempromosikan pelaporan
sukarela dan menyebarkan pemberitahuan informasi keselamatan kepada
anggota atau pelanggan mereka dengan menggunakan situs web mereka, daftar
distribusi email, dan publikasi seperti buletin dan jurnal.

PENILAIAN KEAMANAN: KEJADIAN MERUGIKAN PELAPORAN


SISTEM (AERS)

AERS adalah client server, Oracle sistem database relasional berdasarkan


yang berisi semua AE melaporkan farmasi sub mitted Agen baik secara
langsung atau melalui produsen. Misi AERS adalah untuk mengurangi efek
samping yang berhubungan dengan FDA produk yang diatur dengan
meningkatkan pengawasan postmarketing dan membantu mencegah hasil yang
merugikan terkait dengan kesalahan medis.

AERS dirancang dan dilaksanakan dengan konsep berikut dalam pikiran:

- Ramah tata letak layar dan bantuan fungsi


- Kemampuan pencarian ditingkatkan, fitur kontrol kualitas dan review
elektronik laporan
- Meningkatkan efisiensi operasional, efektivitas dan kontrol kualitas dari
proses penanganan AE
- Meningkatkan aksesibilitas informasi AE semua evaluator keamanan dan
petugas medis dalam FDA
- Menerapkan dan memelihara kompatibilitas dengan standar ICH
- Mbangun kemampuan untuk menerima kiriman elektronik
AE menggunakan standar ICH;
- Memberikan kemampuan generasi sinyal otomatis dan perbaikan alat
untuk analisis potensi sinyal AE.

Produsen farmasi mengirimkan kertas AE melaporkan ke FDA pusat


ruang dokumen, di mana mereka dilacak dan diteruskan ke Kantor Keamanan
Obat (ODS) di CDER FDA. Laporan yang disampaikan oleh individu yang
dikirimkan, fax, dikirim melalui internet, atau menelepon ke MedWatch, dan
diprioritaskan untuk FDA Pusat yang sesuai (s) (yaitu, CDER, CBER, Pusat
untuk Perangkat dan Radiologi (CDRH), Balai Besar Veteriner Kedokteran
(CVM), dan CFSAN).
Ketika diterima oleh ODS, ini yang masuk 3500 dan laporan 3500A
ditugaskan sejumlah laporan permanen (laporan keselamatan individu),
dicitrakan, dan disimpan dalam Imaging System Retrieval Ware, kemudian
mereka masuk verbatim ke database AERS. entri data memiliki sejumlah
langkah berurutan yang melibatkan entri perbandingan, perbandingan kualitas
bidang entri kritis, dan coding dan kontrol kualitas dalam standar terminologi
medis internasional menggunakan MedDRA. dan 15 hari laporan dipercepat
langsung menerima penanganan prioritas dan dimasukkan ke AERS dalam
waktu 14 hari.

Kontrol kualitas otomatis dilakukan untuk meninjau laporan untuk


ketepatan waktu, kelengkapan, dan akurasi dari coding. Sampel statistik juga
digunakan untuk tempat memeriksa kinerja produsen dalam memberikan
laporan yang akurat dan tepat waktu, yang dapat digunakan untuk sesuai fungsi.

Meskipun sebagian besar entri data ke dalam AERS saat dilakukan


melalui coding manual, AERS dirancang untuk pengajuan elektronik ICH E2B
(M) standar, MedDRA precoded laporan keselamatan kasus individu. Konsep
desain ini menggabungkan standar ICH untuk konten, struktur, dan pengiriman
laporan keselamatan kasus individu. Untuk mempersiapkan pelaksanaan skala
penuh dari pengajuan elektronik, program percontohan langkah demi langkah
berada di tempat. navigasi pindah ke produksi penuh pada tahun 2002 untuk
pengambilan ICSRs.
Salinan dari semua laporan dalam database AERS tersedia untuk umum
melalui FDA Kebebasan Kantor Informasi, dengan dihapusnya semua informasi
rahasia (misalnya, pasien, reporter, pengidentifikasi institusional). The AERS
database di update kuartalan non-kumulatif, ini dapat diperoleh dari National
Technical Information Service (www.NTIS.gov) atau dari situs FDA
(www.fda.gov/ cder / aers / extract.htm).
Berbagai fitur teknologi yang dibantu dalam AERS meningkatkan kajian
AE oleh evaluator keselamatan ODS. Evaluator keselamatan ini memiliki alat
pharmacovigilance yang tersedia untuk laporan AE penyaringan untuk
menghasilkan sinyal:
- Trase Primer: Screening program yang terlampir dan terevaluasi
peringatan keselamatan untuk peristiwa serius dan tidak berlabel, dan
peristiwa medis yang serius diketahui berhubungan dengan obat
(misalnya, torsade de pointes, agranulositosis, racun nekrolisis epidermal
, dll).
- Trase Sekunder / pengawasans: menyediakan alat untuk mengidentifikasi
sinyal berdasarkan jumlah tertentu secara keseluruhan untuk setiap
kategori risiko yang berkaitan dengan semua ADR laporan yang diterima
untuk obat yang diberikan.
- Periode berkala (canned): memungkinkan ulasan periodik Database
AERS, termasuk semua tindakan baru dalam jangka waktu.
- Active (canned dan / atau ad hoc) query: mewakili penyelidikan sinyal
aktif kasus seri ditemukan dari salah satu tingkat di atas penyaringan.

AERS memaksimalkan kemampuan Badan untuk mengidentifikasi dan menilai


sinyal penting dalam sistem pelaporan spontan. Mulai tahun 2004 dan selama
periode 5 tahun, upgrade ini akan terjadi pada apa yang kita sebut AERS II.
AERS akan ditingkatkan untuk menangani pengolahan FDA pasca pemasaran
yang merugikan laporan peristiwa yang berkaitan dengan obat manusia dan
biologis terapi selama 5 tahun ke depan. Ini akan menjadi berbasis web,
menerima kiriman elektronik, memenuhi ICH, HL7, E2B (M), eXtensible
Markup Language (XML), dan Tagged Image File Format (TIFF) persyaratan;
menangani beberapa skema produk coding (kode bar), antarmuka untuk industri
dan sistem pemerintah lainnya, dan termasuk repositori pelaporan memberikan
laporan pra-disesuaikan dan fitur ad hoc untuk kebutuhan khusus.

LAPORAN EVALUASI DARI BEBERAPA KEJADIAN

Setiap hari kerja tunggal, FDA menerima hampir seribu laporan spontan
efek samping baik secara langsung atau melalui industri. ODS di CDER
mempekerjakan sekitar 25 evaluator keselamatan postmarketing dan lebih dari
selusin ahli epidemiologi.
Tugas utama dari evaluator keselamatan adalah untuk meninjau kerugian
laporan acara. Sebagian besar evaluator keselamatan apoteker klinis yang
ditugaskan kelompok atau golongan obat atau produk terapi biologis
berdasarkan pelatihan masa lalu mereka dan pengalaman tertentu. Evaluator
keamanan ini bekerja di bawah pengawasan dan bimbingan dari sekitar
setengah dosen pemimpin tim yang memiliki pengalaman yang cukup dalam
evaluasi dan penilaian laporan efek samping, pengetahuan substansial dari obat
atau agen terapi biologis, dan kesadaran keterbatasan data AERS. Setiap laporan
acara berlabel atau idak berlabel bahkan laporan yang merugikan
menggambarkan peristiwa medis penting seperti gagal hati, aritmia jantung,
gagal ginjal, dan rhabdomyolysis secara elektronik ditransfer ke dalam inbox
komputer dari evaluator keselamatan, yang memantau peristiwa ini setiap hari.
Evaluator keamanan mencoba untuk mengidentifikasi potensi "sinyal", yang
didefinisikan sebagai efek samping yang serius yang sebelumnya tidak dikenal
atau tak dikenal.

Epidemiologidalam ODS adalahepidemiologimedis/klinisdenganMDs/


MPHs atau PhD. Epidemiologimedismembantudalam "sinyal"
pembangunandenganevaluasi. Potensilaporankasusefeksamping (data
numerator) danidentifikasifaktorrisiko /
pembaur.Epidemiologiseringdimintauntukmengukurdanmenggambarkanterkena
populasi (data
denominator).Epidemiologijugamengkritikstudiepidemiologiyang
dipublikasikandanmaupunyang tidakdipublikasikan,
danberpartisipasidalamdesaindanpengembanganprotokoluntukstudiepidemiologi
yang disampaikanolehperusahaanobat.

Elemenpentingdarisebuahlaporankasustermasukobatnama,
deskripsisingkatdariefeksamping, tanggalonset acara, mulaiobat / stop tanggal,
jikaberlaku, status pasiendasar (kondisikomorbiditas,
penggunaanbersamaanobat-obatan, adanyafaktorrisiko),
dosisdanfrekuensipemberian, laboratorium yang relevannilai di baseline
danselamaterapi, biopsi / laporanotopsi, demografipasien, mengulang-
penarikan(event meredaketikaobatdihentikan) danmengulang-penarikan (event
berulangbilaobat-restart), daninformasitentangpembaurobatataukondisi
dimanatersedia. Misalnya, dalamLaporanmenggambarkanhepatotoksisitas,
informasidasarstatus hatidaninformasitentangenzimhatimonitoring
akandianggappenting.

Jika "sinyal" yang mencatat, evaluator


keselamatandapatmencobauntukmenemukankasustambahandengan query
database AERS, melakukanpencarianliteratur, menghubungilembaga regulator
asinglangsung, ataumengumpulkankasusmelaluiKesehatanDuniaOrganisasi
(WHO) Uppsala Monitoring Centre di Swedia.
Jikalaporantersebutkurangdidokumentasikan, evaluator
keselamatanmungkinyaituhubungiwartawanatauprodusenuntuktindaklanjutinfor
masi.Definisikasusdapatdikembangkandalamkolaborasidenganseorangahliepide
miologidanmenyaringsepertikasusbarudiidentifikasi.Setelahserangkaiankasusdir
akit, evaluator keselamatanmungkinmencaritrenumum, faktorrisikopotensial,
atauitem pentinglainnya.Sementaraitu,
denganbantuanobatspesialispemanfaatandi ODS, penggunaannarkoba data
diperolehuntukobat yang relevanataukelasobatatauobat-
obatandalamkategoriterapi yang sama. datapenggunaanobat yang
digunakandalamberbagaicara,
termasukuntukmendapatkandemografiinformasitentangpendudukpeenggunapro
dukfarmasi, durasi rata-rata dandosisresepditiadakan, dankhususdaridokteryang
meresepkan. Data inimemungkinkan FDA untukmemeriksaberapa lama
pasiennon-rumahsakittetap di terapiobatresepdanbelajarkombinasiobat yang
mungkindiresepkanuntukhal yang samapasiensecarabersamaan. Data
inijugadigunakandalamasosiasidengan data AERS
untukmemahamikonteksdimanaADEsterjadi. Selainitu,
satuataulebihepidemiologidapatberkonsultasiuntukmenemukankejadianlatarbela
kanghasil yang merugikan yang
bersangkutandanuntukmemperkirakanpelaporantingkathasil yang merugikan,
danmembandingkannyadenganlatarbelakangtingkat di
manadilaporkanterjadidalampopulasiyang sama. Secarasederhana,
tingkatpelaporanadalahjumlah yang dilaporkankasusdarisuatuperistiwa yang
merugikankepentingandibagidenganbeberapaukuranpemanfaatantersangkaobat,
biasanyajumlahresepditiadakan.Secarabersamaan, ahliepidemiologidi ODS
dapatmenjelajahikelayakanmelakukanstudipharmacoepidemiologydalamsatuata
ulebihdatabase klaimresepdengancatatanmedis. FDA
telahmendanaipenelitiluarsekolahmelaluisistemperjanjiankerjasamaselamalebih
darisatudasawarsa.penelitiinimemilikiakseskepopulasi yang
besarberdasarkandatabase dan FDA
memanfaatkansumberdayamerekauntukmenjawabpertanyaankeamananobatdanu
ntukmempelajaridampakdarikeputusanperaturan.

Setelahkonfirmasidari "sinyal" FDA


dapatmelakukanberbagaitindakanregulasi, tingkatdanketelitian yang
tergantungpadakeseriusanefeksamping, ketersediaan, keamanan,
penerimaanterapialternatif,
danhasilnyaintervensiperaturansebelumnya.Intervensiperaturanuntukmengelolar
isikoinitermasukperubahan label sepertikotakperingatan,
penggunaanataudistribusiobat, namadibatasiatauperubahankemasan, sebuah
"Dear Health Care Professional" surat, atau, jarang,
mungkinpenarikanprodukmedisdaripasar (lihatTabel 9.3 danjuga Bab 33).

Waktuantaraidentifikasipertamarisikokeamanandanpelaksanaantindakanr
egulasidapatberlangsungbeberapabulanketahuntergantungpadasifatmasalahdand
ampakkesehatanmasyarakat.Misalnya,
beberapatahunberlaluantarasaatinteraksiobatberbahayadengancisapridedansejum
lahobat lain
diidentifikasidanketikaobatituakhirnyadihapusdaripasaruntukpenggunaanumum.
Demikian pula, gagalhati yang
parahdalamhubungandenganpenggunaantroglitazoneobatantidiabetestercatatbeb
erapabulansetelahpemasarantapibutuhbeberapatahunsebelumobattelahdihapusda
ripasar.Dalamcontohbaikcisapridedantroglitazone, berbagaiperaturanintervensi,
sepertiperubahanpelabelanulangdan “Dear Health Care Professional" surat,
yang diterapkanselamabertahun-
tahununtukmengelolarisikosebelumprodukinitelahdihapusdaripasar.
Intervensiperaturantidakmencapaiperbaikan yang
berartidalampencegahankontraindikasipenggunaannarkobaataudalampengujiane
nzimhati, masing-masing.

Untuk memberitahu profesional kesehatan keselamatan baru yang penting


Informasi ditemukan setelah pemasaran, FDA sering meminta agar produsen
mengirim surat kepada "Tenaga Kesehatan Profesional " memperingatkan
masalah keamanan. Hal ini dilakukan dalam kombinasi dengan label perubahan,
meskipun hanya sebagian kecil dari pelabelan Perubahan menghasilkan huruf
tersebut. Sering, perubahan pelabelan bisa disertai dengan penerbitan (juga
dikenal sebagai Talk Paper) atau kesehatan masyarakat penasehat. Selain itu,
para ilmuwan FDA mungkin menyebarkan informasi keamanan obat baru
melalui publikasi di journals38-65 profesional dan presentasi di pertemuan
profesional.

Ada 43 obat atau biologis surat/ pemberitahuan keamanan diposting pada tahun
2002 dan 36 pada tahun 2003. Pada tahun 2003, label yang terkait dengan
keselamatan telah disetujui oleh FDA untuk 20-45 produk obat setiap bulan.
"Tenaga Kesehatan Profesional" surat dan
pemberitahuan keselamatan lainnya, dan ringkasan keselamatan terkait
perubahan pelabelan disetujui setiap bulan, dapat ditemukan pada situs
MedWatch (www.fda.gov/medwatch/safety.htm). Tabel 9.4 daftar beberapa
contoh baru-baru ini "Tenaga Kesehatan Profesional".

FDA dapat berusaha untuk mengurangi atau membatasi penggunaan obat


produk melalui pelabelan jika reaksi yang merugikan terkait dengan obat ini
memiliki konsekuensi berat. Sebagai contoh, pelabelan untuk valdecoxib obat
arthritis / nyeri baru memiliki efek samping yang serius, termasuk mengancam
jiwa risiko yang berkaitan dengan kulit reaksi Stevens-Johnson Sindrom, dan
reaksi anafilaktoid. pelabelan sekarang menyarankan apabila orang-orang yang
menggunakan valdecoxib dan mengalami ruam untuk segera menghentikan obat
dan juga obat ini kontraindikasi pada pasien alergi terhadap produk yang
mengandung sulfa. Obat-baru ini telah dihapus dari pasar.

masalah keamanan obat juga dapat menyebabkan penghapusan obat dari pasar.
Untungnya, penarikan produk sangat jarang; hanya ada 22 obat yang diminum
dari pasar AS sejak tahun 1980; obat ditarik baru-baru ini tercantum dalam
Tabel 9.3.

Selain teknologi yang digunakan di samping saat ini pelaporan acara, termasuk
database relasional canggih dan koneksi jaringan untuk transfer elektronik, baru
metode untuk mengevaluasi dan menilai laporan spontan sedang dieksplorasi
untuk mengambil keuntungan dari volume tipis data. alat analisis agregat dan
data teknik pertambangan saat ini sedang dikembangkan oleh ODS, WHO, 66
dan lain-lain,
sistematis layar database besar laporan spontan.

Sejak tahun 1998, FDA telah dieksplorasi otomatis dan teknik cepat Bayesian
data mining untuk meningkatkan kemampuannya untuk memantau keamanan
obat, biologis, dan vaksin setelah mereka telah disetujui untuk use.67 Pada
bulan Mei 2003, FDA mengumumkan pembentukan Penelitian Koperativ
Perjanjian Pembangunan (CRADA) dengan perusahaan swasta pengembangan
perangkat lunak. CRADA diharapkan dapat meningkatkan keamanan utilitas
teknologi data mining. CDER FDA dan CBER akan bekerja dengan perusahaan
swasta ini untuk mengembangkan cara-cara baru dan inovatif untuk
mengekstraksi informasi yang berkaitan dengan keamanan obat dan penilaian
risiko. Untuk tujuan ini, sebuah perangkat lunak pertambangan data desktop,
disebut WebVDME, telah dikembangkan dan saat ini sedang berpilot.

Data mining adalah teknik untuk mengekstraksi bermakna, Informasi yang


diselenggarakan dari database kompleks besar. Di data mining strategi adalah
dengan menggunakan komputer untuk mengidentifikasi sinyal potensial dalam
database besar yang mungkin diabaikan, untuk berbagai alasan, di review
pengguna pada kasus-per kasus. Sinyal obat-AE yang dihasilkan oleh
membandingkan frekuensi laporan dengan apa yang akan diharapkan jika
semua obat dan AE diasumsikan untuk mengikuti pola-pola tertentu. Tujuannya
adalah untuk membedakan lebih sinyal penting atau kuat untuk memfasilitasi
identifikasi kombinasi obat dan peristiwa yang menjamin lebih mendalam. Data
mining adalah alat paling cocok untuk generasi sinyal mungkin dan tidak dapat
mengganti atau menimpa
tangan-on teliti review oleh evaluator keselamatan. Lebih lanjut, apakah
memiliki keuntungan apapun atas ulasan tangan,

PELAPORAN SPONTAN DI AMERIKA SERIKAT

Tabel 9.4. Baru-baru ini FDA MedWatch peringatan keamanan / "Tenaga


Kesehatan Profesional" huruf, 2003

Obat Penjelasan
Topamax® (topiramate) Revisi tersebut PERINGATAN dan
PENCEGAHAN untuk memberitahu
para profesional perawatan kesehatan
bahwa Topamax menyebabkan
hiperkloremik, non-anion gap asidosis
metabolik (Penurunan bikarbonat
serum). Pengukuran dasar dan serum
periodik bikarbonat selama pengobatan
topiramate dianjurkan.
Permax® (pergolide mesylate) Revisi PERINGATAN dan
PENCEGAHAN bagian untuk
menginformasikan perawatan
kesehatan
profesional dari kemungkinan pasien
tertidur saat melakukan setiap hari
kegiatan, termasuk operasi kendaraan
bermotor, saat menerima pengobatan
dengan Permax®. Banyak pasien yang
telah meninggal telah dirasakan tidak
ada peringatan dari sifat tidur.
Arava® (leflunomide) Dalam pengalaman postmarketing di
seluruh dunia, langka, kerusakan hati
yang serius, termasuk kasus dengan
hasil yang fatal, telah dilaporkan
selama pengobatan dengan Arava.
Kebanyakan kasus terjadi dalam 6
bulan terapi dan dalam pengaturan dari
beberapa risiko faktor untuk
hepatotoksisitas.
Viread® (tenofovir disoproxil Diberitahu profesional perawatan
fumarat) kesehatan dari tingginya tingkat
kegagalan virologi awal dan
munculnya resistensi reverse
transcriptase inhibitor nucleoside
mutasi terkait dalam sebuah studi
klinis yang terinfeksi HIV yang naif
pengobatan pasien yang menerima
rejimen tiga ddI, lamivudine dan
tenofovir fumarat disoproxil.
Lariam® (mefloquine hidroklorida) Diberitahu profesional perawatan
kesehatan Panduan Pengobatan Lariam
dikembangkan di Bekerja sama dengan
FDA untuk membantu wisatawan lebih
memahami risiko malaria, risiko dan
manfaat yang terkait dengan
mengambil Lariam untuk mencegah
malaria, dan efek samping yang serius
kejiwaan terkait dengan menggunakan
obat.
Prandin® (repaglinide) Revisi yang PENCEGAHAN / Obat
bagian Interaksi untuk
menginformasikan perawatan
kesehatan
profesional dari interaksi obat-obat
antara repaglinida dan gemfibrozil.
Penggunaan bersamaan dapat
mengakibatkan ditingkatkan dan
berkepanjangan darah penurun glukosa
efek repaglinide.
Serevent Inhalasi Aerosol® label baru mencakup peringatan kotak
(Salmeterol ksinafoat) tentang kecil, tapi signifikan,
peningkatan risiko episode asma yang
mengancam jiwa atau kematian terkait
asma diamati pada pasien yang
memakai salmeterol di US besar baru
selesai studi keselamatan.
Ziagen® (abacavir) tingkat tinggi dari awal virologi non-
respon yang diamati dalam studi klinis
orang dewasa terapi-naif dengan
infeksi HIV menerima sekali sehari
tiga obat Terapi kombinasi dengan
lamivudine (Epivir, GSK), abacavir
(Ziagen, GSK), dan tenofovir (TDF,
Gilead Sciences).
Genotropin® (somatropin [rDNA Kematian telah dilaporkan dengan
asal] untuk injeksi) penggunaan hormon pertumbuhan di
pediatrik pasien dengan sindrom
Prader-Willi dengan satu atau lebih
dari risiko berikut faktor: obesitas
berat, riwayat gangguan pernapasan
atau sleep apnea, atau
ISPA tak dikenal.
Topamax® (topiramate) tablet / Oligohidrosis (menurun berkeringat)
kapsul taburi dan hipertermia telah dilaporkan di
pasien topiramate-diobati.
Oligohidrosis dan hipertermia
mungkin memiliki berpotensi gejala
sisa yang serius, yang dapat dicegah
dengan cepat pengenalan gejala dan
pengobatan yang tepat.
Risperdal® (risperidone) Cerebrovascular efek samping
(misalnya, stroke, serangan iskemik
transient), termasuk korban jiwa,
dilaporkan pada pasien dalam uji coba
dari risperidone pada pasien usia lanjut
dengan demensia terkait psikosis.
Avonex® (Interferon beta-1a) laporan pascapemasaran depresi,
ideation dan / atau pengembangan
bunuh diri baru atau memburuk
gangguan kejiwaan yang sudah ada,
termasuk psikosis, dan laporan dari
anafilaksis, pansitopenia,
trombositopenia, gangguan autoimun
dari beberapa organ sasaran, dan
kerusakan hati.

dan sejauh mana itu menghasilkan sinyal palsu, tetap untuk dievaluasi.

KEKUATAN

SKALA BESAR DAN BIAYA-EFEKTIF


Dua keuntungan penting dari sistem surveilans berdasarkan laporan langsung
adalah bahwa mereka berpotensi mempertahankan surveilans berkelanjutan dari
semua pasien, dan relatif inexpensive.68
sistem laporan langsung adalah metode yang paling umum digunakan dalam
pharmacovigilance untuk menghasilkan sinyal baru pada Efek samping yang
tidak ditemukan selama trials klinis.69

GENERASI HIPOTESIS DAN SINYAL


Membuat penggunaan terbaik dari data yang diperoleh melalui pemantauan
yang mendasari dari surveillance.70 tujuan untuk menuju postmarketing itu,
utilitas laporan besar langsung terletak di hipotesis generasi, 71 kebutuhan
untuk mengeksplorasi kemungkinan untuk menjelaskan efek samping yang
bersangkutan. dengan mengangkat kecurigaan, 72 program surveilans berbasis
laporan langsung melakukan fungsi penting, yaitu untuk menghasilkan sinyal
masalah potensial yang menjamin penyelidikan lebih lanjut. Penilaian hubungan
produk medis-merugikan untuk laporan tertentu atau serangkaian laporan yang
cukup sulit. Tabel 9.5 daftar faktor yang membantu dalam mengevaluasi
kekuatan hubungan antara obat dan event.73 dilaporkan semakin kuat dapat
merugikan hubungan obat-event dalam setiap kasus dan semakin rendah
kejadian efek samping yang terjadi secara langsung, laporan kasus sedikit
diperlukan untuk memahami causality.74 Telah ditemukan bahwa untuk
peristiwa langka, kebetulan asosiasi obat-event sangat tidak mungkin bahwa
mereka pantas mendapatkan sedikit perhatian, dengan lebih dari tiga laporan
membutuhkan study sinyal.75 Bahkan, telah menyarankan bahwa hubungan
temporal antara produk medis yang merugikan ditambah dengan positif de-
tantangan dan re-tantangan,

Tabel 9.5. Faktor yang dilaporkan berguna untuk menilai hubungan kausal
antara obat dan efek samping

 Kronologi administrasi agen, termasuk awal dan berakhir pengobatan


dan merugikan secara onset
 Kursus peristiwa buruk ketika diduga agen berhenti
(De-tantangan) atau terus
 peran etiologi agen dan penyakit dalam hal efek samping
 Respon untuk readministration (re-tantangan) agen
 Hasil uji laboratorium
 Toksisitas yang dikenal agen

kadang-kadang bisa membuat laporan terisolasi konklusif untuk produk-


association.76 masuk akal jika Biologi dan Kekuatan dapat bantuan asosiasi di
deeming setiap asosiasi sebagai causal77 (lihat juga Bab 36). Namun, mencapai
bukti tertentu kausalitas merugikan tidak biasa. Konfirmasi dari hubungan
antara obat dan reaksi yang merugikan biasanya membutuhkan studies.78
tambahan lebih lanjut untuk Meraih terkemuka tingkat kecurigaan jauh lebih
mungkin, tapi masih mungkin dianggap sebagai dasar yang memadai untuk
peraturan decisions.74

PELUANG KONTRIBUSI BAGI DOKTER


Ketergantungan sistem surveilans postmarketing di pelaporan kesehatan
profesional memungkinkan individu untuk membantu meningkatkan kesehatan
masyarakat. Hal ini ditunjukkan oleh satu studi yang ditemukan partisipasi
praktisi langsung di FDA sistem pelaporan adalah sumber yang paling efektif.
laporan ADR baru yang menyebabkan perubahan labeling.76 Memastikan
bahwa informasi yang diberikan mengenai efek samping yaitu selengkap dan
semendalam mungkin untuk lebih meningkatkan postmarketing
pengawasan. Jadi, sementara memiliki melekat keterbatasan, postmarketing
pengawasan berdasarkandari laporan langsung yaitu alat yang ampuh untuk
mendeteksi peristiwa buruk
dan sinyal dari dampak klinis langsung.

KELEMAHAN
Ada keterbatasan penting untuk dipertimbangkan saat menggunakan informasi
laporang yang langsung. peristiwa yang merugikan Ini termasuk keterbatasan
dengan pengakuan yang merugikan, tidak dilaporkan, bias, estimasi paparan
populasi, dan kualitas dalam melaporkan.

MEMBURUK EVENT PENGAKUAN


Atribusi AE (atau productassociated efek samping medis lainnya) mungkin
cukup subjektif dan imprecise.79 Sementara atribusi dari hubungan antara
produk medis dan acara diamati diasumsikan oleh wartawan dengan semua
peristiwa yang dilaporkan langsung, setiap upaya dilakukan untuk
menyingkirkan penjelasan lain untuk acara di pertanyaan. Hal ini juga diketahui
placebos80 itu dan bahkan tidak ada treatment81 dapat dikaitkan dengan efek
samping. Sebagai tambahan, hampir selalu ada tingkat latar belakang yang
mendasari setiap peristiwa klinis dalam suatu populasi, terlepas dari apakah ada
paparan produk medis.

Dalam Mencapai kesimpulan tegas tentang hubungan antara paparan produk


medis dan terjadinya
dari suatu peristiwa sulit yang merugikan. Dalam satu penelitian, klinis farmasi
dan dokter yang merawat menunjukkan Perjanjian lebih kurang dari setengah
waktu saat menentukan apakah obat-obatan, alkohol atau penggunaan narkoba
"rekreasi" telah menyebabkan hospitalization.82 pertimbangan tersebut
menekankan kebutuhan penting, laporan efek samping pada sejak diterima oleh
FDA atau produsen. Ini adalah melalui Proses inilah yang kausalitas, atau
setidaknya tingkat tinggi kecurigaan untuk asosiasi acara produk-merugikan,
dimasukkan ke tes (lihat juga Bab 36). Pada akhirnya, pharmacoepidemiology
study resmi biasanya diperlukan untuk memperkuat hubungan yang diamati

PENGURANGAN PELAPORAN

Perhatian utama lain dengan pelaporan spontan sistem underreporting


dari events. Jumlah kerugian tidak underreporting tidak diketahui dan dapat
dipengaruhi oleh keparahan acara, kekhususan dari pelapor, berapa lama obat
telah di pasar, apakah acara tersebut diberi label, dan apakah obat itu resep atau
non-prescription. Telah diperkirakan bahwa jarang lebih dari 10% dari ADRs,
dan 2-4% dari reaksi non-serius, dilaporkan ke Inggris pelaporan spontan
program. Perkiraan serupa adalah bahwa FDA menerima laporan langsung
kurang dari 1% dari yang diduga ADRs. Ini berarti bahwa kasus spontan
dilaporkan untuk setiap program pengawasan, yang terdiri pembilang,
umumnya hanya mewakili sebagian kecil dari jumlah yang telah benar-benar
terjadi. Dampak dari tidak dilaporkan bisa akan agak berkurang jika laporan
yang disampaikan, terlepas dari jumlah, yang berkualitas tinggi.

BIASES

Perhatian utama lain dengan pelaporan spontan sistem underreporting


efek samping. Ini termasuk lamanya waktu produk telah di pasar, ukuran detail
sponsor , kekuatan, populasi sasaran, kesadaran penyedia layanan kesehatan,
kualitas data, dan publisitas effects.
Selain itu, telah diamati bahwa spontan pelaporan efek samping untuk
obat cenderung naik pada puncak di akhir tahun kedua dari pemasaran dan
penurunan pelaporan setehnya (efek Weber) .
Selain bias-bias ini, terdapat mungkin bahwa pelaporan kasus mungkin
berbeda dari kasus nonreported dalam karakteristik seperti waktu untuk
timbulnya atau severity.

ESTIMASI POPULASI SAMBUNGAN


Penggabungan keterbatasan ini adalah kurangnya denominator data,
seperti populasi pengguna dan paparan pola obat, yang akan membantu
memprkirakan jumlah pasien yang terkena produk medis, dan yang berisiko
untuk terkena efek samping yang menarik. Pembilang dan penyebut
keterbatasan membuat tingkat insiden dihitung dari spontan data yang
dilaporkan bermasalah, jika tidak benar-benar tak berdasar. Namun, bahkan
jika populasi pasien terkena tidak
diketahui secara tepat, estimasi paparan dapat dicoba melalui penggunaan
pemanfaatan data obat.
Pendekatan ini, yang berdasarkan metodologi yang berlaku untuk produk
medis secara umum, dapat berguna. Sumber utama data tentang penggunaan
obat didefinisikan populasi mencakup survei pasar berdasarkan penjualan atau
data resep, pembayar pihak ketiga atau pemeliharaan kesehatan organisasi,
pengaturan kelembagaan / rawat jalan, atau khusus
perjanjian Koperasi pharmacoepidemiology studies, dan kontrak dengan peneliti
luar memungkinkan FDA untuk menggunakan database seperti dalam
penyelidikan (lihat Bagian IIIb). Perawatan harus diambil dalam menafsirkan
hasil dari studi menggunakan database ini. Resep obat itu belum tentu
penggunaannya sama, dan penerapannya. Hasil yang diperoleh dari populasi
tertentu (seperti Medicaid penerima) dengan populasi pada umumnya, perlu
dipertimbangkan hati-hati.

KUALITAS LAPORAN
Kemampuan untuk menilai, menganalisis, dan bertindak atas isu-isu
keselamatan
berdasarkan pelaporan spontan tergantung pada kualitas dari informasi yang
disampaikan oleh petugas kesehatan pada saat pelaporan. Sebuah laporan efek
samping lengkap yang dilaporkan pada sebuah acara harus mencakup:
• Nama produk (dan informasi seperti model dan serial nomor dalam kasus alat
kesehatan);
• Data demografi;
• Deskripsi klinis ringkas dari peristiwa yang merugikan, termasuk konfirmasi /
hasil uji / laboratorium yang relevan;
 Faktor pembaur seperti produk medis bersamaan dan riwayat kesehatan;
• Informasi temporal, termasuk tanggal acara onset dan mulai / berhenti tanggal
untuk penggunaan produk medis;
• dosis / frekuensi penggunaan;
• Biopsi / hasil otopsi;
• de-tantangan / re-tantangan informasi;
• hasil.

RINGKASAN

Keterbatasan utama dari sistem pelaporan FDA AE mencerminkan fakta


bahwa data yang dihasilkan dalam terkendali dan cara yang tidak lengkap.
Meskipun produsen secara hokum diminta untuk menyerahkan AE melapor
kepada FDA dan beberapa dari mereka melaporkan didasarkan pada studi
formal, mayoritas AE berasal dengan dokter yang masih berlatih yang mungkin
atau tidak mungkin memberitahukan produsen atau FDA ketika mereka
mengamati AE di salah satu pasien mereka. Tampaknya bahwa mereka
umumnya melakukan tidak memilih untuk melaporkan AE, dan jumlah laporan
bahwa FDA menerima tidak mewakili tingkat yang merugikan peristiwa yang
terjadi di Amerika Serikat. Jumlah laporan dalam sistem juga dipengaruhi oleh
berbagai factor lainnya, seperti tingkat dan kualitas produsen individu pasca
pemasaran kegiatan surveilans, lingkungan acara, jenis obat, lamanya waktu
telah dipasarkan, dan publisitas di media awam atau profesional. Karena
keterbatasan ini, laporan AE terutama berguna untuk hipotesis menghasilkan,
daripada pengujian hipotesis. Ironisnya, sifat tidak terkendali ilmiah dari AE
pelaporan menciptakan keuntungan-kemampuan terbesar untuk mendeteksi dan
mengkarakterisasi AE terjadi di berbagai praktek-sebagai medis serta
keterbatasan yang paling serius.

APLIKASI TERTENTU
SECARA KESELURUHAN

FDA AERS mempunyai hampir 3 juta laporan, dengan awal dating


kembali ke 1969. Sementara tingkat pelaporan tetap cukup konstan selama
tahun 1970-sekitar 18 000 laporan yang dimasukkan ke dalam database pada
tahun 1970, dan sedikit lebih dari 14 000 laporan ditambahkan pada tahun
1980-pelaporan meningkat secara dramatis setelah tahun 1992, seperti dapat
dilihat pada Gambar 9.4. Pada tahun 1992, jumlah tahunan laporan meningkat
menjadi 120 000, dan pada tahun 2003 adalah lebih dari 370 000. Empat puluh
persen dari laporan ini serius dan tak terduga (yaitu, 15-hari).
Sebagaimana dicatat sebelumnya, AERS berisi laporan dari berbagai
sumber. Laporan mungkin dari Amerika Serikat atau negara lain. AE yang
diduga mungkin telah diamati dalam praktek yang biasa kedokteran atau selama
studi formal; laporan kasus dari literatur juga termasuk. Laporan datang ke FDA
baik secara langsung dari profesional kesehatan atau konsumen, atau dari
farmasi produsen. Sebagian besar (lebih dari 90%) dari samping laporan event
obat diterima oleh FDA melalui produsen, dengan sisanya yang diterima
langsung dari kesehatan profesional perawatan atau konsumen.
Pada tahun 2003, dari semua laporan sukarela dikirim langsung ke FDA,
68% yang terlibat obat-obatan, peralatan medis 14%, 12% kualitas obat
masalah, 3% biologis, dan 3% suplemen makanan. Itu sumber adalah: 59% dari
apoteker, 15% dari dokter, 9% dari perawat, dan 6% dari para profesional non-
kesehatan (Dengan sumber 11% tidak diberikan).
Contoh Spesifik

Temafloxacin (Omniflox®): Ditarik dari pasaran.

Antibiotic oral ini pertama kali dipasarkan pada bulan Februari 1922. Selama
tiga bulan pertama penggunaan, FDA telah menerima kira-kira 50 laporan
situasi buruk yang serius, termasuk tiga kematian. Peristiwa tersebut termasuk
hipologikemia pada pasien lanjut usia yang sama dengan hubungan dari multi
system organ kesamaan karakteristik yang ditandai dengan anemia hemolitik,
acapkali berhubungan dengan gagal ginjal, ditandai dengan tes fungsi hati yang
abnormal, dan koagulopati. Ketika obat ini diakui oleh FDA, temafloxacin telah
digunakan di Argentina, Jerman, Italia, Irlandia, Swiss, dan Eropa. Akantetapi
pengalaman FDA dengan obat ini menunjukkan betapa pentingnya pengawasan
posmarketing dan laporan kejadian buruk secara berkala. Setelah lebih dahulu
disetujui oleh FDA, sedikitnya lebih dari 4000 pasien yang diberi obat pada saat
percobaan klinik, dan bahwasanya temafoxacin telah dipertimbangkan memiliki
profil efek samping yang sama denga antibiotic quinolon lain. Pada saat tiga
bulan pertama dari pemasaran secara komersial, sudah ada ribuan pasien yang
menggunakan obat ini. Tidak lama setelah melalui pengalaman klinik yang
lebih luas timbul efek samping yang serius seperti yang dijelaskan di atas
menjadi jelas. Kurang dari empat bulan setelah pemasaran, obat tersebut ditarik
kembali.

Linezolid (Zyvox®): Serius, ADR Tanpa Label Ditandai Tidak Lama Setelah
Persetujuan

Linezolid (Zyvox®), antibacterial sintetik dari kelas oxazolidinon, telah


disetujui penggunaannya pada April 2000. Diindikasikan untuk perawatan pada
pasien dewasa yang terinfeksi yang disebabkan mikroorganisme: resisten
vankomisin Enterococcus faecium, termasuk kasus bakteremia yang terjadi
secara bersamaan; nosocomial pneumonia; komplikasi dan unkomplikasi kulit
dan infeksi struktur kulit; dan hal lain yang disebabkan oleh pneumonia,
Termasuk kasus bakteremia yang terjadi bersamaan.
Pada saat persetujuan, data keamanan sangat terbatas, berdasarkan
kegunaannya pada percobaan klinik terkontrol. Kejadian buruk yang paling
serius tercatat pada saat pelabelan inisial produk tertulis trombositopenia,
disebutkan di bagian tindak pencegahan dan Laboratory Changes subsection
dari seksi reaksi yang merugikan.
Seperti yang dilaporkan oleh seksi Farmakologi Hewan dari pelabelan
produk, linezoid menyeabkan dose dan timedependent myelosuppression,
berdasarkan fakta dari hiposelulariti sumsum tulang, mengurangi hematopiesis,
dan menurunkan tingkat sirkulasi eritrosis, leukosit, dan platelet pada hewan.
Selama enam bulan pertama saat produk berada di pasaran empat kasus
red cell aplasia berhubungan dengan penggunaan produk telah diterima oleh
FDA. Selain itu, enam kasus lain yang dipengaruhi oleh myelosuppression telah
disampaikan, bersamaan dengan dua kasus dari anemia sideroblastic.
Dengan meningkatnya angka kasus yang diterima oleh FDA, dilakukan
sebuah review mendalam dari masalah tersebut. AERS mencari laporan
toksisitas hematologi yang berhubungan dengan linezolid dan total dari 27
laporan yang didapat pada 20 September 2000. Laporan tersebut di review
apabila ditemukan hal apapun yang mungkin menjadi awal dari suggestive of
myelosuppression tetapi tidak dilaporkan sebagaimana mestinya (seperti
penurunan jumlah darah putih, hemoglobin dan hematokrit, dan platelet). Selain
itu pada kasus empat red cell aplasia, enam kasus tambahan suggestive of
myelosuppression telah di identifikasi:

 Penerima transplantasi sumsum tulang belakang yang tertunda


pemasangannya telah di pikirkan bahwa dia berhak untuk diberikan
linezolid myelosuppression.
 Tiga laporan kasus rutin dari jumlah darah lengkap (CBC), menyatakan
penurunan sel darah putih (WBC), hemoglobin dan hematokrit, dan
platelet. Komunikasi perorang dengan pelapor ketiga kasus tersebut tidak
ditemukan lebih lanjut info terkait seperti biopsy sumsum tulang
belakang, bahkan tidak ada pergerakan menuju ke tingkat penyakt yang
lebih serius
 Dua kasus yang diterima atas laporan langsung; yang satu dideskripsikan
sebagai supresi sumsum tulang belakang dan trombositopenia pada
wanita berusia 65 tahun dan yang lain sebagai pancytopenia pada wanita
51 tahun.

Karena cepatnya pada saat kasus-kasus tersebut di laporkan ke FDA linezolid


berada di pasaran dalam waktu singkat, dan estimasi yang relative kecil dari
angka bagian penjualan terapi penjualan, FDA dan pabrikan setuju berdasarkan
pada jumlah peringatan yang mencolok untuk di masukkan kedalam pelabelan
yang berkenaan dengan perkembangan dari myelosuppression. Perubahan
dibuat untuk seksi Peringatan dan Tindak Pencegahan yang direkomenasikan
pada clinicians adalah:

Myelosuppression (termasuk anemia, leucopenia, pancytonia, dan


trombositopenia) telah dilaporkan pada pasien yang menerima linezolid.
Pada kasus dimana akibatnya telah diketahui, ketka linezolid tidak
dilanjutkan, parameter hematologi yang terpengaruh mengalami kenaikan
menuju tingkat pretreatment. Jumlah darah lengkap pasien yang menerima
linezolid harus di control setiap minggu terutama pada pasien yang diberi
linezolid lebih dari dua minggu, pasien dengan pre-existing
myelosuppression, mereka yang menerima obat yang mmemproduksi
supresi tulang belakang secara bersamaan, atau mereka dengan infeksi
kronik yang menerima terapi antibiotic yang bersamaan atau berulang.
pemberhentian terapi linezolid harus mempertimbangkan kondisi pasien
yang membaik atau memperburuk myelosuppression.

Valproic Acid (Depakote®): Meningkatnya keparahan berlabel ADR tercatat


setelah beberapa tahun penggunaan

Produk valproic acid, termasuk Depakote®, Depakene®, dan Depacon®,


telah digunakan di bidang klinikal care sejak diresmikan FDA pad tahun 1978.
Walaupun pancreatitis berada di urutan pertama pada kemasan di dalam produk
valproat pada tahun 1981, sama dengan sebagian besar obat, keamanan data
yang terbatas untuk produk ini pada waktu diresmikan. Pada percobaan klinis,
tersebutkan 2 kasus pancreatitis tanpa elternatif etiologi pada 2416 pasien,
mewakili 1044 pengalaman pasien.
Asalnya, obat-obatan tersebut diindikasikan untuk penggunaan yang
terbatas dan pada populasi yang terbatas. Selama lebih dari 20 tahun, produk ini
digunakan secara lebih luas baik untuk indikasi on-label dan off-label,
dan populasi yang terekspos oleh obat tersebut termasuk populasi yang lebih
luas daripada ketika sebelum persiapan percobaan klinik. Dengan kenaikan
jumlah penggunaan ini, FDA menerima sejumlah laporan sukarela melalui
MedWatch system yang melaporkan secara spontan bentuk yang lebih hebat
dari pancreatitis, sering kali hemorrhagic, sesuatu yang fatal, dengan jumlah
kasus yang terjadi pada bayi dan remaja. Meskipun ADR, pancreatitis, sudah
“berlabel” atau terkenal, kenaikan jumlah kondisi yang mendorong ODS staf
pengawasan post-pemasaran dan divisi refiew untuk memulai sebuah investigasi
epidemiologi dan perkembangan dari case series. Evaluasi ini menunjukkan
nilai berdasarkan kasus yang dilaporkan melewati dugaan pada populasi pada
umumnya dan adanya kasus yang mana pancreatitis terulang setelah diberikan
valproate kembali. Dengan persetujuan dari pabrikan, FDA mengakui label
keamanan yang baru dengan perubahan pada seksi Peringatan dan Tindak
Pencegahan dan memodifikasi peringatan kotak hitam untuk menginformasikan
clinicians dan pasiennya :

Pancreatitis : sebuah kasus ancaman hidup, pancreatitis telah dilaporkan


terjadi pada anak-anak maupun orang dewasa yang menerima valproate.
Beberapa kasus telah di deskripsikan sebagai hemorrhagic dengan proses
yang cepat dari gejala awal menuju kematian. Kasus yang telah dilaporka
tidak lama setelah penggunaan awal sama dengan pengunaan beberapa
tahun. Pasien dan penjaga harus di peringatkan bahwa sakit pada bagian
perut, nausea, muntah, dan/atau anorexia bisa jadi merupakan gejala dari
pancreatitis yang membutuhkan evaluasi medis yang cepat. Jika telah di
diagnose pancreatitis, penggunaan valproate sebaiknya tidak dilanjutkan.
Pengobatan alternative berdasarkan kondisi medis harus lakukan sebagai
indikasi klinis (lihat peringatan dan tindak pencegahan).

Masa depan

Pengumpulan sistematis dan evaluasi pascapemasaran Dari laporan ADR


yang resmi oleh FDA telah menempuh Jarak jauh sejak awal sekitar 50 tahun
yang lalu. Mei, tahun 1999 laporan kepada Komisaris FDA manajement Risiko
dari penggunaan Produk medis: Membuat kerangka Manajemen Risiko
menemukan bahwa Program pengawasan pasca pemasaran saat ini di tempat
dilaksanakan dengan baik atas tujuan yang dirancang untuk mencapai-deteksi
cepat tak terduga. Namun, harus diingat bahwa pelaporan spontan, meskipun
tak ternilai, hanya satu alat yang digunakan dalam mengelola risiko produk
medis. Laporan ini mengakui bahwa program FDA tidak dirancang untuk
mengevaluasi tingkat, atau dampak, dari efek samping yang diketahui. Laporan
ini mengusulkan beberapa pilihan untuk meningkatkan resiko manajemen,
termasukmemperluas sistem penggunaan otomatis untuk pelaporan, monitoring,
dan evaluasi AE, dan meningkatkan akses agensi ke sumber data yang akan
melengkapi dan memperpanjang pelaporan spontanitas sistem. Hal ini dapat
mencakup penggunaan Database medis skala besar dari organisasi pemeliharaan
kesehatan untuk memperkuat, dukungan, dan meningkatkan sinyal spontanitas
dan memberikan tingkat latar belakang dan epidemiologi deskriptif.

Sejak laporan tahun 1999, FDA telah melanjutkan untuk bekerja dengan
akademisi dan industri untuk mengatasi rekomendasi tersebut. Dalam
pengakuan pentingnya peningkatan pengawasan pasca pemasaran dan penilaian
risiko dalam pengaturan regulasi, dengan berbagai inisiatif yang berlangsung
dalam FDA. Pada tahun 2002, ODS diciptakan dalamCDER, dengan tiga divisi
yang berfokus pada peningkatanidentifikasi dan evaluasi epidemiologi dari
ADRs,evaluasi kesalahan pengobatan, dan penelitian lebih lanjutdan
pelaksanaan kegiatan komunikasi risikodiarahkan baik profesional perawatan
kesehatan danpasien. Reauthorization terbaru dari Resep yangPengguna
narkoba Gratis Act (PDUFA) pada tahun 2002 akan, untuk pertamawaktu,
memungkinkan FDA untuk menerapkan dana biaya pengguna untuk kegiatan
agensi pasca pemasaran . Dalam mengantisipasi ini diperluas upaya FDA telah
menerbitkan beberapa pedoman dokumen evaluasi resiko pasca pemasaran,
komunikasi risiko,dan manajemen risiko (lihat www.fda.gov/bbs / topik / berita
/ 2004 / NEW01059.html).

Pada tahun 2003, ODS memulai proses formal, proses kompetitif


langsung akses ke longitudinal,tingkatan pasien, elektronik data rekam medis
yang dapat digunakan untuk mempelajari ADRs.Akuisisi sumber daya ini akan
langsung meningkatkan kemampuan ODS untuk mencapai salah satu tujuan
strategis FDA, yaitu,meningkatkan pasien dan keselamatan konsumen. Selain
itu, secara online akses ke sumber daya data ini akan memungkinkan ODS
untuk melakukan Studi keamanan obat dalam pengaturan berbasis populasi
yang besar.

Upaya FDA saat ini dan masa depan adalah sebagai


berikut:meningkatkan kualitas laporan yang masuk dari efek samping dengan
fokus pada pembuatan AERS yang lebih efisien; membangun standar pelaporan
global; mempromosikan kecepatan pelaporan dan penilaian melalui pelaporan
elektronik; menjelajahi penilaian yang baru dan data visualisasi metodologi;
dan,terakhir, menjelajahi alat luar pelaporan spontanitas. inisiatif terakhir
melibatkan identifikasi dan penilaian terkait database dan pendaftar yang dapat
diakses untukmemperluas pengawasan, memberikan bukti konfirmasi sinyal
atas, menilai dampak regulasi perubahan pelabelan melalui studi, dan, secara
umum, membangun kekuatan yang diketahui generasi pelaporan-sinyal
spontanitas peristiwa potensial yang penting.

Selain itu, ODS akan menyempurnakan teknik saat ini untukmenilai


risiko obat melalui pengembangan dan evaluasiprogram manajemen risiko.
Kami akan terus mempertimbangkanalat komunikasi risiko yang tepat untuk
Informasi yang jelas tentang keamanan obat untuk kedua profesional kesehatan
yang mengartikulasikan dan pasien pada waktu yang tepat. Tujuan kami untuk
3-5 tahun termasuk rencana untuk mengembangkan dan membangun"Praktik
terbaik" untuk rencana manajemen risiko dan untuk mengembangkan
pendekatan kuantitatif untuk meninjau pasca pemasaran data keamanan.

Singkatnya, pelaporan spontan AE memberikan landasan penting bagi


pharmacovigilance di AS. Regulator dan produsen produk medis di seluruh
dunia bergerak maju "transmisi pesan keselamatan tunggal" dengan harmonisasi
global untuk standar data dan transmisi data, perbaikan dalam sistem database
relasional, yang pengembangan metodologi penilaian risiko baru, dan
peningkatan akses ke sumber daya data lainnya, termasuk komputerisasi catatan
medis, untuk meningkatkan kemampuan kita secara keseluruhan untuk
mengelola risiko dari obat-obatan.
Obat Global Surveillance : WHO
Program untuk Pengawasan Obat International
I. RALPH EDWARDS, STEN OLSSON, MARIE LINDQUIST and BRUCE
HUGMAN
WHO Collaborating Centre for International Drug Monitoring (Uppsala
Monitoring Centre), Uppsala, Sweden.

Pendahuluan

Secara umum kesadaran saja dapat membawa menggunakan obat


terlarang masalah yang tidak terduga tersebut dipicu oleh sebuah surat kepada
editor dari lancet diterbitkan pada 16 desember 1961. surat sejarah baris lima
belas , dr mcbride dari australia melaporkan bahwa Dr McBride dari Australia
melaporkan bahwa ia telah mencatat peningkatan frekuensi malformasi
ekstremitas pada bayi , dan bahwa umum denominator tampaknya asupan
hipnotis baru obat - thalidomide - oleh ibu mereka.
Dalam bangun dari bencana kesehatan masyarakat, pemerintah di
banyak negara mengatur prosedur untuk pengumpulan informasi tentang
dicurigai reaksi obat yang merugikan (ADR). sistem ini didasarkan pada
pelaporan spontan diduga ADR oleh dokter . Mereka pertama kali
diselenggarakan di Australia , Kanada ,Cekoslowakia , Irlandia , Belanda ,
Selandia Baru ,Swedia , Inggris , Amerika Serikat , dan Jerman Barat . Mereka
dimulai antara tahun 1961 dan 1965. Sistem serupa sekarang beroperasi di lebih
dari 70 negara . Banyak prinsip yang masih penting dalam pharmacovigilance
adalah dijabarkan dalam ini masa awal,terutama oleh finney.
Pada tahun 1968, sepuluh negara dari Australasia, Eropa, dan
Amerika Utara setuju untuk kolam semua laporan yang telah dikirim ke pusat
pemantauan nasional mereka dalam WHOsponsored proyek pemantauan
narkoba internasional. Tujuan adalah untuk mengidentifikasi reaksi bahkan
sangat jarang namun serius sedini mungkin. Skema ini didirikan di kantor pusat
WHO
di Jenewa pada tahun 1970. Operasional hubungan ekonomi dan tanggung
jawab dipindahkan dengan swedia pada tahun 1978 dengan pembentukan who
kolaborasi centre for international obat pemantauan di ( sekarang dikenal
sebagai kepulauan uppsala pemantauan uppsala pusat , umc ) formal tanggung
jawab dan koordinasi program. Namun, tetap dengan kantor pusat WHO. Hari
ini, 73 negara berpartisipasi dalam program ini sebagai anggota penuh dan 12
lebih lanjut sebagai anggota asosiasi (Gambar 10.1), setiap tahun berkontribusi
sekitar 200 000 laporan ADR dicurigai ke database WHO di Uppsala. database
ini memegang hampir tiga juta laporan kasus sampai saat ini. Ada pedoman
mencakup semua aspek pelaporan, dan default adalah aktif ditindaklanjuti.
pusat nasional harus melaporkan pada frekuensi bulanan minimum, dengan
laporan awal jika rincian lengkap dan evaluasi tidak lengkap. Data yang,
bagaimanapun, heterogen dan tunduk pada semua jenis pengaruh, dan program
WHO telah menyepakati peringatan berikut untuk digunakan oleh semua orang
yang menghasilkan analisis berdasarkan data:
“interpretasi data efek samping , dan khususnya yang didasarkan pada
perbandingan antara farmasi produk , mungkin menyesatkan . Informasi
ditabulasikan di cetakan yang menyertainya tidak homogen dengan sehubungan
dengan sumber informasi atau kemungkinan bahwa produk farmasi
menyebabkan diduga merugikan reaksi. Beberapa menggambarkan informasi
seperti " data mentah " . Setiap penggunaan informasi ini harus
memperhitungkan setidaknya
di atas.”
Sistem pelaporan spontan masih paling sering digunakan untuk mendeteksi
sinyal keamanan obat baru. Di negara-negara berkembang mereka juga
digunakan untuk mendeteksi obat standar dan palsu. Di semua negara sekitar
setengah reaksi yang merugikan yang mengambil pasien ke rumah sakit telah
dinilai tidak dihindari. Sekarang, oleh karena itu, ada juga kebutuhan untuk
mempertimbangkan kesalahan medis sebagai sinyal bahwa ada masalah dengan
produk medis. Sebuah tren baru dalam pelaporan spontan adalah meningkatnya
jumlah laporan langsung dari konsumen
daripadaprofesional kesehatan. Sama seperti laporan profesional kesehatan
'menceritakan keprihatinan mereka tentang narkoba, begitu laporan konsumen
dan dari perspektif yang berbeda dan penting. Dalam semua dimensi ini,
laporan spontan menghasilkan data tentang kemungkinan ADR, atau sekitar
masalah yang lebih luas dengan obat; mereka menyediakan dasar untuk analisis
lebih lanjut atau untuk hipotesis untuk studi sistematis. Langkah berikutnya
adalah:
• untuk membuktikan atau menyangkal hipotesis ini;
• untuk memperkirakan kejadian, risiko relatif, dan kelebihan
risikoADR;
• untuk mengeksplorasi mekanisme yang terlibat;
• untuk mengidentifikasi kelompok risiko khususspontan.
Dalam beberapa kondisi yang tidak biasa, pelaporan dapat digunakan untuk
memberikan informasi yang berharga untuk tugas-tugas yang terakhir juga, tapi
setiap kasus membutuhkan analisis sendiri dan
pelaksanaanpenilaian klinis ahli. Sebuah WHO baru-baru ini publication5
menyoroti tantangan baru untuk farmasi covigilance: Dalam dekade terakhir,
telah terjadi pertumbuhan mendeteksi sinyal baru dari masalah keamanan.
Globalisasi, konsumerisme, ledakan dalam perdagangan bebas dan komunikasi
lintas batas, dan meningkatnya penggunaan internet telah mengakibatkan
perubahan dalam akses ke semua produk obat dan informasi pada mereka.
GLOBAL SURVEILLANCE OBAT
internasional ada kebingungan atas apa yang dimaksud dengan " . sinyal
"definisi WHO adalah:
informasi yang dilaporkan pada hubungan kausal mungkin antara peristiwa
yang merugikan dan obat, hubungan yang tidak diketahui atau tidak lengkap
didokumentasikan sebelumnya. (catatan) Biasanya lebih dari satu laporan
diperlukan untuk menghasilkan sinyal, tergantung pada keseriusan acara dan
kualitas informasi. Definisi ini netral dalam hal tindakan yang mungkin diambil.
Pandangan bahwa sinyal harus dilihat sebagai petunjuk pertama bahwa ada
kebutuhan untuk melihat lebih dekat pada obat dan ADR dilaporkan telah
diramalkan oleh Finney pada tahun 1974: "sinyal adalah dasar dari komunikasi
antara WHO dan pusat-pusat nasional; jarang akan hal itu membawa kekuatan
bahaya terbukti "dan" Sinyal dimaksudkan untuk membangkitkan kecurigaan
dan untuk merangsang penyelidikan lebih dalam "Amery pada tahun 1999 juga
menggemakan sentimen ini:". sinyal dapat didefinisikan sebagai informasi baru
menunjuk ke kausal yang sebelumnya tidak diketahui hubungan antara
peristiwa yang merugikan, atau insiden, dan obat: informasi harus seperti itu,
jika dikonfirmasi, itu
dapatmenyebabkan tindakan mengenai obat "dan" jadi generasi sinyal bertujuan
identifikasi tepat waktu efek samping tak terduga sebelumnya, tetapi setiap
sinyal memerlukan evaluasi lebih lanjut karena mereka sendiri tidak
membuktikan bahwa ada masalah keamanan. "arus Eropa Obat Badan evaluasi
(EMEA) pertimbangan sinyal ditemukan dalam Prosedur Transmisi dan
Pengelolaan sinyal Terdeteksi sebagai" masalah keamanan yang serius
(misalnya serangkaian ADR tak terduga atau serius atau peningkatan tingkat
pelaporan laporan ADR dikenal). "7 definisi lain oleh Meyboom et al0,8
mengacu pada sinyal sebagai" set data merupakan suatu hipotesis yang relevan
dengan rasional dan penggunaan yang aman dari obat pada manusia, "dengan
tambahan" Data tersebut biasanya klinis, farmakologis, patologis atau
epidemiologi di alam. "Kedua pernyataan ini membawa dengan mereka
implikasi bahwa beberapa tindakan harus diambil untuk mengingatkan orang
lain untuk sinyal. Ini adalah masalah kapan harus mengambil sinyal ke depan
bagi orang lain untuk mempertimbangkan hal itu, atau untuk profesi kesehatan
yang lebih luas atau masyarakat tahu tentang sinyal, yang sering subyek
perdebatan sengit, mengingat kedua implikasi untuk masa depan obat dan untuk
keselamatan pasien. Definisi Meyboom memberikan pandangan yang lebih luas
dari informasi yang digunakan untuk mendeteksi sinyal dan juga berguna
menggunakan istilah "hipotesis," yang lagi menggarisbawahi sifat tentatif dari
sinyal. Bahkan jika semua di atas pernyataan / definisi yang jelas bahwa sebuah
sinyal sementara masalah ini lebih lanjut bingung oleh fakta bahwa beberapa
menggunakan istilah "peringatan" sebagai alternatif untuk "sinyal". Lainnya
menggunakan "peringatan" menjadi peringatan yang dikirim keluar mengenai
sinyal. Jadi tidak hanya dua istilah yang digunakan secara bergantian, mereka
digunakan dalam indera berlawanan dengan otoritas yang berbeda.
Kotak 10.1. Definisi "sinyal."

Perubahan ini telah memunculkan jenis baru dari masalah keamanan:

Penjualan ilegal obat-obatan dan penyalahgunaan obat melalui Internet


Meningkatkan praktek pengobatan sendiri
Praktik dana tidak rasional dan berpotensi tidak aman
Pembuatan obat tersebar luas, penjualan palsu dan obat-obatan yang tidak
memenuhi syarat
Meningkatnya penggunaan obat tradisional di luar batas dari penggunaan
obat tradisional yang semestinya
Meningkatnya penggunaan obat tradisional dan herbal dengan obat lain
dengan potensi interaksi yang merugikan

Menurut publikasi yang sama, tujuan spesifik dari pharmacovigilance adalah


untuk:

Meningkatkan perawatan dan keselamatan pasien yang berhubungan


dengan penggunaan obat-obatan dan semua medis serta intervensi
paramedic
Meningkatkan kesehatan dan keselamatan masyarakat yang berkaitan
dengan penggunaan obat-obatan
Berkonstibusi pada penilaian dari manfaat, bahaya, efektivitas dan risiko
obat-obatan, mendorong keamanan, rasional dan penggunaan yang lebih
efektif (termasuk biaya-efektif)
Mempromosikan pemahaman, pendidikan, dan pelatihan klinis dalam
pharmacovigilance dan komunikasi yang efektif kepada masyarakat

Pharmacovigilance telah berkembang, ruang lingkup dari WHO Collaborating


Centre sudah luas, seperti tercermin dalam visi terbaru pusat dan tujuan, dan
pengantar di pertengahan 1990-an dari nama yang baru, Uppsala Pemantauan
Centre (UMC).

DESKRIPSI
GAMBARAN SKEMA PELAPORAN ADR
Skema pelaporan ADR berbeda dalam sejumlah dimensi. Terdapat dua parallel
atau sistem yang kurang global:
1. Literatur medis: Banyak jurnal mempublikasikan laporan kasus dari
pasien yang mungkin mengalami ADR.
2. Sistem pharmacovigilance Nasional: Laporan kasus diduga ADRs
dikumpulkan oleh pharmacovigilance nasional pusat
Fokus dari bab ini adalah pada bagian kedua (meskipun laporan kasus (case
reports) dari literatur termasuk dalam beberapa sistem nasional). Dalam kategori
kedua ini sekarang ada dua sistem internasional :

1. Salah satu di bawah naungan WHO di mana data pada semua ADRs
diduga dikumpulkan dan dikoordinasikan oleh UMC di Swedia.
2. Uni Eropa (EU) sistem pharmacovigilance (ilmu dan kegiatan yang
berkaitan dengan deteksi, penilaian, pemahaman dan pencegahan efek
samping obat atau masalah yang mungkin berhubungan dengan obat
lainnya).

Belakangan, semua Anggota Negara dan EMEA terhubung melalui intranet


aman (Eudranet) untuk pertukaran informasi pharmacovigilance. Sebuah
database, Eudrawatch, sedang dalam pembangunan untuk pemeriksaan dan
analisis laporan ADR yang serius terkait dengan produk resmi melalui prosedur
terpusat Uni Eropa. Perlu dicatat bahwa semua negara-negara Eropa ini juga
termasuk, dan laporan kepada, sistem WHO dan EMEA memiliki akses ke
informasi database WHO.

Informasi pada berbagai pusat pharmacovigilance nasional telah disusun.9 Di


masa depan publikasi ini akan diperbarui pada website UMC (www.who-
umc.org). Sistem nasional sendiri diatur dalam berbagai cara. Sebagian besar
terpusat, tetapi peningkatan jumlah terdesentralisasi. Untuk sebagian besar
sistem nasional pelaporan ADR bersifat sukarela, tetapi untuk beberapa hal
adalah wajib. Kebanyakan sistem nasional menerima laporan langsung dari
praktisi kesehatan. Beberapa, bagaimanapun, menerima sebagian besar laporan
mereka dari praktisi kesehatan melalui produsen farmasi, termasuk sistem
nasional terbesar, itu adalah AS (lihat Bab 9).

Sebagian besar pusat meninjau setiap laporan secara individual dengan


menggunakan pendekatan diagnostik dan pengambilan keputusan klinis,
membuat penilaian tentang setiap kasus bagaimana kemungkinan itu adalah
bahwa obat menyebabkan efek samping (lihat juga Bab 36). Namun, yang lain
menggunakan terutama pendekatan agregat atau epidemiologi untuk analisis
laporan (lihat Bab 9). Akhirnya, pusat-pusat nasional berbeda secara dramatis
dalam cara mereka berinteraksi dengan para reporter dari ADR. Beberapa
memperlakukan para wartawan mereka secara anonim, memberikan umpan
balik hanya dalam bentuk tindakan peraturan atau makalah yang diterbitkan
sesekali. Lainnya menyediakan umpan balik yang sangat langsung-verbal,
tertulis, dan / atau diterbitkan-untuk memaksimalkan dialog antara para
wartawan dan pusat. Pedoman tersedia tentang pengaturan dan menjalankan
pusat pharmacovigilance.10

ORGANISASI, AFILIASI, DAN TUGAS PUSAT MONITORING


NASIONAL
Di sebagian besar negara, pusat pemantauan merupakan bagian dari badan
pengawas obat.

 Pada beberapa, Filipina dan Selandia Baru, misalnya, fungsi yang dilakukan
bersama-sama oleh otoritas pengawasan obat dan lembaga universitas.
Belakangan menerima laporan awal dan melakukan analisis untuk
dipertimbangkan oleh otoritas.
 Di Jerman, program pemantauan ADR awalnya diselenggarakan oleh Komisi
Obat Profesi Medis Jerman. Pada tahun 1978 tanggung jawab untuk evaluasi
risiko yang ditimbulkan obat dipindahkan ke National Institute of Health
(Bundesgesundheitsamt), dan pada tahun 1993 sebuah badan baru dibentuk
untuk mengendalikan obat-obatan dan perangkat (BfArM). Komisi Obat masih
mengumpulkan dan mengevaluasi ADR laporan dari dokter dan apoteker, yang
kemudian diteruskan ke pihak berwenang kesehatan.
 Di Perancis, DinasObat Perancis telah mengambil tugas sebelumnya dilakukan
oleh Departemen Kesehatan. Hal ini juga berfungsi sebagai koordinasi dan
badan eksekutif untuk jaringan 31 pusat regional yang terhubung ke rumah
sakit universitas regional yang besar. Setiap pusat bertanggung jawab untuk
memantau ADR di wilayahnya. Laporan dievaluasi dimasukkan ke database
pusat. Pusat-pusat regional adalah co-disponsori oleh lembaga, rumah sakit,
dan universitas. Sumber-sumber publik atau bahkan dukungan swasta dapat
digunakan juga, asalkan mereka memiliki etika, menerima laporan, dan
disahkan oleh badan.
 Argentina, Kanada, Spanyol, Swedia, dan Thailand juga telah
mengembangkan sistem desentralisasi, di bagian yang mirip dengan Perancis.
 Di Inggris ada empat pusat daerah yang dipilih terhubung ke rumah sakit
universitas, yang memiliki tanggung jawab khusus untuk mendorong
pelaporan ADR di daerah khusus mereka.

Sistem regional memiliki keuntungan bahwa komunikasi yang baik dan


hubungan pribadi dapat dibentuk antara staf dari pusat pemantauan dan laporan
yang profesional. Mereka, bagaimanapun, menuntut dalam jumlah staf yang
dibutuhkan dan, kecuali laporan yang dimasukkan langsung ke database pusat,
dapat mengakibatkan keterlambatan arus informasi.

Di Moroko, Tanzania, dan beberapa negara lain pusat nasional juga


berfungsi sebagai Pusat Informasi Beracun, atau berhubungan erat dengan
pelayanan informasi obat. Ini dapat berfungsi sebagai model yang berguna bagi
negara-negara lain, karena reaksi keracunan dan merugikan sering berhubungan.
Juga, permintaan informasi obat yang sering tentang reaksi obat yang
merugikan, yang mungkin juga diketahui atau langka dan tak terduga. Hal ini
dapat lebih menambah nilai pusat, sebagai para dokter lokal kemudian merasa
bahwa mereka tidak hanya memberi di laporan ADR, tapi sebagai imbalannya
menerima informasi bermanfaat secara klinis.
Beberapapusat regional, misalnya, di Barcelona (Spanyol), Bordeaux (Prancis),
dan orang-orang di Swedia, jugaengagedInstudipharmacoepidemiology formal
untukmengikutisinyaluppotentialdiciptakanolehlaporanspontan.Di
banyaknegarapemantauan ADR dimulaidalampengaturanakademikrumahsakit,
danmungkinjugaterussepertiitu.kegiatandari Boston Collaborative Drug
Surveillancewerecontohutamadaripendekatansemacamitu. Beberapa Negara
lain, termasuk India dan Thailand, sertabeberapa Negara lainnya,
memilikirumahsakitindividu yang kuatmonitoring.lihat Bab 35
untuklebihlanjuttentangpharmacoepidemiologyrumahsakit. PELAPORAN
PERSYARATAN
Kebutuhanterbesaruntukinformasitentangefekobatdantibatibatidakdiinginkanber
kaitandenganobat yang barudikeluarkan.Dengandemikian,
sebagianbesarnegaramenekankanperlunyatoreportbahkanreaksisepeleuntukobat
baru, sementaraobat-
obatanstabildepannyahanyareaksiseriusbiasanyadiminta.Beberapanegaratelahme
ngidentifikasidenganjelas yang obatbaruingindiamati paling dekat.Di
KingdomsuchInggrisobatditandaidengansegitigahitam di
BritishNationalformularium.PemegangIzinedar (Mahs)
didoronguntukmemasukkannyakedalamsemuaprodukinformasi laindaniklan.
Sisteminisukareladankhususnyatidakbisaditegakkanuntukprodukterpusat (mis.,
yang disetujuioleh EMEA untukdigunakandalamEuropeanUnion). Di Denmark
danSwedia, daftarobatpemantauaninterestforkhususditerbitkan di
nasionalmedisjournal.diSelandiaBarudanIrlandia, beberapaobatbaru yang
dipilihareputdalam program pelaporanintensif. Di SelandiaBaru, intensifObat
monitor Pemantauan Program kohortsemuapasien yang
memakaidipilihobatbarudanpermintaanspesialisbahwasemuaperistiwaklinisdilap
orkan, tidak ADR hanyasuspensi. Sebagianbesarnegara, bagaimanapun,
mengeluarkanrekomendasirathergeneralsepertiapajenisharusbereaksidilaporkan
kepusat-pusatnasional. Dalamsetidaknyasepuluhnegara,
ituadalahwajibuntukdoktergigidandokteruntukmelaporkankasusdugaanreaksi
yang
merugikansseriusterhadapotoritas.KeduaDewanforInternationalOrganisasiIlmu
Kedokteran (CIOMS) danKonferensiInternasionaltentangHarmonisasi (ICH)
telahbekerjapadapraktekpharmacovigilancebaik,
whichsetpedomanuntukmanajemen yang tepatdarikasusindividudankasus
series.11,12 (Lihatjuga www.ich.org , safetytopics.) AS
bekerjapadapedomansepertijuga (lihat Bab 8 dan 9). Di beberapa 25 negara,
termasukUniEropa, Jepang, danTheus, ituadalahwajibbagiperusahaanfarmasi
(orMAHs di UniEropa) untuktundukkepadaotoritascasesofdidugaefeksamping
yang telahmenjaditothemdikenal (peristiwaklinis yang
mungkindisebabkanolehthedrug, dankadang-kadangmereka di
manatidakadaatribusihasbeensepertidibuat). SUMBER LAPORAN Status
peraturandanorganisasidari program
drugmonitoringnasionaljugamenentukansumberdanthetypeinformasi yang
akanditerima. Tigamaingroupsnegaradapatdiidentifikasi: • Negara
memperolehkontribusibesarreportsdirectlydaridokter di
rumahsakitdanpraktekumum, seperti Australia, Perancis, Irlandia, Belanda,
SelandiaBaru, negara-negaraNordik, Spanyol, Thailand, andtheInggris Raya. •
Negara menerimasebagianbesarinformasimerekaindustrifarmasi, sepertiJerman,
Italia, danAmerikaSerikat. • Negara
terutamatergantungpadainformasidaridokterrumahsakitke merekasaja,
sepertiJepang, India, Rumania, danBulgaria.
Kontribusidaridoktergigiumumnyakecil.Beberapanegaramenerimalaporandariap
oteker, perawat, dankonsumen. PENANGANAN DAN EVALUASI
LAPORAN Ketikalaporanmencapaipusatnasionalapotekerdokter
normalmembacanya. (Dalambeberapacountriespharmacists di
pusatnasionalmemilikiakseskekonsultankesehatan.)Sebuahpenilaian yang
dibuattentangapakahinformasitersediacukupsebagaidasaruntukpendapatkebenar
andari diagnosis dankausalitas, atau data
jikalebihharusdiminta.DalammayoritasNegara partisipandalamskema WHO,
merekpetugasmedispenilaiansetiapkasus yang
berkaitandenganprobabilitasdarihubungansebabakibatantarklinis

Dalam beberapa tahun terakhir telah ada upaya internasional


untukmenyelaraskan istilah yang digunakan untuk menggambarkan efek
samping danuntuk mengatur kriteria dan definisi untuk setidaknya serius
utamajenis reaksi. Demikian pula, telah ada upaya untukmenyelaraskan cara
data disimpan dan dikomunikasikaninternasional. Badan-badan utama yang
terlibat dalam pekerjaan initelah WHO, CIOMS, ICH, dan Uni Eropa. Sebagai
contoh,disepakati secara internasional kriteria dan definisi telahditerbitkan
untuk reaksi sering dilaporkan ke WHODatabase 14,15 dan oleh beberapa
kelompok lain yang terlibat dengan ADRmonitoring.16-19 The Medical
Dictionary untuk RegulatoryKegiatan (MedDRA) menjadi lebih dan lebih
digunakanseluruh dunia, dan format ICH E2B, yangpedoman untuk format
transmisi informasi untukdisertakan pada laporan kasus reaksi yang merugikan,
dansesuai IT spesifikasi pesan untuk transmisi,ICH ICSR DTD (Individual
Kasus Keselamatan Laporan DokumenType Definition), berada di jalan untuk
menjadi data globalpenyimpanan dan pemindahan standar bagi dunia.

Tidak ada standar umum untuk operasional rincipenilaian hubungan


sebab akibat antara obat dan ADRtelah disepakati secara internasional.
Kebanyakan ahli setuju tentangfaktor yang harus diperhitungkan dalam
penilaian,tapi berapa banyak berat badan harus diberikan untuk masing-masing
faktoradalah subyek melanjutkan debat ilmiah (lihat Bab 36) .20Sejumlah
kurang lebih rumit dan komprehensifalgoritma untuk penilaian kausalitas
telahconstructed.21,22 Ketika diuji oleh penemu mereka, inialgoritma telah,
secara umum, telah ditemukan untuk mengurangi variabilitasantara peringkat
diproduksi oleh individuals.23-25 berbedaIni belum, namun, selalu terjadi
ketikakelompok independen telah diuji algorithms.26,27 yang Selain itu,itu
belum mungkin untuk menguji apakah penilaiandicapai dengan penggunaan
algoritma telah lebih validdaripada mereka mencapai tanpa mereka. Tidak ada
algoritma belumdibangun yang dapat mengatasi berbagai jeniskategori paparan-
acara dilihat oleh pusat nasional dan belumcukup sederhana untuk digunakan
ketika mengevaluasi sejumlah besarkasus secara rutin.

Satu-satunya negara hari ini menggunakan algoritma pada rutinitasdasar


untuk penilaian kausalitas dalam laporan ADR adalahPerancis, di mana
keberadaan 31 pusat regional yang berbedamembutuhkan beberapa
standardization.28 Beberapa pusat nasional berpendapat bahwa rating kausalitas
setiap kasus tunggal sebagai disampaikan memperkenalkan Bias, dan bahwa itu
adalah tidak dapat diterima alokasi sumber daya. Oleh karena itu lebih baik
menggunakan istilah "Hubungan" karena ini tidak menyiratkan pertimbangan
nilai. Namun, perjanjian internasional baru-baru ini telah mencapai antara
negara-negara yang berpartisipasi dalam obat WHO Skema monitoring pada
definisi umum dari istilah yang paling sering digunakan untuk menggambarkan
hubungan di semi-kuantitatif cara (Tabel 10.1). Metode untuk menilai hubungan
di laporan kasus dibahas secara lebih rinci dalam Bab 36.

Hubungan kausal jelas dalam satu kasus, atau bahkan seri, bukan satu-
satunya masalah di sinyal awal yang komprehensif deteksi. Banyak laporan
kasus dengan informasi yang terbatas mungkin dikeluarkan dari pertimbangan
serius, tapi kasus record yang tidak memungkinkan untuk penilaian terpencil
hubungan antara obat dan ADR tidak berarti bahwaPengamat asli tidak benar,
hanya itu pengamatantidak dapat dikonfirmasi. Jadi kuantitas, serta kualitas,
dari
Tabel 10.1. Terminologi untuk penilaian kausalitas

Tertentu. Sebuah peristiwa klinis, termasuk uji laboratorium kelainan,terjadi


dalam hubungan waktu yang masuk akal untuk pemberian obat,dan yang tidak
dapat dijelaskan oleh penyakit bersamaan atauobat lain atau bahan kimia.
Respon terhadap penarikanobat (de-tantangan) harus masuk akal secara
klinis.Acara ini harus farmakologi definitif atau fenomenologis, menggunakan
memuaskan re-tantanganprosedur jika perlu.
Kemungkinan/ kemungkinan. Sebuah peristiwa klinis, termasuk uji
laboratoriumkelainan, dengan wajar waktu berurutan untuk administrasiobat,
mungkin dikaitkan dengan penyakit bersamaanatau obat lain atau bahan kimia,
dan yang mengikuti klinisTanggapan wajar penarikan (de-tantangan). Re-
tantangan
Informasi tidak diperlukan untuk memenuhi definisi ini.
Mungkin. Sebuah peristiwa klinis, termasuk uji laboratorium
kelainan,dengan urutan waktu yang wajar untuk administrasiobat, tapi yang bisa
juga dijelaskan dengan bersamaanpenyakit atau obat lain atau bahan kimia.
Informasi tentang obatpenarikan mungkin kurang atau tidak jelas.
Tidak sepertinya. Sebuah peristiwa klinis, termasuk uji laboratorium
kelainan, dengan hubungan temporal untuk pemberian obatyang membuat
hubungan kausal mustahil, dan di manaobat lain, bahan kimia, atau penyakit
yang mendasari memberikan yangmasuk akalpenjelasan.
Conditional/unclassified.Sebuahperistiwa klinis, termasuk laboratorium
tes kelainan, dilaporkan sebagai reaksi yang merugikan, tentangyang lebih
banyak data penting untuk penilaian yang tepat ataudata tambahan berada di
bawah pemeriksaan.
Unassessable/unclassifiable.Sebuah laporan menunjukkan suatu yang
merugikanReaksi yang tidak dapat dinilai karena informasi adalahcukup atau
bertentangan, dan yang tidak dapatditambah atau diverifikasi. laporan dari
asosiasi berharga. Penggunaan "miskin kualitas " melaporkan sebagai pemicu
untuk sinyal harus diambil serius jika acara klinis serious.13 peringatan dini
adalah tujuan , dan sinyal berdasarkan bukti diragukan harusmempromosikan
pencarian yang lebih baik.

Mungkin juga ada beberapa bagian informasi dalam satu set laporan yang
memicu pertimbangan sebuah sinyal lain selain dari sekedar produk obat dan
acara klinis : representasi-nyata mengenai dosis yang lebih tinggi dari obat
yang relevan, atau pengobatan bersama atau karakteristik pasien tertentu dapat
menjadi hal yang penting pada penggunaan yang aman dari produk obat.

Di atas adalah beberapa masalah umum untuk dipertimbangkan selama


evaluasi awal. Ada banyak orang lain, seperti temuan masalah pada satu produk
obat, yang memicu pencarian produk dengan efek yang sama. Yang jelas adalah
bahwa ada pola interaksi yang sangat kompleks pada informasi, yangdapat
memicu ide-ide dan keprihatinan.

Banyak pihak berwenang nasional meninjau sistematis dan mengevaluasi


informasi dari berbagai sumber, selain laporan ADR spontan, untuk
mengidentifikasi ADRs baru atau mengubah profil ADR dasar yang mana
tindakan harus dimulai untuk meningkatkan penggunaan yang aman dari obat-
obatan.Web dan review jurnal seperti Reaksi Weekly (ADIS Internasional)
berguna dalam hal ini. (Reaksi Weekly juga menghubungkan temuan literatur
untuk orang-orang dari database WHO yang relevan.)

UMPAN BALIK REPORTER

Beberapa bentuk umpan balik dari pusat nasional harus diatur untuk
dokter merasa bahwa mereka terlibat dalam proses yang berulang dan
progresif. Di banyak negara, masing-masing reporter menerima pengakuan
pribadi,sering termasuk sebuah evaluasi awal dari kasus. Buletin reaksi yang
merugikan dibuat secara teratur di banyak negara dan kemudian didistribusikan
ke profesi medis. Kadang-kadang informasi yang disertakan termasuk dalam
jurnal medis lokal atau buletin informasi obat.

Hal ini, mungkin, titik pusat di mana komunikasi yang efektif sangat
penting untuk keberhasilan pharmacovigilance(keamanan obat). Setelah dokter
mengetahui sistem pelaporan nasional mereka, laporan yang terpercaya adalah
penting, untuk tahu di mana cara menemukan bentuk laporan mereka, dan
merasa termotivasi untuk bertindak (semua komunikasi utama dan tantangan
motivasi dalam diri mereka), mereka harus merasa bahwa upaya mereka
memiliki beberapa reward (penghargaan, setidaknya) dan beberapa efek pada
pengetahuan medis dan practice.29

DETEKSI DAN EVALUASI Sinyal

Laporan reaksi obat yang merugikan secara spontan pada prinsipnya


metode untuk mengidentifikasi bahaya yang sebelumnya tidak dikenal obat
dipasarkan. Dalam program WHO "sinyal" perhatian informasi mengenai
kemungkinan hubungan antara obat dan efek samping atau interaksi obat.
Dalam mencoba untuk mendeteksi sinyal dari data internasional itu harus
dipahami bahwa sinyal adalah hipotesis awal, dan bahwa hal itu hanya
panggilan sederhana untuk pekerjaan lanjutan yang akan dilakukan pada
hipotesis itu.

Pada hari-hari awal pharmacovigilance, ketika laporan relatif sedikit,


sinyal dicari secara manual atau melalui pemeriksaan, misalnya, daftar
triwulanan laporan kasus yang disampaikan diurutkan dalam berbagai cara
untuk membantu review (misalnya, semua kematian, baru menuju sistem).
Profil berdasarkan proporsi laporan mengenai kelas sistem organ yang berbeda
dibandingkan dan perbedaan laporan proporsi reaksi digunakan sebagai
petunjuk untuk analisis lanjutan.30-32
Kemudian, perbedaan proporsi tersebut diuji dengan tes signifikansi
statistik. Sebuah sinyal yang dipublikasikan, misalnya, berdasarkan uji tersebut
adalah proporsi yang lebih tinggi dari serum penyakit-seperti reaksi untuk
cefaclor, dibandingkan dengan sefalosporin lainnya dan ampicillin.33

Metode Perancis "Kasus-non kasus" ini didasarkan pada prinsip yang


sama, membandingkan proporsi, misalnya, hipoglikemia dilaporkan untuk
acetylcholinesterase (ACE) inhibitor dengan laporan untuk obat kardiovaskular
lainnya.34

Otak manusia sangat baik dalam menemukan pola yang signifikan dalam
data: manusia tidak akan bertahan jika itu tidak berpikiran seperti itu

Jadi ! Ini adalah proses yang kompleks untuk memeriksa sejumlah besar
laporan kasus untuk faktor baru yang mungkin berdampak pada penggunaan
yang aman dari obat atau obat-obatan yang bersangkutan, terutama ketika
setiap laporan kasus terdapat sejumlah informasi yang dapat dipertimbangkan.
Dapat dijadikan pengingat istilah reaksi yang merugikan pada laporan yang
berbeda, bagaimana mereka mungkin saling terkait, dan waktu tren pelaporan
mereka pelaporan hanya sebuah petunjuk kompleksitas tersebut. Volume besar
data di keamanan obat saat ini tidak dapat memberikan perhatian yang efektif,
apalagi diadakan di memori manusia untuk analisis. Meskipun banyak sinyal
penting memiliki keaslian dalam data tinjauan klinis open-minded (pandangan
terbuka), beberapa pre-sorting sekarang diperlukan untuk alasan di atas. Juga,
agar tidak ketinggalan sinyal penting yang mungkin ada tempat untuk
menganalisis data yang memungkinkan kita untuk melihat pola tanpa prasangka
yang dapat membutakan kita untuk kemungkinan kondisi diluar pengalaman
kita.

Memang benar bahwa dalam mencari pola yang signifikan dengan


memilah-milah data, sesuatu yang terlihat kemungkinan dapat muncul secara
kebetulan: data "pengerukan" atau "trawl" atau "ekspedisi memancing" terikat
untuk menangkap sesuatu, tetapi belum tentu banyak yang berguna. Data
pengerukan harus digunakan sebagai istilah yang merendahkan untuk
mengutak-atik terstruktur tentang data, atau lebih buruk, penerapan struktur data
untuk membuatnya sesuai hipotesis bias dengan cara memberi tambahan
kredibilitas pada hasilnya.

Formal data mining, atau "pengetahuan menemukan / deteksi,"

di sisi lain, tidak acak mengobrak-abrik data dalam mode tanpa tujuan,yang
adalah apa istilah "pengerukan" menyiratkan. Data mining / pengetahuan
menemukan harus dianggap sebagai istilah untuk aplikasi alat atau alat untuk
menganalisis data dalam jumlah besar secara transparan dan berisi, dengan
tujuan informasi menyoroti layak pertimbangan lebih dekat

Memang benar bahwa keterlibatan variabel dan karakterisasi dari setiap


hubungan mereka di pengenalan pola maju adalah "tanpa pengawasan" di data
mining, dalam logika yang telah ditentukan untuk menemukan pola yang
diperbolehkan untuk berjalan bebas dari campur tangan manusia. Namun, dalam
sinyal metode menggunakan data mining, tingkat fleksibilitas dan jenis logika
yang diterapkan untuk data yang sistematis dan transparan.

Data mining pendekatan terhadap sinyal deteksi dapat menggunakan


metodologi yang berbeda tetapi mereka memiliki kesamaan bahwa mereka
mencari "disproportionalities" di data, yaitu, hubungan atau pola berdiri keluar
dari latar belakang pengalaman Database

Dua keuntungan dari pendekatan ini adalah:

• tidak ada data eksternal yang diperlukan dan keterbatasan data tersebut
(termasuk keterlambatan dalam penerimaan) tidak berlaku;
• mereka mungkin diharapkan untuk menangkal beberapa bias yang terkait
dengan pelaporan variabel. Sebagai contoh, jika keseluruhan tingkat pelaporan
tinggi karena bias obat baru, ini

tidak akan selalu mempengaruhi proporsi semua reaksi untuk obat; sementara
tingkat pelaporan keseluruhan tinggi dapat dikaitkan dengan tingkat
penggunaan narkoba, reaksi merugikan tertentu mungkin masih proporsional
dilaporkan jika itu adalah umum

Salah satu kelemahan yang mungkin adalah bahwa, sebagai perubahan data
latar belakang untuk semua obat pada set data, begitu juga dengan yang
diharapkan terjadinya (disproporsionalitas) untuk kombinasi obat-ADR yang
bersangkutan. Stratifikasi juga akan memiliki efek yang sama dengan mengubah
data latar belakang disertakan. Ini bisa, bagaimanapun, harus diperhitungkan
selama analisis. Hal ini jelas bahwa dalam database yang besar penambahan
informasi baru untuk latar belakang akan memiliki relatif kurang berpengaruh.

Dua pendekatan terhadap Penemuan pengetahuan dijelaskan di bawah,


dalam beberapa detail, sebagai contoh: satu untuk mengidentifikasi pola-pola
yang kompleks dalam data, dan yang lainnya untuk melihat hubungan yang
relatif sederhana.

Pendekatan Bayesian Menggunakan Neural Networks sebagai


Diimplementasikan untuk database WHO

Deskripsi

Penggunaan utama dari database internasional program WHO adalah untuk


menemukan Novel sinyal mengenai keamanan obat: informasi baru. Satu mulai
melihat masalah sebagai mencari pepatah "jarum di tumpukan jerami." Seperti
disebutkan di atas, jika sinyal penting adalah jangan sampai terlewatkan,
analisis pertama dari informasi harus bebas dari prasangka

Dengan pemikiran ini, UMC telah mengembangkan sistem deteksi sinyal


yang menggabungkan alat data mining untuk penyaringan data mentah dengan
aplikasi berikut dari algoritma filtering yang berbeda. penyaringan kuantitatif
ini data ini dimaksudkan untuk fokus Ulasan klinis pada kombinasi obat-ADR
yang paling berpotensi penting, yang dapat disamakan dengan sistem triase
klinis untuk membimbing ulasan klinis terhadap bidang yang menjadi perhatian
pertama. Yang dihasilkan "paket prioritas" diteliti oleh para ahli independen
pada panel review internasional. Berdasarkan evaluasi dari bukti yang tersedia
dan pendapat ahli, hipotesis dari masalah obat-induced potensial dirumuskan
sebagai "sinyal."

Ini diedarkan ke semua pusat nasional yang berpartisipasi dalam program WHO
untuk pertimbangan implikasi kesehatan masyarakat

Langkah pertama menuju proses signaling baru ini adalah pengembangan


dari alat data mining untuk database WHO. Kepercayaan Bayesian Propagasi
Neural Network (BCPNN) metodologi, 41 dirancang untuk mengidentifikasi
disproportionalities signifikan secara statistik dalam satu set data yang besar,
dengan kinerja tinggi, untuk memungkinkan skrining otomatis semua kombinasi
obat dan efek samping di WHO Database (Kotak 10.2).

The BCPNN memberikan model komputasi yang efisien untuk analisis


data dalam jumlah besar dan kombinasi variabel, baik nyata, diskrit, atau biner.
Hal ini kuat dan hasil yang relevan masih bisa dihasilkan meskipun data yang
hilang. Data yang hilang tidak mencegah identifikasi proporsional dilaporkan
obat-ADR atau kombinasi lainnya; hanya ketidakpastian yang lebih besar dan
dilambangkan dengan batas kepercayaan yang lebih luas. Jika diperlukan, juga
memungkinkan untuk menghubungkan nilai-nilai, dan untuk membuat kasus
terbaik, informasi terburuk. Hal ini menguntungkan karena sebagian besar
laporan dalam database berisi beberapa bidang kosong. Hasilnya direproduksi,
membuat validasi dan memeriksa sederhana. The BCPNN mudah untuk
melatih; hanya membutuhkan waktu satu lulus seluruh data, yang membuat

hal ini sangat hemat waktu. Hanya sebagian kecil dari semua kemungkinan
kombinasi reaksi obat merugikan sebenarnya non-nol dalam database. Dengan
demikian, penggunaan metode matriks jarang membuat pencarian melalui
database yang cepat dan efisien.

BCPNN adalah jaringan saraf dimana belajar dan kesimpulan dilakukan


dengan menggunakan prinsip-prinsip hukum Bayes'. Statistik Bayesian dengan
tidak sengaja cocok ke dalam kerangka pendekatan jaringan syaraf karena
keduanya membangun konsep beradaptasi berdasarkan data baru.
Sistem sinyal baru menggunakan BCPNN untuk memindai laporan ADR
yang baru masuk dan membandingkan mereka secara statistik dengan apa yang
sudah disimpan dalam database sebelum pemeriksaan klinis. Setiap tiga bulan,
database WHO lengkap dipindai untuk menghasilkan database kombinasi. Ini
adalah tabel yang berisi jumlah frekuensi untuk masing-masing obat, untuk
setiap ADR, dan untuk setiap kombinasi obat-ADR yang UMC telah menerima
laporan kasus selama kuartal terakhir. Hanya kombinasi dimana obat telah
dilaporkan sebagai "terduga" yang disertakan. Untuk setiap kombinasi reaksi
obat merugikan, gambaran statistik yang dihasilkan oleh BCPNN juga
diberikan. Angka-angka dari kuartal sebelumnya juga disertakan dan data yang
disediakan untuk semua pusat phamacovigilance nasional dalam format
elektronik.
Arsitektur jaringan saraf memungkinkan kerangka yang sama untuk
digunakan baik untuk sumber data/analisis data serta untuk pengenalan pola dan
klasifikasi. Pengenalan pola oleh BCPNN tidak tergantung pada hipotesis a
priori (berdasarkan teori daripada kenyataan yang sebenarnya), sebagai
pencarian dan deteksi pendekatan tanpa pengawasan digunakan. Untuk output
rutin BCPNN digunakan sebagai model satu lapis, meskipun telah diperpanjang
ke jaringan multilayer. Untuk menemukan ketergantungan yang kompleks yang
belum tentu dipertimbangkan sebelumnya, jaringan berulang digunakan untuk
investigasi kombinasi dari beberapa variabel dalam database WHO. Dua
aplikasi penting berdasarkan BCPNN bahwa UMC mengembangkan deteksi
sindrom dan identifikasi pada interaksi obat yang mungkin. Kemungkinan lain
termasuk menemukan profil usia reaksi obat merugikan, menentukan kelompok
risiko, dan mencari hubungan dosis-reaksi.
Tentu, perubahan pola seperti kelompok pasien, golongan obat, sistem
organ, dan dosis obat mungkin juga penting. Namun, seperti beberapa subdivisi
data, jumlah keseluruhan yang sangat besar diperlukan awalnya untuk mencapai
signifikansi statistik dalam subset. Ini adalah keuntungan utama menggunakan
database besar WHO dan UMC berusaha memaksimalkan potensi ini.
Stratifikasi data memiliki masalah yang sama dari membutuhkan data
yang besar serta masalah penentu dalam memajukan apa strata mungkin relevan
dalam setiap situasi tertentu, meskipun mungkin berharga dalam menghapus
efek pembaur. Stratifikasi, oleh karena itu, dilakukan setelah sinyal telah
ditemukan, seperti necessary.42 dianggap "Validasi" Pendekatan BCPNN Data
Mining Kritik dari data mining cukup dapat menunjukkan bahwa, dengan
semua kemungkinan hubungan dalam database yang besar, banyak asosiasi
reaksi obat merugikan akan terjadi secara kebetulan, meskipun mereka
tampaknya secara signifikan terkait. Itu Metodologi BCPNN digunakan oleh
UMC tidak memperhitungkan dari ukuran database dalam menentukan
probabilitas. Saya t jelas bahwa pusat-pusat nasional dan pengulas tidak harus
tersedia dengan apa sebesar sejumlah besar berguna informasi probabilistik. Di
sisi lain, jelas bahwa proses menemukan sinyal awal akan memerlukan
beberapa palsu positif.
Menentukan kinerja BCPNN adalah Tugas yang sulit karena tidak ada
standar emas untuk perbandingan dan ada definisi yang berbeda dari sinyal
jangka. Menurut
definisi yang digunakan dalam program WHO, sinyal adalah dasarnya hipotesis
bersama-sama dengan data dan argumen, dan tidak hanya pasti namun juga
awal di alam:
status sinyal dapat berubah secara substansial dari waktu ke waktu, sebagai
pengetahuan baru diperoleh.
Dua penelitian utama kinerja BCPNN telah dilaporkan dalam paper.43
tunggal
Satu studi yang bersangkutan tes retrospektif dari BCPNN Nilai prediktif dalam
deteksi sinyal baru dibandingkan dengan sumber pustaka referensi (Martindale
ini Ekstra Farmakope,
dan Dokter US Desk Reference). The BCPNN Metode terdeteksi sinyal dengan
nilai prediksi positif dari 44% dan nilai prediksi negatif adalah 85%. Studi
kedua adalah perbandingan BCPNN dengan hasil mantan prosedur signaling,
yang berdasarkan tinjauan klinis data kasus diringkas. Enam sepuluh sinyal
diidentifikasi sebelumnya juga diidentifikasi oleh
yang BCPNN. Kombinasi ini semua menunjukkan substansial peningkatan
pelaporan berikutnya. Sisa empat obat-ADR kombinasi yang tidak diidentifikasi
oleh BCPNN memiliki
kecil, atau tidak ada, peningkatan jumlah laporan, dan tidak tercantum dalam
sumber-sumber referensi tujuh tahun setelah mereka memiliki telah beredar
sebagai sinyal.
Tentu saja, penggunaan sumber literatur terpilih sebagai standar emas terbuka
untuk diperdebatkan. literatur tidak dimaksudkan sebagai sistem sinyal awal,
dan menggunakan banyak sumber untuk informasi yang lain selain database
WHO: bias mempengaruhi inklusi dan eksklusi informasi ADR Oleh karena itu
mungkin sangat berbeda. Faktor-faktor seperti yang mempengaruhi diferensial
melaporkan kepada WHO dan masuknya informasi baru dalam sumber referensi
akan memiliki efek yang independen dari kinerja yang BCPNN.
The BCPNN dijalankan setiap triwulan oleh UMC, dan hanya seperempat
dipilih: sejak BCPNN yang digunakan dalam analisis terus menerus,
kekhususan dan sensitivitas tunduk untuk perubahan yang diperlukan
tergantung waktu di klasifikasi "Positif" dan "negatif." Sulit untuk
mempertimbangkan sesuatu sebagai "non-asosiasi" karena saat ini
ketergantungan, dan jelas bahwa ada asimetri dalam pengaruh waktu pada hasil.
Asumsi dibuat bahwa peningkatan substansial dalam jumlah laporan dari
asosiasi selama periode menunjukkan minat klinis berlangsung di sebuah
asosiasi.
laporan lebih dapat dilihat sebagai dukungan untuk validitas asosiasi, meskipun
sering ada kecenderungan untuk ADR yang menjadi terkenal akan lebih pula
dilaporkan.
Keterbatasan lain jelas adalah bahwa metode BCPNN untuk deteksi sinyal
tergantung pada terminologi yang digunakan untuk merekam reaksi yang
merugikan. Sangat sedikit kerja telah dilakukan pada salah satu terminologi
medis digunakan atau diusulkan
untuk menentukan nilai relatif mereka dalam mencari obat baru sinyal.
Meskipun UMC menemukan bahwa penggunaan BCPNN yang memberi
nilai prediksi positif 44%, dan negatif yang tinggi nilai prediktif 85%,
pendekatan yang biasa untuk menilai kekuatan metode yang sulit diterapkan,
karena alasan yang diuraikan di atas. Selanjutnya, dan yang lebih penting,
negatif nilai prediksi akan selalu tinggi ketika apriori
probabilitas rendah. Dengan demikian, 85%, nilai prediksi negatif tidak
mungkin bahkan dianggap sebagai tinggi dalam situasi ini. Ini untuk alasan-
alasan bahwa "validasi" ditempatkan dalam tanda kutip dalam judul bagian ini.
The BCPNN (atau memang metode data mining lainnya) adalah bukan
obat mujarab untuk pemantauan keamanan obat. Ini penting untuk menyadari
keterbatasan BCPNN dan bahwa hal itu tidak bisa menggantikan review.40 ahli
Namun, mungkin sangat berguna alat dalam analisis awal dari kompleks dan
besar database
Ini merupakan pendekatan dirintis di UK44 tapi sekarang
banyakdigunakan karena kesederhanaannya. Proporsi semuareaksi obat yang
mewakili medis tertentu
kondisi bunga dibandingkan dengan proporsi yang samauntuk semua obat
dalam database. statistik yang dihasilkan disebutrasio pelaporan proporsional
(PRR). Penilaian tentang sinyal
kemudian dapat dibuat menggunakan PRR, bersama dengan terkaitnilai chi-
kuadrat dan jumlah absolut dari laporan.
Seperti dengan metode lain, pendekatan ini menggunakan jumlah total
laporan obat sebagai pembaginya untuk menghitung proporsi semua reaksi yang
penting (misalnya, hepatitis). Proporsi ini dapat dibandingkan dengan menilai
obat lain. Hal ini juga memungkinkan untuk membandingkan profil lengkap
dari pelaporan ADR untuk obat dengan berbagai jenis reaksi, di mana
perbedaan dalam profil dapat mewakili sinyal potensial. Hasil perhitungan
tersebut juga disebut PRR, di mana PRR adalah / (a + b) dibagi dengan c / (c +
d) sebagai berikut dua-dua tabel:
Reaksi (s) yang penting Semua reaksi lainnya
Obat yang penting a b
Semua obat lain dalam d c
database

Hasil PRR, serta metode lain yang dijelaskan di bawah ini, adalah
menekankan kombinasi obat-ADR dengan tingkat pelaporan secara tidak
proporsional tinggi: secara matematika terlihat berbeda tetapi prinsip-prinsipnya
sama.
Nilai yang diharapkan atau tidak adanya nilai untuk PRR adalah 1.0 dan
angka yang dihasilkan adalah ukuran asosiasi yang berperilaku dengan cara
yang sama untuk risiko relatif. Langkah-langkah asosiasi statistik untuk setiap
nilai dihitung menggunakan metode standar untuk signifikansi (lihat di bawah).
Semakin tinggi PRR, semakin disproporsionalitas (tidak seimbang) statistik
yang terlihat. Pemeriksaan perubahan PRRS dari waktu ke waktu dapat
membantu untuk menunjukkan bagaimana disproportionalities dapat
diidentifikasi sedini mungkin.
PRRS memiliki keunggulan dibandingkan perhitungan dari tingkat
laporan, karena PRRS termasuk sederhana dalam konsep dan perhitungan, dan
menikmati manfaat dari data mining pada umumnya. Namun yang terpenting,
ini tidak memperhitungkan relevansi klinis dan efek bias termasuk pengganggu,
tidak dilaporkan selektif, dan efek atau dampak dari meringkas laporan
informasi.
Hal ini penting lagi untuk menyadari bahwa PRRS bukan merupakan
pengganti untuk tinjauan perincian kasus, tetapi merupakan bantuan untuk
memutuskan serangkaian kasus yang paling menjamin untuk penelaahan lebih
lanjut. Juga, PRRS dan nilai-nilai chi-square adalah ukuran dari asosiasi dan
tidak kausalitas (metode hubungan sebab-akibat). Hasil PRR sebuah
memberikan sinyal; itu tidak membuktikan sebab-akibat. Pengujian hipotesis
yang dihasilkan biasanya membutuhkan studi formal dalam data lebih
terstruktur.
Ada beberapa kemungkinan ekstensi (perpanjangan waktu) untuk metode
yang sedang dievaluasi lebih lanjut, misalnya oleh Profesor Stephen Evans di
Inggris, menggunakan perbedaan observasi dan diharapkan melaporkan nilai
atau tingkatan (uji rasio probabilitas secara berurutan) sebagai cara untuk
menekankan tanda atau sinyal yang mungkin lebih penting (komunikasi
pribadi). Juga, perhitungan PRR dapat dibatasi untuk kelompok-kelompok
tertentu obat, laporan yang serius atau fatal, atau untuk kelompok usia tertentu.
DATA MINING DENGAN PENDEKATAN LAINNYA UNTUK
DETEKSI SINYAL
Pendekatan data mining (serangkaian proses untuk menggali nilai tambah dari
suatu kumpulan data berupa pengetahuan yang selama ini tidak diketahui secara
manual) telah diadopsi oleh beberapa pusat pharmacovigilance nasional,
termasuk Belanda, Inggris, dan US.44,46,47 dan juga dengan beberapa
perusahaan farmasi. Sebuah makalah baru-baru ini menganalisis kesesuaian
antara ukuran yang berbeda (PRR, melaporkan odds ratio (ROR), dan IC) .
Suatu metode yang berbeda semua menggunakan prinsip menentukan
disproporsionalitas (ketidakseimbangan) seperti yang dijelaskan untuk PRR,
tapi teori matematika di belakang berbeda, sebagai contoh , pendekatan dan
informasi teori Bayesian mendasari BCPNN. Hasil dari studi banding adalah
bahwa tidak ada perbedaan yang jelas yang hadir, kecuali ketika ada
kekurangan dari empat laporan per obat kombinasi ADR, meskipun ini
tergantung pada probabilitas sebelum Bayesian digunakan dalam metode
mereka yang menggunakan teori Bayes '. Maka semua metode memiliki
perbedaan kelebihan dan kekurangan. Sebelum sistem deteksi sinyal parsial
otomatis dilaksankan, dianjurkan bahwa pertimbangan secara cermat diberikan
untuk alternatif yang mungkin dalam mencari yang paling praktis dan tepat
dalam pengaturan tertentu.

ASPEK PELAPORAN KUANTITATIF

Laporan kasus yang disampaikan oleh pusat-pusat nasional untuk UMC


dimasukkan dalam database WHO. Gambar 10.2 menggambarkan jumlah
kumulatif laporan yang disimpan dalam database. Di sebagian besar negara
pelaporan secara bertahap meningkat dari waktu ke waktu. Biasanya diperlukan
waktu beberapa 5-10 tahun beroperasi sebelum pelaporan mencapai tingkat
yang stabil. Jumlah laporan disampaikan ke UMC sering kurang dari yang
menerima di negara ini, karena berbagai alasan teknis. Di Perancis, laporan
yang diterima oleh badan nasional dari produsen (50%) tidak dikirim ke UMC,
tidak pula laporan tentang obat yang dipasarkan hanya di Perancis. Juga,
laporan dievaluasi tidak secara klasifikasi atau reaksi akibat overdosis
dihilangkan dari beberapa tapi tidak semua negara. Situasi AS khusus dalam hal
ini dan dijelaskan secara terpisah (lihat Bab 9). (Masalah ini juga dibahas lebih
lanjut di bawah ini, lihat "Batasan".)

Gambar 10.2. Jumlah kumulatif laporan dalam database WHO, 1968-2003.

Tidak ada standar internasional untuk praktek pharmacovigilance baik tetapi


beberapa publikasi yang berguna memberikan saran mengenai beberapa aspek

Dalam beberapa tahun terakhir telah ada peningkatan kecenderungan di


kalangan regulator untuk menuntut produsen melaporkan dugaan ADR yang
terjadi di negara-negara lain secara langsung kepada mereka, terlepas dari fakta
bahwa sebagian besar laporan tersebut sudah tersedia untuk mereka melalui
sistem WHO. Pada awalnya, persyaratan tersebut juga berarti bahwa produsen
harus melaporkan kasus ini dalam berbagai bentuk, sesuai dengan aturan yang
berbeda dan waktu penjadwalan.

Dalam rangka mengurangi beban kerja dari produsen dan meningkatkan


efektivitas biaya pelaporan internasional, sebuah inisiatif dimulai pada tahun
1986 untuk menyelaraskan aturan untuk pelaporan internasional kasus tunggal
di bawah naungan CIOMS, yang berafiliasi dengan WHO. inisiatif ini, yang
disebut "CIOMS I," kini diterima di sebagian besar negara dan oleh sebagian
besar produsen, dan telah diterima oleh ICH sebagai pedoman untuk digunakan
di Jepang, Uni Eropa, dan Amerika Serikat. Sistem ini telah pasti mengurangi
keragaman aturan dalam pelaporan internasional, meskipun variasi nasional
masih ada bahkan di negara-negara anggota ICH. Ada juga pedoman CIOMS
pada pelaporan secara elektronik dari reaksi yang merugikan bertaraf
internasional.

Baik di dalam dan luar ICH, banyak lembaga pengawasan obat yang lebih kecil
merasa bahwa mereka tidak memiliki kapasitas untuk mengatasi peningkatan
pesat pada jumlah laporan yang CIOMS I inisiatif yang dihasilkan. Mereka
lebih menyukai update keamanan secara berkala, termasuk evaluasi situasi
keamanan pada umumnya oleh perusahaan. Di beberapa negara update
keamanan seperti itu wajib, tapi sekali lagi ada perbedaan dalam aturan, format,
dan jadwal waktu. Oleh karena itu, proyek CIOMS kedua - "CIOMS II" -
dimulai untuk menyelaraskan isi, format, dan jadwal waktu untuk update
keamanan periodic, Beberapa fitur baru dari skema ini adalah:
• penciptaan "tanggal lahir" internasional untuk setiap produk obat, yang
merupakan hari persetujuan pertama di negara manapun;
• masuknya data paparan obat dan pengalaman dari kedua studi pra dan
postmarketing;
• prinsip bahwa produsen harus menulis evaluasi keselamatan keseluruhan
produk.

Update keamanan CIOMS II sekarang tidak resmi diterima oleh negara-negara


ICH dan telah dibuat menjadi pedoman diikuti oleh Uni Eropa, AS, dan Jepang.
Banyak negara lebih menerima update keamanan secara berkala sesuai dengan
format CIOMS / ICH, meskipun lagi ada beberapa variasi dalam tuntutan oleh
pihak berwenang, yang menggagalkan konsep standardisasi global lengkap
bahwa industri farmasi berupaya untuk mengurangi beban administrasi.

Parlemen Eropa mengadopsi peraturan tahun 1995 reating EMEA, yang terletak
di London, UK. Menurut peraturan ini, setiap dicurigai reaksi samping serius
yang dilaporkan ke MAH oleh seorang profesional kesehatan harus dilaporkan
kepada otoritas kesehatan negara di mana hal itu terjadi dalam waktu 15 hari.
Otoritas kesehatan juga harus melaporkan kepada EMEA dan ke MAH dalam
waktu 15 hari. MAH juga wajib melaporkan ADR terjadi di luar Uni Eropa
serta dari literatur dunia yang baik serius dan tak terduga (dikenal sebagai
berlabel: tidak sepenuhnya tercakup dalam Ringkasan Karakteristik Produk
paket insert yang menyertai produk obat). peraturan serupa yang ada di AS,
yang dijelaskan dalam Bab 8, dan di beberapa negara lain. Ini "15-hari
melaporkan" tentu memiliki keuntungan dari mendapatkan peringatan yang
cepat dari sinyal baru reaksi obat yang merugikan, tapi perlu dipertimbangkan
terhadap kebutuhan untuk tindak lanjut laporan dan kemungkinan kesalahan dan
duplikasi, yang tampaknya telah sulit untuk menghindari sejauh ini.

Masalah mengelola dan mendistribusikan sejumlah besar ADR yang dilaporkan


dalam waktu 15 hari telah menyebabkan komitmen dari berbagai negara untuk
berkomunikasi data secara elektronik. Namun, standardisasi set data dan
terminologi diperlukan untuk dilaksanakan secara efektif. MedDRA53 dan
Elektronik Standar untuk transfer peraturan Informasi diperkenalkan ke ICH
(M1 dan M2 topik) pada tahun 1994. Keduanya berlaku untuk sebelum dan
sesudah tahap pemasaran siklus regulasi (lihatwww.ich.org).

MedDRA didasarkan pada terminologi yang dikembangkan oleh Badan


Pengawasan Obat-obatan (sekarang Obat dan Badan Pengatur produk
kesehatan; MHRA) di UK. Ini memberikan spesifisitas lebih besar dari data lain
(istilah lain) yang sebelumnya digunakan reaksi terminologi yang merugikan
dan kategori pengambilan data hirarkis. Namun, itu tidak mengandung definisi
khusus dari istilah yang akan digunakan. Di kaitan ini, inisiatif CIOMS yang
diandalkan. Penggunaannya untuk pelaporan ADR akan diwajibkan di beberapa
negara, namun negara-negara lain, terutama negara-negara kecil dan
berkembang, telah menyatakan keraguan karena sumber daya komputer mereka
terbatas dan jumlah laporan mereka kecil.

KELEBIHAN

sistem pelaporan spontan relatif murah untuk beroperasi, meskipun biaya total
mereka yang sebenarnya untuk sistem peduli kesehatan, termasuk investasi
yang besar oleh industri farmasi dalam pemeliharaan mereka, tidak diketahui.
Mereka tetap satu-satunya sarana praktis yang mencakup seluruh populasi dan
semua obat. Mereka dapat membantu masalah yang signifikan pada tenaga
kesehatan dan pasien untuk diungkapkan, dikumpulkan, dan ditindaklanjuti
untuk membentuk hipotesis dari risiko obat. Satu dokter, satu apoteker, dan
seorang sekretaris biasanya dapat mengelola antara satu dan dua ribu laporan
setahun, tergantung pada jumlah pengawasan, tindak lanjut, umpan balik, dan
kegiatan lainnya yang merupakan bagian dari program. Dasar peralatan teknis
yang dibutuhkan pada investasi juga relatif kecil. Bersama dengan kualitas lain
(Tabel 10.2), beberapa yang unik, membuat salah satu sistem laporan spontan
yang penting, bahan dasar dalam sistem yang komprehensif untuk pengawasan
resiko pasca pemasaran akibat obat.

Sebuah sistem pelaporan spontan memiliki potensi untuk mencakup total


populasi pasien. Ini tidak mengesampingkan pasien yang dirawat karena
penyakit lain yang bersamaan atau mereka menggunakan produk obat lain.
Selain itu, pengawasan bisa dimulai segera setelah obat disetujui untuk
pemasaran dan tidak memiliki batas waktu bawaan. Oleh karena itu, berpotensi
paling paling efektif untuk mendeteksi ADR baru yang jarang terjadi, terutama
di sub-kelompok khusus, seperti orang tua, atau di kombinasi dengan obat lain.

Dalam sebuah analisis awal tentang bagaimana ADR penting adalah


pertama dicurigai dan kemudian diverifikasi, Venning menemukan bahwa 13
dari 18 reaksi pertama kali ditandai dengan laporan anekdotal dibuat oleh dokter
dengan pikiran terbuka dan kritis. Fakta bahwa laporan ini diterbitkan dalam
jurnal medis membawa penulis menyimpulkan bahwa sistem pelaporan spontan
pada proses persinyalan memiliki nilai yang kecil. Namun, mayoritas reaksi ini
benar-benar terdeteksi sebelum banyak sistem pelaporan spontan yang
operasional.Dimana analisis belakangan ini ada kecurigaan pertama bahwa obat
baru bisa menyebabkan agranulositosis dan sindrom Stevens-Johnson muncul,
ditemukan bahwa, untuk sebagian besar Laporan pertama muncul di database
WHO lebih dari enam bulan sebelum diterbitkan. Situasi sebaliknya adalah
ditemukan hanya dalam beberapa kasus. Beberapa sinyal tersebut diterbitkan.
Dalam kebanyakan kasus bagaimanapun sistem pelaporan spontan perlu
dilengkapi oleh sumber lain dari informasi, seperti dijelaskan di bagian pada
"aplikasi khusus, "di bawah ini.

BATASAN
Sistem pelaporan spontan terutama dimaksudkan untukmenghasilkan
sinyal tentang potensi ADR baru . Untuk memenuhi agarberfungsi dengan baik ,
harus diakui bahwa sejumlahsinyal palsu akan diproduksi dan , setiapsinyal
harus diteliti dan diverifikasi sebelum dapatditerima dan ditindaklanjuti .
Sebaiknya sinyal harus ditindaklanjuti menggunakan desain studi epidemiologi
analitikdan satu atau lebih dari sumber data yang dijelaskan dalam Bab11-24 .
Sinyal mungkin reaksi langka , sehinggakendala setiap studi epidemiologi
penting untuk pertimbangan. Mungkintidak mudah untuk membuat studi kasus -
kontrol yang akan menjawab pertanyaan tentangreaksi yang serius jarang terjadi
. Dalam hal demikian, tampaknya masuk akaluntuk memenuhi syarat hasil
dengan pernyataan seperti : " laporan spontan memberi kesan reaksi yang
merugikan x , tapi lebih lanjutStudi telah mampu mengkonfirmasi hal ini pada
kejadianlebih sering daripada . . . . "
Kerugian yang lebih serius adalah bahwa tidak semua reaksi dilaporkan
dan bahwa proporsi yang dilaporkan dalam situasi tertentu sulit untuk
memperkirakan. Sebuah kebutuhan dasar untuk laporan adalah bahwa dokter
menunjukan obat dapat menyebabkan tanda-tanda dan / atau gejala pasiennya.
Ini relatif mudah ketika tindakan farmakologis atau sifat kimia obat dapat
memprediksi reaksi. Ada juga beberapa penyakit yang dianggap sebagai
"biasanya" reaksi obat-induced, seperti reaksi agranulositosis dan kulit yang
parah, sehingga tingkat dasar kecurigaan tinggi. Namun demikian, sangat sulit
untuk membuat koneksi mental antara terapi obat dan medis jika acara
mensimulasikan umum atau spontan
Penyakit yang terjadi atau peristiwa yang tak diinginkan lainnya, yang memiliki
tidak pernah sebelumnya digambarkan sebagai obat. Beberapa contoh ini
termasuk kasus pertama oculomucocutanous yang syndrome, sindrom Guillain-
Barré, dan perubahan dalam distribusi lemak tubuh, katup jantung
strukturalperubahan, dan defek lapang pandang dengan pola tertentu. Ini juga
sulit untuk membuat hubungan mental antara obat dan medis jika ada jeda
waktu yang lama antara paparan dan penyakit. Bahkan jika dokter mencurigai
tanda-tanda dan gejala a pasien menjadi obat-induced, ketidaktahuan nilai
ADR atau aturan pelaporan, dan kerja paksa, telah diberikan sebagai alasan
untuk tidak melaporkan. Peningkatan informasi dan umpan balik oleh lembaga
nasional, sekolah medis, pabrik farmasi, dan jurna profesional yang bisa
bekerjasama memperbaiki kekurangan tersebut.
Pihak kesehatan berwenang juga memiliki peran yang jelas di sini. Ini tanggung
jawab mereka untuk memantau kualitas pelayanan kesehatan dan untuk
membangun praktek pelaporan ADR dalam sistem jaminan kualitas mereka ,
serta dalam melanjutkan pendidikan kedokteran.
Selain menunda deteksi ADR baru, underreporting menciptakan dua
masalah penting lainnya. Pertama, itu akan meremehkan frekuensi ADR dan
meremehkan pentingnya masalah. Hal ini mungkin tidak begitu serius selama
mengakui bahwa laporkan frekuensi cenderung tingkat minimum kejadian.
Lebih penting adalah bahwa tidak dilaporkan mungkin tidak acak tapi
selektif, yang mungkin menimbulkan bias yang serius. Pengaruh pelaporan
selektif menjadi berpotensi bencana jika jumlah laporan dari ADR untuk
berbeda obat dibandingkan dengan cara yang tidak kritis. Ada banyak
kemungkinan alasan untuk perbedaan jelas. Keseluruhan tingkat pelaporan telah
meningkat selama bertahun-tahun, dan pelaporan sering lebih tinggi selama
tahun-tahun pertama obat baru pada pasar ( "efek Weber" 57). Akhirnya, obat
yang diklaim sangat aman mungkin pertama dicoba pada pasien yang tidak
melakukan tolerir produk obat sebelumnya (channeling bias).
Selain itu, mungkin ada pelaporan distorsi jika ada kecurigaan atau
rumor beredar tentang obat. Contoh lain yang menarik dari laporan bias adalah
perbedaan empat kali lipat dalam laporan diare hemoragik dengan sehubungan
penjualan dua produk penisilin-v Calciopen®dan Kåvepenin® di Swedia.
Analisis situasi gagal untuk mengungkapkan perbedaan dalam dua produk.
Mereka diproduksi di pabrik yang sama dari batch yang sama dan hanya bentuk,
nama produk, dan MAH berbeda. Bagaimanapun, perbedaan dalam penggunaan
produk. Produk yang lebih lama digunakan untuk sebagian besar oleh dokter ,
oleh spesialis telinga, hidung, dan tenggorokan, dan praktisi swasta, kelompok-
kelompok yang secara tradisional tidak melaporkan ADR. Bagaimanapun harus
benar-benar menjelaskan perbedaan jelas dalam tingkat ADR, para penulis
resep yang jarang mewawancara, tapi profesional perawatan kesehatan lainnya
yang berhasil pasien 'penyakit. Penjelasan yang paling penting adalah mungkin
bahwa produk baru itu lebih sering direkomendasikan dandigunakan dalam "
pelaporan tinggi " daerah . Situasi yang sama muncul ketika minocycline
ditemukan memiliki tingkat pelaporan yang lebih tinggi untuk sindrom lupus
dan kerusakan hati , baik bersama-sama dan secara terpisah , dari tetrasiklin
lainnya .Perbedaan ini di tingkat ini mungkin disebabkan , setidaknya sebagian ,
dengan lebih penggunaan berkepanjangan dari minocycline dalam pengelolaan
muda orang dengan jerawat , dibandingkan dengan penggunaan jangka pendek
tetrasiklin lain untuk mengobati infection.58
APLIKASI TERTENTU

TANPA PENAMBAHAN DATA LAINNYA

Hal
inijarangmungkinuntukmenggunakanlaporanspontanuntukmembangunlebihdari
kecurigaandarihubungankausalantaraefeksampingdanobat, kecuali:

1.
adatidaknyasatukasusdengantantanganpositifdanbeberapakasuspendukunglainny
a yang tidaktahuobatpenggangguataupenyakit, atau

2. adaacara yang fenomenologisyang


sangatjelasterkaitdenganpaparanobattunggal, seperti

anafilaksis, atau
3. adasekelompokkasusyang dilaporkanterkenakejadianefeksamping yang
mendekatinol, dantidakadapengganggu.

Bahkanmunculnyakembaliperistiwaburukketikaobatdiberikanlagitentuadabuktik
ausalitas, kecualiinidilakukandalamkeadaandikontrolketat, yang
mungkintidaketis.Jadi, paparanobat yang menyebabkanADR
seringdisengaja.Dalamprakteknya, bagaimanapun,
satudiyakinkanbahwaadabukti yang
kuatuntukhubungankausaljikaadasekelompokkasusdenganinformasiklinis yang
baik,di manaacara yang
samatelahmunculkembalidengandiulangpaparansetidaknyasekalidalamsetiappas
ien.Hal inihanyamungkinjikaacaramedis yang dimaksudadalahtipe yang
akanberkurangatauhilangsetelahpenarikanobatdantidakmunculkembalisecaraspo
ntan. Dengandemikian, pengamatanlimakasusmeningitis aseptik yang
munculkembalidalambeberapa jam setelahmengambil trimethoprim
antibiotikuntuksalurankemihinfeksi,
akanmeyakinkankebanyakandokterbahwaobatinidapatdantidakmenyebabkanrea
ksisepertiitu.Untukkasus "hit and
run"efeksepertipenyakittromboembolidanuntukpenyakit yangbisasiklik,
informasitantangan, bagaimanapun, dapatmenyesatkan. Misalnya,
satulaporankasus yang tidakdipublikasikanterlibatseoranganakmuda yang
mengembangkanagranulositosistigakali
sehubungandenganinfeksidiobatidenganampisilin.Tidaksampaisetelahkeempatk
alinya, ketikaagranulositosisdikembangkansebelumampisilindiberikan,
bahwasikliknyaneutropenia ditemukan.Kontrasinidenganpasienyang tiga kali
mengembangkansindromGuillain-Barrésetelahvaksinasi tetanus.bahan yang
tidakdipublikasikantersebutmemilikipengaruhkebijakan.

Informasitentangtantanganrelatifjarang
dikebanyakansistempelaporanspontan.Direncanakantantanganmungkinberbahay
a, jarangdibenarkandariklinissudutpandang, dandapatmenjaditidaketis.Namun,
informasipadaeksposurpositif yang tersedia di sebanyak 13%dari 200 kasus
fatal berturut-turutdilaporkan di Nordic countries.Dalam database
pharmacovigilancePerancis,exposure dilaporkandalam 8,5% darilaporan,
positifdalam 6%.

Contohtarifmembandingkandarisekelompokacaradenganterjadinyakardiovaskul
araprindineobat.Empatkasusagranulositosisdilaporkandalamduatahunpertamaob
atdipasarkan.SebagaiInsidenagranulositosishanyalimasampaidelapan per
jutapenduduk per tahun, inimembuatkuatkasusuntuk relationship.
kausalDemikian pula, ada 25kasus yang
dikonfirmasineuropatisensorikberikutmeningitis A vaksinasi di 130 000 anak-
anak, yangjauhlebihtinggidarikejadian.

Contoh-contohinimenunjukkanbeberapacara di manalaporan ADR


dapatmenyebabkankesimpulanperusahaan yang
dibuat,danlaporantersebutmungkinsatu-satunyainformasi yang
tersedia,khususnyaselamapemasaranawalproduk.
Seharusnyatidakperluuntukmenekankanbahwalaporanharusberkualitasbaikketik
amerekaadalahsatu-satunyabukti yang digunakan!

DENGAN PENAMBAHAN DENOMINATORDATA

Saatini, sebagianbadanpengawasobat di industry


negaradanprodusenfarmasimenyusuninformasiyang
dapatdigunakanuntukmemperkirakanbaikukurandankarakteristikpopulasiterkena
dankejadianpenyakit.Di banyaknegaraadanasionalstatistikpenjualanobatdan /
resep (lihat Bab 27).Di banyaknegarainformasijualobatdanresepbersifatrahasia,
namun di negara-negaraNordikinformasiiniditerbitkansecaraberkala.
IMS Health
merupakansumberunikinformasitentangpenjualanfarmasidankebiasaanresepdala
msejumlahnegara (lihat Bab 23 dan 27).Data yang
dikumpulkanterusmeneruspadahampirsemuaprodukobat.Data
resepdiperolehdari panel rollingresep di setiapnegara,
merupakanuntukcerminancampurannasionalspesialismedisdanpraktekmedis.Dat
a-data inibukantanpakelemahanbiasaterusmeneruspengumpulan data rutin,
namunpenggunaannyatelahmemberikanbanyakwawasanpentingkedalammasalah
keamananobat.Misalnya, data
daribeberapanegaratelahdigabungkandenganinformasi ADR dari database WHO
untukmemberikanperkiraankejadiankasarmasalahobat-induced
tertentu,danperspektiftentangkemungkinanalasanuntukperbedaanpelaporan
ADR jugatelahterbuktiberguna.

CONTOH PENGGUNAAN LAPORAN SPONTAN UNTUK


MEMPERKIRAKAN RESIKO

Jika tingkat pelaporan diketahui, pembilang dapat disimpulkan dengan


beberapa akurasi. Dari studi menggunakandiagnosis register pengeluaran/debit
rumah sakit, memungkinkan untuk menghitung tingkat pelaporan untuk
beberapa daerah, untuk ADRs, dan untuk jangka waktu tertentu. Mengingat
reaksi serius seperti diskrasia darah, penyakit tromboemboli, dan sindrom
Stevens-Johnson, antara 20% dan 40% dari pasien dipulangkan dengan
diagnosa ini telah ditemukan untuk dilaporkan. Dengan mengidentifikasi semua
kultur BCG yang positif di laboratorium bakteriologi, ditemukan bahwa hampir
80% dari semua anak yang mengembangkan osteitis setelah vaksinasi BCG
telah dilaporkan. Namun, tingkat pelaporan mungkin tidak dapat digeneralisasi.
Besar tidak dilaporkannya penting untuk diketahui ketika mengevaluasi data,
tetapi tidak boleh digunakan untuk mengoreksi underreporting dalam
perhitungan karena tingkat pelaporan adalah waktu, masalah, obat, dan negara
tertentu.

Jika informasi dari sistem pelaporan spontan efisien, dapat dikombinasi


dengan informasi tentang penjualan obat dan statistik resep, memungkinkan
untuk mulai mempertimbangkan melaporkan tarif sebagai perkiraan kasar dari
tingkat frekuensi atau kejadian ADR. Perkiraan tersebut tidak pernah dapat
mencapai akurasi yang berasal dari uji klinis atau studi epidemiologi formal.
Namun, mereka dapat berfungsi sebagai indikator pertama dari ukuran masalah
potensial, dan tentu saja indikator kekhawatiran profesional kesehatan 'tentang
masalah. Untuk reaksi yang sangat jarang, mereka mungkin satu-satunya ukuran
dibayangkan.

Dengan pengetahuan dari jumlah dosis harian yang ditentukan (DDD)


terjual dan rata-rata dosis harian yang ditentukan (PDD), memungkinkan untuk
mendapatkan perkiraan kasar dari total orang-waktu eksposur untuk obat
tertentu. Jumlah kasus yang dilaporkan per pasien "waktu paparan" mungkin
kemudian menjadi sangat kasar, panduan awal untuk kejadian minimum. Jika
statistik resep tersedia, jumlah resep mungkin perkiraan yang lebih baik dari
penggunaan obat di kalangan pasien rawat jalan dari jumlah pengobatan-
mingguan dihitung dari data penjualan, terutama di mana penggunaan obat
adalahsebagian besar jangka pendek dan dosis dan waktu pengobatan mungkin
berbeda dengan usia pasien dan indikasi

Jika kejadian latar belakang penyakit diketahui atau dapat diperkirakan


dari sumber lain, kadang-kadang juga mungkin untuk menghitung perkiraan
kasar dari risiko relatif dan risiko kelebihan dari data laporan spontan ADRs
ditambah penjualan dan statistik resep. Misalnya, kasus tunggal anemia aplastik
pada pasien yang memakai acetazolamide (karbonat anhidrase penghambat
diuretik yang digunakan terutama untuk pengobatan glaukoma) telah dilaporkan
sejak obat itu diperkenalkan pada pertengahan tahun 1950-an. Tidak ada
perkiraan kejadian reaksi ini, tapi itu pasti dianggap sangat langka, mungkin
jarang daripada anemia aplastik terjadi setelah penggunaan kloramfenikol.
Antara 1972 dan 1988, 11 kasus dilaporkan terjadi di Swedia. Berdasarkan data
penjualan dan resep, itu bisa diperkirakan bahwa waktu paparan total adalah
195000 pasien tiap tahun selama periode waktu yang sama, menghasilkan
kejadian yang dilaporkan sekitar 1 dalam 20000 resep, atau 50 juta pasien tiap
tahun. Dari studi berbasis populasi anemia aplastik dimana Swedia juga
berpartisipasi, itu bisa diperkirakan bahwa total kejadian tahunan anemia
aplastik dalam kelompok usia yang relevan adalah sekitar 6 juta orang terkena.
Dalam studi case-control itu tidak mungkin untuk memperkirakan risiko relatif
untuk hubungan antara acetazolamide dan anemia aplastik, karena tidak ada
kontrol yang terkena. Namun, jika kejadian spontan dilaporkan anemia aplastik
antara orang terkena acetazolamide dibandingkan dengan total kejadian anemia
aplastik dari studi case-control, risiko relatif bisa diperkirakan sekitar 10.

Beberapa sumber potensial kesalahan dalam penelitian ini harus


dipertimbangkan. Tingkat underreporting dalam contoh ini tidak diketahui.
Namun, dalam sebuah studi tingkat pelaporan untuk anemia aplastik ditemukan
30%, dan sejak itu dilaporkan secara umum menjadi dua kali lipat. Tidak ada
hubungan yang diketahui antara glaukoma dan anemia aplastik yangbisa
bertindak sebagai perancu, tetapi beberapa pasien dilaporkan telah mengambil
obat lain selama enam bulan sebelum deteksi anemia aplastik mereka. Ada dua
pasien yang telah diobati dengan obat yang, atas dasar farmakologi klinis,
tampaknya alternatif kemungkinan yang wajar sebagai agen kausal. Namun,
keterbatasan jelas bahwa beberapa eksposur obat tidak dapat diperbaiki untuk di
analisis kasar seperti ini.

Dalam beberapa kasus telah memungkinkan untuk membandingkan


perkiraan risiko dari sebuah studi case-controlepidemiologi formal dengan
orang-orang yang berasal dari sistem pemantauan obat Swedia. Risiko relatif
untuk agranulositosis disebabkan oleh kotrimoksazoldan sulfasalazin yang
menakjubkan sama.

MENGGUNAKAN LAPORAN DATA SPONTAN UNTUK


IDENTIFIKASI MEKANISME DAN FAKTOR RESIKO

Begitu seperti yang telah ditetapkan bahwa obat dapat menyebabkan


reaksi yang merugikan tertentu, menjadi penting untuk mengidentifikasi
mekanisme yang terlibat, dan apakah setiap kelompok pasien berada pada risiko
yang sangat tinggi, dan jika ukuran apa pun dapat diambil di pasien dan / atau
tingkat populasi untuk mengurangi risiko. Biasanya banyak metode yang
berbeda harus diterapkan, baik di laboratorium dan di tingkat populasi. Sebuah
sistem pelaporan spontan yang baik dapat menjadi nilai dalam pekerjaan ini
dalam keadaan tertentu, jika data dapat dibandingkan dengan penjualan dan data
resep atau jika pasien dapat dikenakan investigasi khusus.

Misalnya, dalam salah satu penelitian terhadap karakteristik pasien


mengembangkan hipoglikemia selama pengobatan dengan glibenclamide (obat
antidiabetes oral), distribusi dosis harian yang ditentukan adalah serupa pada
pasien dengan episode hipoglikemia berat dan pada populasi umum. Namun,
pasien dirawat di rumah sakit karena hipoglikemia berat yang lebih lama dan
cenderung sebelumnya memiliki riwayat penyakit serebrovaskular.

Program farmakovigilens saat ini juga sedang di bentuk di negara


berkembang, sejak terdapatnya informasi kecil di masa lalu. Hal ini yang
memonitor populasi dengan pola lain dari morbiditas dan status gizi lain akan
membuka tipe lain dari efek samping dari pada apa yang telah kita pelajari dari
populasi dalam dunia industri, bahkan dari pembatan obat. Pengaruh dari obat
tambahan lain dengan obat tradisional, dan kegagalan yang tidak diperkirakan
oleh efikasi karena substandar atau obat palsu, akan dapat di tutupi dengan
sistem farmakovigilens. Di negara berkembang terdapat sebuah penyakit yang
tidak terlihat. Salah satu contohnya yaitu malaria, tetapi penyakit ini dan
penyakit lain sedang di obati oleh bahan kimia baru dalam program kesehatan
masyarakat besar. Farmakovigilens dan farmakoepidemiologi harus dapat
bekerja berdampingan seperti program jika resiko yang berhubungan dengan
obat dideteksi lebih awal dan terbatas.

Peran dari laporan spontan di masa depan akan lebih penting jika di
kembangkan lebih jauh. Keperluan mendasar dari hal ini adalah untuk
meningkatkan efektifitas dari arus informasi yang meningkat, secara teori
kualitatif dan kuantitatif. Sebagai contohnya, untuk meningkatkan laporan
klasik, ADR jarang seperti diskrasias darah, nekrolisis epidermal toksik, dan
kerusakan hati dan ginjal, pengkoleksian informasi otomatis dari semua pasien
yang telah di rawat inap dengan kondisi tersebut dapat dimulai. Hal ini dapat di
selesaikan melalui pengawasan secara case-control dari penyakit jarang yang
sering disebabkan oleh obat. Sebagai alternatif, manual perolehan kembali
ringkasan kasus, menyediakan informasi kualitas tinggi, atau alternatif lain
melalui transfer otomatis dari penghentian diagnosis secara komputer di rumah
sakit, dapat digunakan untuk pembelajaran seri kasus. Tentu saja, dengan sistem
otomatis, salah satu hal dapat kehilangan pengaruh kepentingan skrining dari
provider yang memikirkan efek yang dihasilkan dari suatu obat. Secara berkala
hal ini dapat memberi keuntungan untuk fokus dalam kelas obat baru tertentu
untuk mengklarifikasi spektrum ADR mereka secepatnya. (Laporan skema
ADR HIV di UK sebagai contohnya).

Tetapi, penemuan yang tidak di perkirakan akan paling mungkin


dilanjutkan untuk mengandalkan kapasitas pikiran manusia untuk
memperkirakan masa depan. Maka dari itu, hal ini adalah hal yang penting
untuk meningkatkan kesadaran tenaga medis dan bekerja sama untuk
melaporkan ADR. Sistem regional saat ini dengan keuntungan bersama, seperti
sistem prancis, rupanya lebih menjanjikan.

WHO dan UMC telah mengambil beberapa inisiatif untuk


mempromosikan kepentingan komunikasi yang efektif. Publikasi lain dalam
manajemen yang krisis di farmakovigilens juga berurusan dengan isu
komunikasi, dan publikasi Viewpoint mengarah pada menjelaskan beberapa isu
yang berhubungan dnegan farmakovigilens untuk rakyat umum. Bersama
dengan perkembangan ilmiah yang pesat, ketika inti dari farmakovigilens
adalah penemuan pengetahuan tentang keamanan obat, pencapaian ini bernilai
kecil bila tidak secara aktif mempengaruhi praktek klinik dan kebijaksanaan dan
kepatuhan pasien. Tujuan utama dari mendorong melaporkan membutuhkan
lebih dari kepercayadirian secara sains: hal ini menuntut lebih dari peningkatan
kemampuan persuasi/membujuk, motivasi, dan marketing. Beberapa negara
telah menunjukkan imajinasi yang tinggi dan kreatifitas di area ini, tetapi
pengaruh pada sains dan kesehatan masyarakat akan bergantung berat pada
yang melakukan dan pendekatan profesional untuk membuat informasi yang
relevan dan berarti dan untuk mempengaruhi tingkah laku.

Terapi medis menjadi lebih kompleks lagi. Penggunaan obat lebih dari
satu akan menyebabkan interaksi efek samping. Tidak hanya polifarmasi yang
disebabkan oleh satu dokter mengobati proses beberapa penyakit, tetapi juga
peningkatan spesialisasi yang lebih dari 1 doter dapat meresepkan tanpa
sepengetahuan lain. Maka dari itu, terdapat obat yang pasien dapat gunakan dari
peningkatan sesungguhnya pemilihan dari obat diluar kasir dan herbal, dibuat
tersedia di masyarakat canggih. Mengobati penyakit kompleks juga
membutuhkan pertimbangan terhadap interaksi antara penyakit yang sama dan
obat yang digunakan untuk target penyakit.
Hal ini jelas bahwa terdapat banyak dan lebih banyak lagi tekanan pada
dokter dan profesional kesehatan di umum. Peningkatan kekompleksan tekhnis
dan profesional dari pekerjaannya yang nyata, dan kita perlu menambahkan ke
administrasi yang meningkat dan beban bureaucratic yang mereka miliki,
termasuk pekerjaan kasar di banyak negara. Pelatihan medis belum lulus tidak
memberikan waktu yang tepat untuk efek samping sebagai hal yang paling
penting yang menyebabkan morbiditas/kesakitanl pembelajaran setelah lulus
terlalu sering terkait dengan terapi terbaru dan kepentingan dari teori yang up-
to-date dibandingkan kesadaran praktek. Disini terdapat tekanan yang tidak
kunjung berakhir pada dokter, meliputi ancaman secara hukum bahkan yang
kesalahan paling murni oleh dokter yang paling berhati-hati. Pasien diberi
informasi lebih terhadap kesehatan dan di hibur, dengan benar, untuk
memahami terapi mereka dan untuk sebagai partner yang aktif dibandingkan
dengan objek pasif dalam manajemen. Sayangnya, ketergantungan sumber
informasi sangat beragam, meliputi banyaknya jumlah sumber di internet. Hal
ini bersangkutan dengan dokter pada peningkatan kebutuhan untuk
membenarkan saran mereka terhadap terapi dan bahkan menghilangkan
kebingungan karena informasi yang berlawanan.

Latihan komunikasi yang baik dan kebutuhan teknologi informasi harus


sangat tinggi pada agenda semua orang yang menginginkan peningkatan
keamanan obat. Hal ini menawarkan satu-satunya jalan untuk menjamin
profesional kesehatan dapat dengan mudah menekspresikan masalah mereka
tentang keamanan produk obat kepada agensi yang menyusun, menganalisis,
dan menggunakan informasi untuk fokus komunikasi kembali ke profesional
kesehatandan pasien mereka di jalan yang dapat berguna pada latihan sehari-
hari, dan tidak dilihat sebelah mata untuk menambahkan informasi yang
berlebih.
Masalah tidak hanya terdapat pada informasi untuk diterima, tetapi, hal
ini saat ini tersedia sebagai isolasi, pesan yang tidak fokus. Apa yang kita
butuhkan adalah pesan yang fokus, relevan yang tersedia pada poin kritis saat
dibutuhkan: ketika dokter menuliskan resep, farmasis meracik, dan pasien di
obati.

PENGAKUAN

Kita dengan penuh terima kasih pengakuan pekerjaan dari Dr. Mary
Couper pada tinjauan bab ini dan banyak komentar membantu. Beliau telah
membuat banyak perkembangan terkini dalam program WHO disebabkan oleh
energinya yang hebat dan wawasan dalam yang perlu di perbaiki.

Kita juga mengakui pekerjaan dan ide dari banyak kolega dari, sekarang
ini, 73 negara diseluruh dunia yang secara konstan memeriahkan kita dengan
perspektif baru dan penglihatan.

Case–Control Surveillance
LYNN ROSENBERG, PATRICIA F. COOGAN and JULIE R. PALMER
Slone Epidemiology Center, Boston University, Boston, Massachusetts, USA.

PENGANTAR
Tidak ada jaminan bahwa obat, aman pada saat mereka diedarkan ke
pasar, karena premarketing percobaan untuk keamanan dan keampuhan terlalu
kecil untuk mendeteksi apapun efek samping dan terlalu singkat untuk
mendeteksi efek yang muncul setelah interval laten panjang atau jangka waktu
penggunaan. Memang, seperti yang dijelaskan dalam Bab 1, banyak obat telah
dihapus dari pasar, kadang-kadang bertahun-tahun setelah persetujuan.
Persetujuan penelitian berfungsi tidak hanya untuk mendokumentasikan efek
samping yang tidak diinginkan dari obat-obatan, tetapi juga untuk
mendokumentasikan efek menguntungkan yang tidak terkait dengan indikasi
untuk digunakan. Dokumentasi keamanan jangka panjang juga penting,
terutama untuk obat yang banyak digunakan oleh orang yang sehat. Karena
obat-obat yang digunakan untuk kondisi kronis cenderung akan diambil secara
teratur dan untuk waktu yang lama, mungkin ada efek kesehatan yang tidak
diinginkan. Di sisi lain, penarikan obat dari pasar karena kekhawatiran yang
ternyata tidak berdasar, tidak akan melayani kesehatan masyarakat .
Kebutuhan untuk pengawasan obat resep jelas. Namun, obat tanpa resep
juga dapat memiliki efek samping yang serius dan manfaat yang tidak
diinginkan. Semakin banyak obat yang sebelumnya hanya tersedia dengan resep
dokter, seperti ibuprofen, naproxen, dan cimetidine, sedang disetujui untuk
over-the-counter penjualan, dan perubahan dari resep untuk penjualan tanpa
resep sering mengakibatkan peningkatan besar dalam penggunaan. Sampai saat
ini, sebagian besar over-the-counter obat yang digunakan untuk kondisi
membatasi diri akut . Namun, wilayah terapi yang saat ini sedang
dipertimbangkan oleh perusahaan farmasi untuk perubahan dari resep untuk
penjualan tanpa resep termasuk hiperkolesterolemia, osteoporosis, hipertensi,
dan depresi.
Penggunaan suplemen makanan, termasuk suplemen herbal, telah
meningkat secara dramatis dalam beberapa tahun terakhir. Dalam Survei Slone,
survei berkelanjutan sampel acak dari populasi Amerika Serikat yang dilakukan
oleh Slone Epidemiology Center, masing-masing dari 10 suplemen telah
diambil pada minggu sebelumnya oleh setidaknya 1% dari populasi selama
tahun 1998 sampai 2001. Diet suplemen sering diresepkan sendiri untuk banyak
alasan yang sama bahwa "tradisional" resep dan tanpa resep obat yang
digunakan. Suplemen yang dijual over-the-counter dan mereka tidak harus
terbukti berkhasiat atau aman sebelum dipasarkan. Mengingat digunakan secara
luas, potensi mereka untuk bertindak sebagai karsinogen, dan pengaruh mereka
mungkin pada tindakan estrogen dan metabolisme, suplemen makanan harus
dipantau untuk efek tak terduga pada terjadinya kanker dan penyakit lainnya.
studi kohort, seperti studi keterkaitan data farmasi dengan data hasil, tokoh
menonjol di antara strategi postmarketing sedang digunakan. Studi ini berguna
untuk memantau obat resep tetapi umumnya kekurangan informasi tentang obat
tanpa resep dan suplemen makanan. Mereka juga bermasalah untuk
dokumentasi efek karsinogenik yang mungkin terjadi lama setelah inisiasi
penggunaan narkoba. Kami telah mengembangkan sistem surveilans, Case-
Control Surveillance (CCS), yang menggunakan metodologi kasus-kontrol
secara sistematis mengevaluasi dan mendeteksi efek dari obat-obatan dan
eksposur lainnya pada risiko penyakit serius, terutama kanker. CCS meliputi
pemantauan obat tanpa resep dan suplemen makanan serta obat resep. CCS juga
termasuk komponen biologis yang memungkinkan untuk penilaian apakah
polimorfisme genetik memodifikasi efek dari obat atau suplemen pada risiko
penyakit.

DESKRIPSI GAMBARAN
CCS dimulai pada tahun 1976 ketika AS Food and Drug Administration
(FDA) menyediakan dana untuk pemantauan penyakit nonmalignant dan ganas
dalam kaitannya dengan penggunaan obat-obatan. Karena kekhawatiran tentang
efek obat pada risiko kanker (misalnya, postmenopause penggunaan hormon
wanita pada risiko kanker endometrium), kami mengusahakan dana untuk
melanjutkan CCS, dengan fokus pada kanker. National Cancer Institute telah
menyediakan dana untuk tujuan itu sejak tahun 1988. Dalam CCS, studi kasus-
kontrol beberapa dilakukan secara bersamaan. Individu dengan kanker yang
baru didiagnosis atau kondisi nonmalignant yang diwawancarai dalam satu set
rumah sakit yang berpartisipasi. Informasi diperoleh dengan wawancara standar
pada sejarah masa penggunaan obat secara teratur dan faktor-faktor yang
mungkin membingungkan atau mengubah asosiasi-penyakit obat. penggunaan
narkoba rawat inap umumnya tidak tercatat. Ringkasan debit diperoleh untuk
semua pasien, dan laporan patologi untuk pasien dengan kanker. Sebuah
komponen biologis ditambahkan pada tahun 1998: peserta memberikan sampel
sel pipi dari mana DNA diekstraksi dan disimpan. Sejak awal penelitian, lebih
dari 70 000 pasien telah diwawancarai, di antaranya sekitar 25.000 baru-baru ini
didiagnosis kanker primer dari berbagai situs.
CCS database digunakan untuk pengujian hipotesis dan penemuan.
Analisis mendalam dari data yang dilakukan untuk menyelidiki hipotesis yang
muncul dari berbagai sumber. Data juga "disaring" secara berkala dengan cara
beberapa perbandingan untuk menemukan asosiasi baru. persetujuan dewan
review kelembagaan telah diperoleh dari semua lembaga berkolaborasi, dan
studi mematuhi semua Asuransi Kesehatan Portabilitas dan Akuntabilitas Act
persyaratan (HIPAA). Semua peserta menyediakan persetujuan tertulis secara
terpisah untuk wawancara dan untuk sampel sel bukal.

METODE

Kasus dan Kontrol Identifikasi dan Accrual

Kolaborasi antar intitusi-intitusi yang terletak di beberapa area geografis, telah


berubah dari waktu ke waktu. Jaringan saat ini, diawasi oleh Dr Brian Strom,
yang terdiri dari tujuh pengajar dan rumah sakit masyarakat di Philadelphia.
Rumah sakit di Baltimore, Boston, New York, dan daerah lainnya telah
berpartisipasi dalam masa lalu.

Secara khusus perawat-pewawancara yang telah terlatih dipekerjakan oleh CCS,


wawancara pasien dewasa berusia 21-79 tahun di rumah sakit. Pewawancara
mendaftarkan pasien baru-baru ini didiagnosis kanker atau yang baru
didiagnosis gangguan nonmalignant; yang terakhir berfungsi sebagai kolam
kontrol potensial di analisis kasus-kontrol, dan dari waktu ke waktu kontrol
diagnosis mungkin itu sendiri menarik sebagai hasilnya (misalnya,
kolesistitis,penyakit inflamasi pada panggul). Pasien dengan kondisi onset akut
(misalnya, luka trauma, radang usus buntu) sesuai di kontrol dengan berbagai
analisis, dan mereka secara selektif masih harus dibayar. Untuk kondisi lebih
kronis (misalnya, gangguan ortopedi, batu ginjal), perekrutan terbatas pada
pasien yang diagnosisnya dibuat dalam tahun sebelumnya. Hanya pasien yang
tinggal di daerah yang berjarak sekitar 50 mil dari rumah sakit yang memenuhi
syarat; pewawancara memiliki daftar yang menerima ZIP Kode dan hanya
pasien yang berada di daerah-daerah tertentu yang diwawancarai.Untuk
menambah daya tarik kasus spesial, pewawancara selektif mencari pasien
dengan diagnosa tertentu yang sesuai untuk daftar prioritas. Pewawancara
menemukan kasus melalui berbagai metode, termasuk daftar penerimaan
memeriksa dan grafik pasien. Jika pewawancara memiliki pilihan
mewawancarai pasien dengan prioritas kanker dan pasien dengan kanker dari
situs lain, prioritas kanker akan dipilih. Pewawancara mencoba untuk
mewawancarai semua kasus baru tapi tetap rumah sakit yang memilih dan
pasien sering melakukan tes, perawatan, dan pengunjungan. Dengan demikian,
dalam prakteknya, pewawancara mendaftarkan semua pasien yang tersedia.
Pasien direkrut tanpa pengetahuan tentang status pajanan mereka. Penulis
menginformasikan isi yang diperoleh sebelum wawancara dilakukan.
Wawancara pengaturan-rumah sakit atau ruang klinik adalah serupa untuk kasus
dan kontrol. Pewawancara tidak menyadari jika pasien adalah "kasus" atau
"kontrol" karena banyak penyakit dan hipotesis dinilai, dan kasus dalam satu
analisis mungkin menjadi kontrol lain.

Tingkat partisipasi di CCS melebihi 90% sebelum dimasukkannya


pengumpulan sampel sel pipi. Setelah Selain komponen biologis ini, sekitar
20% dari pasien telah menolak untuk berpartisipasi. Saat ini, di antara 80% dari
pasien yang setuju untuk diwawancarai, sekitar 95% memberikan sampel sel
pipi. Pasien yang setuju untuk memberikan suatu sampel biologis pada
wawancara serupa di usia dan jenis kelamin bagi mereka yang berpartisipasi
hanya dalam wawancara; pasien berkulit putih sedikit lebih mungkin untuk
berpartisipasi dalam komponen biologis dari pasien berkulit hitam.

Tabel 11.1 menunjukkan jumlah pasien yang baru didiagnosis kanker dari
berbagai situs yang telah diakui dalam CCS sejak tahun 1976 di empat pusat
terbesar di mana CCS dioperasikan-Baltimore, Boston, New York City, dan
Philadelphia. Semua tabel berikutnya mengacu pada yang sama empat daerah.
CCS saat ini termasuk 7160 pasien dengan payudara kanker, sekitar 2700
dengan kanker usus besar, setidaknya 1000 masing-masing dengan kanker paru-
paru, melanoma ganas, kanker prostat, atau kanker ovarium, dan setidaknya 500
masing-masing dengan endometrium kanker, leukemia, kanker kandung kemih,
kanker pankreas, non limfoma Hodgkin, atau kanker ginjal.

Tabel 11.2 mencantumkan diagnosa lebih umum di antara pasien mengakui


untuk kondisi nonmalignant. Pasien-pasien ini melayani sebagai kontrol untuk
analisis berbagai jenis kanker, meskipun dalam beberapa kasus diagnosa
nonmalignant sendiri telah dinilai sebagai hasil dari bunga. Antara diagnosa
nonmalignant paling umum adalah trauma cedera (misalnya, lengan patah),
neoplasma jinak, infeksi akut (Misalnya, usus buntu), gangguan ortopedik
(misalnya, gangguan disc), penyakit kandung empedu, dan hernia.
Tabel 11.1. Kasus kanker insiden yang dipilih situs yang masih harus dibayar di
CCS sejak tahun 1976; Baltimore, Boston, New York City, dan Philadelphia

Tabel 11.2. Pasien dengan kondisi nonmalignant masih harus dibayar di CCS
sejak tahun 1976; Baltimore, Boston,New York City, dan Philadelphia
Data Wawancara

Informasi Obat

Tidak (mudah/mungkin) untuk bertanya secara spesifik tentang ribuan


entitas obat individu. Sebaliknya, sejarah penggunaan obat diperoleh dengan
menanyakan tentang penggunaan terhadap 43 indikasi atau kategori obat,
misalnya, sakit kepala, penurun kolesterol, kontrasepsi oral, gejala menopause,
herbal/suplemen makanan. Nama obat dan waktu, durasi, dan frekuensi
penggunaan dicatat untuk setiap penggunaan. Dosis obat tercatat ketika itu
menjadi bagian dari nama dagang, Misalnya, untuk kontrasepsi oral dan
estrogen terkonjugasi ,nama dagang terkadang menunjukkan dosis.

Tabel 11.3 Penggunaan obat-obatan terpilih dan penggolongan obat dalam CCS
1976–2003 and 1998–2003; Baltimore, Boston, New York City, and
Philadelphia

Category 1976–2003 1998–2003


(n = 61 672) (%) (n=4317) (%)
Aspirin-containing drugs 47.5 30.5
47.5
Oral contraceptives 42.0 55.5
(women only)
Acetaminophen- 38.9 55.3
containing
drugs
Conjugated estrogens 23.7 34.6
(women aged 50+)
Benzodiazepines 20.8 12.3
Thiazide diuretics 14.2 9.2
Ibuprofen 13.7 32.7
Phenylpropranolamine 9.6 2.7
Beta-adrenergic blockers 8.7 11.8
Histamine H2 7.4 16.4
antagonists
Phenothiazines 4.2 2.6
Calcium channel 3.9 13.0
blockers
Oral anticoagulants 3.9 6.7
Phenolphthalein 3.8 0.7
laxatives
Aromatic 3.7 2.5
anticonvulsants
Naproxen 3.3 8.1
Phenobarbital 2.6 1.0
Indomethacin 2.5 1.1
Insulin 2.3 4.1
Statins 1.6 13.2
Selective serotonin 1.3 9.5
uptake inhibitors

Ribuan pengobatan spesifik berbeda telah dilaporkan. Tabel 11.3


menunjukkan prevalensi laporan penggunaan obat-obatan terpilih dan
penggolongan obat yang mana telah ditandai mengalami perubahan pada
(prevalensi/rata-rata) dari waktu ke waktu. Kolom kiri menunjukkan prevalensi
pasien CCS yang diwawancarai pada tahun 1976 – 2003, dan
kolom kanan menunjukan prevalensi antara pasien yang diwawancarai pada
tahun 1998-2003. Ada peningkatan besar dalam beberapa tahun terakhir dalam
penggunaan asetaminofen, berbagai obat anti-inflamasi non steroid, antagonis
histamin H2, calcium channel blockers, statin, dan selective serotonin reuptake.
Beberapa peningkatan ini timbul sebagai bagian untuk mengubah resep menjadi
penjualan tanpa resep; Misalnya, Cimetidine antagonis histamin H2, dan
ibuprofen NSAID.

Dalam beberapa tahun terakhir, pasien CCS telah meningkat dilaporkan


penggunaan suplemen makanan. Tahun 2000-2003, penggunaan glucosamine
dilaporkan oleh 1,5%, ginkgo biloba 1,3%, echinacea sebesar 1,2%, dan ginseng
dengan 0,9%. Tabel 11.4 dan 11.5 menunjukkan frekuensi penggunaan yang
paling sering dilaporkan obat-obatan dan kelas obat oleh CCS peserta 1976-
2003.

Tabel 11.4. Penggunaan obat-obatan yang dipilih dalam/pada CCS, 1976-


2003;Baltimore, Boston, New York City, dan Philadelphia.

DRUG NAME %
Aspirin 32 Iron 13
Acetaminophen 29 Tetracycline 8
Ascorbic acid 20 Ampicillin 7
Diazepam 14 Erythromycin 6
Ibuprofen 14 Aluminum hydroxide gel 6
Tocopherol acetate 13 Hydrochlorothiazide 6
Cortisone 6 Cyanocobalamin 3
Prednisone 6 Percodan® 3
Guaifenesin 5 Acetaminophen with codeine 3
Furosemide 5 Midol® 3
Vitamin B complex 4 Diphenhydramine HCl 2
Synalgos 4 Indomethacin 2
Propranolol HCl 4 Psyllium hydrophilic colloid 2
Bufferin® 4 Codeine 2
Cimetidine 4 Pseudoephedrine HCl 2
Calcium 4 Potassium chloride 2
Triamterene/hydrochlorothiazide 4 Chlorpheniramine maleate 2
Miconazole nitrate 4 Nitroglycerin 2
Chlordiazepoxide HCl 3 Contoz® 2
Vitamin A 3 Sulfisoxazole 2
Ranitidine HCl 3 Digoxin 2
Levothyroxine sodium 3 Yellow phenolphthalein 2
Warfarin sodium 3 Nyquil® 2
Propoxyphene HCl 3 Diphenoxylate HCl/atropine S04 2
Norinyl 3 Milk of magnesia 2
Oxycodone/APAP 3 Thyroid 2
Aluminum hydroxide/magnesium Fiorinal® 2
hydroxide 3 Trimethoprim/sulfamethoxazole 2
Methyldopa 3 Excedrin® 2

CASE–CONTROL PENGAMATAN

Tabel 11.5. Penggunaan golongan obat yang dipilih di CCS, 1976-2003;


Baltimore, Boston, New York City, dan Philadelphia.
DRUG CLASS %
Vitamins/minerals 62 Codeine 6
Aspirin-containing drugs 47 Conjugated estrogens 6
Acetaminaphen-containing drugs 39 Antifungals 6
Iron 36 Barbiturates 6
Oral contraceptives 26 Thyroid supplements 6
Folic acid 26 Guaifenesin 6
Antihistamines 24 Antidepressants 5
Estrogens 22 Furosemide 5
Benzodiazepines 21 Phenothiazines 4
Corticosteroids 17 Docusate salts 4
Narcotic pain formulas 16 Calcium channel blockers 4
Vitamin A 15 Oral anticoagulants 4
Antacids 15 Hypnotics and tranquilizers 4
Thiazides 14 Cephalosporins 4
Diazepam 14 Aromatic anticonvulsants 4
Ibuprofen 14 Tricyclic antidepressants 4
Sulfonamides 13 Naproxen 3
Laxatives 11 Methyldopa 3
Folic acid antagonists 10 Antimalarials 3
Tetracyclines 10 Sulfonylureas 3
Phenylpropanolamine 10 Nitrates 3
Calcium salts 10 ACE inhibitors 3
Beta-adrenergic blockers 9 Xanthines (excludes caffeine) 3
Ampicillin/amoxicillin 8 Phenobarbital 3
Phenacetin 8 Cardiac glycosides 2
Pseudoephedrine 8 Indomethacin 2
Histamine H2 antagonists 7 Digitalis 2
Macrolide antibiotics 7
Insulin 2 kunjungan ke dokter di masing-masing dua tahun
Meprobamate 2 sebelumnya). faktor-faktor ini mungkin menarik di
Heparin 2 kanan mereka sendiri sebagai faktor risiko.
Statins 2
Other anti-hyperlipidemics 2 Informasi Rekam Medis Rumah Sakit
Aminoglycosides 2
Salinan ringkasan di rumah sakit, diperoleh dari setiap
pasien yang terdaftar dalam studi patologi untuk semua
Informasi Tentang Faktor-Faktor Lain
pasien kanker. Hal ini telah dikaji di kantor pusat oleh
Dari Obat.
study nurse coordinator, karena gagal dalam
Informasi tentang banyak faktor yang
mengkategorikan, maka diklasifikasikan atau dibedakan
dapat mengacaukan atau memodifikasi
dengan diagnosis.
hubungan penyakit dengan obat secara
rutin dikumpulkan: deskriptif Buccal Cell Sample
karakteristik (misalnya, usia, tinggi, Pengambilan sel Buccal untuk sampeldari pasien CCS
berat badan saat ini, berat badan 10 dimulai pada tahun 1998. Pasien yang setuju,
tahun yang lalu, berat badan pada usia memberikan sampelnya dengan menggosok pada
20, tahun pendidikan, perkawinan bagian dalam tiap pipi dengan kuas (2 sampel tiap
status, ras kelompok / etnis), pasien). Metode pengumpulan DNA ini cocok untuk
kebiasaan (merokok, alkohol pasien rumah sakit karena ini tidak
konsumsi, konsumsi kopi), ginekologi membahayakan.Sampel dikirim ke laboratorium untuk
dan reproduksi faktor (usia pada pengambilan dan penyimpanan DNA. Sampel yang
kelahiran pertama, paritas, usia saat diperoleh dengan cara ini telah berhasil untuk gen
menarche dan menopause, dan jenis polimorfisme NAT2-341, dan membuktikan kualitas
menopause), riwayat kesehatan serta kuantitas dari DNA-29 yang diambil. DNA yang
(Kanker, hipertensi, diabetes, penyakit disimpan berfungsi sebagai sumberdaya untuk
serius lainnya, vasektomi, mengidentifikasi subgrup yang mungkin dapat
histerektomi, ooforektomi), riwayat meningkatkan resiko tertentu yang berkaitan dengan
keluarga kanker, penggunaan genotype, serta untuk menjelaskan mekanisme dari
perawatan medis (misalnya, jumlah
carconigenesis. Metabolisme yang mengandung Acetaminopheen terkandung dalam
carcinogen, termasuk obat, yang Acetaminophen coalition, total kurang lebih 450
mungkin melibatkan gen yang produk. Penggabungan dari obat lain juga telah
mengatur monooksigenasi tahap 1 dan dibentuk seperti inhibitor selective serotonin re uptake,
tahap 2 serta konjugasi dari clacium channel blocker, antidepresan trisiklik, diuretik
carcinogen yang potensial. thiazide, dan benzodiazepine.

Drug Dictionary Data Analysis (Hypothesis testing)

Kelompok penelitian yang ada selama Case and Control Specification


ini memiliki kamus obat. Kamus ini
Untuk analisis, digunakan case series, misalnya: wanita
adalah sistem komputerisasi linkage
yang didiagnosis kanker payudara invasive kurang dari
yang terdiri dari obat individu dan
satu tahun telah dicatat secara keseluruhan dalam suatu
multikomponen produk. Setiap
laporan penyakit. Kontrol yang tepat harus diterapkan
produknya diberi kode nomor tertentu.
agar terjamin validitasnya. Untuk paparan pada
Semua produk kombinasi
masalah, kontrol harus sesuai dengan kondisi yang tidak
dihubungkan dengan komponennya
dapat dicegah, atau diobati. Pendekatan dilakukan
masing-masing, dengan
dengan memilih tiga atau empat kategori diagnosa yang
pengelompokan, obat yang
sesuai jumlah untuk dapat melakukan pemeriksaan
mengandung zat tertentu dapat lebih
keseragaman dari paparan dalam seluruh kategori. jika
mudah dibentuk. Misalnya Tylenol,
penilaian tentangseleksi kontrol adalah benar,
terkandung dalam 50 produk berkode
prevalensi informasi itu akan seragam dengan seluruh
yang ada dalam drug dictionary.
tes diagnostik yang dipilih untuk analisis.
Konstituen dari produk dapat
diperoleh dari dictionary tersebut,
misal : Tylenol cold effervescent Aspect of Drug Use
formula, mengandung
Kami menilai mulai menggunakan setidaknya satu
Acetaminophen, Chlorpheniramine
tahun sebelum masuk, karena penggunaan onset yang
maleas, dan phenylpropanolamine
paling baru tidak dapat mendahului timbulnya kanker.
HCL. Produk Tylenol dan produk lain
Menurut pada hipotesis, kategori obat kita ditempatkan pada penggunaan biasa (misalnya,
yang berbeda adalah yang paling setidaknya 4 kali seminggu selama minimal 3 bulan ) ,
menarik. Contohnya, untuk kanker dan terutama pada penggunaan biasa selama beberapa
payudara, analisis fokus terhadap tahun atau lebih.
penggunaan obat yang berpotensi Waktu penggunaan juga mungkin relevan.
rentan selama masa reproduksi Dalam analisis kami data CCS pada obat anti-
(misalnya segera setelah menstruasi, inflammatory drugs dan kanker usus besar, kita
sebelum kelahiran anak pertama di menemukan bahwa penggunaan yang telah berhenti
masa lalu). Obat tertentu atau regimen setidaknya satu tahun sebelumnya tidak berhubungan
obat juga relevan, contoh : resiko dengan risiko, sedangkan
kanker endometrium meningkat penggunaan yang terus berlanjut tahun sebelumnya
dengan dengan suplemen estrogen, dikaitkan dengan rasio odds berkurang. Keduanya
tetapi sedikit atau tidak terjadi apabila memiliki hubungan yang telah disarankan oleh data
digunakan kombinasi estrogen dan hewan. Selain itu, ada kelebihan dari kasus di antara
progesteron. pengguna terakhir, menunjukkan penghentian
penggunaan yang mungkin karena gejala, tidak
Pengamatan efek yang lebih besar dan
menjelaskan hubungan terbalik dengan penggunaan
lebih sering atau penggunaan durasi
yang berlanjut ke tahun sebelumnya. "Laten interval"
panjang menyediakan dukungan peran
analisis mungkin dapat fokus pada apakah efek muncul
kausal. Beberapa obat , terutama obat
setelah lama digunakan. Sebagai contoh, analisis dalam
non - resep seperti aspirin , NSAID
penilaian kami dari paparan non-obat, vasektomi dalam
lainnya , dan acetaminophen , yang
kaitannya dengan 10 risiko kanker dianggap interval
sering digunakan secara sporadis.
antara vasektomi dan terjadinya juga terjadinya kanker.
Penggunaan sporadis tidak dapat
Yang terpenting juga adalah berapa lama peningkatan
dilaporkan secara akurat .Selain itu,
atau mengurangi rasio odds tetap setelah paparan telah
penggunaan rutin lebih cenderung
terjadi. Misalnya, dalam penilaian kami dari risiko
memiliki peran etiologi dari
kanker ovarium dalam kaitannya dengan penggunaan
penggunaan sporadis . Dengan
kontrasepsi oral, penurunan pengguna berlangsung
demikian , ketergantungan terbesar
selama 15-19 tahun setelah penghentian penggunaan,
memperluas periode sebelumnya, yang model regresi jika inklusi mereka secara material
telah diperkirakan sekitar 10-15 tahun. mengubah rasio odds misalnya sebesar 10 % atau lebih
Dosis obat yang dulu .
digunakan sulit untuk dipelajari karena Pengaruh Modifikasi
tidak akurat recall. Misalnya, wanita subkelompok tertentu mungkin sangat rentan atau
umumnya menggunakan beberapa sangat dilindungi oleh pencahayaan. Modifikasi efek
merek yang berbeda dari kontrasepsi dinilai dengan memeriksa hubungan paparan – penyakit
oral dan mereka memiliki kesulitan dalam subkelompok dan oleh pemodelan statistik ,
mengingat merek (dengan dosis) seperti penggunaan istilah interaksi dalam regresi
secara akurat. Oleh karena itu, kita logistik . Sebagai contoh, dalam analisis kami suplemen
tidak meminta untuk dosis obat yang estrogen dalam kaitannya dengan risiko kanker
digunakan, meskipun nama obat payudara, temuan secara keseluruhan nol tapi
kadang-kadang menunjukkan dosis. penggunaan suplemen dikaitkan dengan peningkatan
Untuk semua obat, frekuensi risiko kanker payudara di kalangan wanita kurus ,
penggunaan dan durasi memberikan seperti yang diamati di tempat lain. Kita umumnya
ukuran yang berguna dari intensitas menguji interaksi ditentukan apriori atas dasar hasil
paparan. penelitian sebelumnya atau yang masuk akal secara
biologis.
Pengendalian Faktor Kekuatan statistik
pengganggu CCS memiliki kekuatan statistik yang sangat baik untuk
Odds rasio ( 95% interval confidence ) deteksi hubungan yang penting dalam kesehatan
diperkirakan dari beberapa analysis masyarakat . Tabel 11.6 menunjukkan ukuran sampel
regresi logistik. Kami pertama yang dibutuhkan 80% kekuatan untuk mendeteksi
mengidentifikasi faktor potensial yang berbagai rasio odds dalam berbagai paparan prevalensi .
menggagalkan yaitu , faktor risiko Obat / Analisis Genotipe
untuk penyakit berhubungan penting Apakah hubungan antara paparan obat dan kanker
dengan penggunaan obat antara dimodifikasi oleh genotipe yang diwarisi dinilai dalam
kontrol. Faktor potensial yang dua cara : dengan memeriksa hubungan penggunaan
menggagalkan dikendalikan dalam
obat dengan risiko kanker dalam strata CCS,
mereka dengan dan tanpa genotipe atau setelah analisis di mana ada hati-hati spesifikasi
penting dan dengan dimasukkannya. dari kasus dan kontrol kelompok dan kontrol untuk
Penemuan Asosiasi Tak pembaur selain faktor usia, jenis kelamin, dan pusat
terduga studi. Kita melaksanakan analisis mendalam dari
Data hewan dapat menyebabkan asosiasi baru jika Asosiasi direplikasi dalam data yang
identifikasi asosiasi baru dalam data dikumpulkan di CCS di tahun-tahun berikutnya,
CCS . Misalnya , percobaan pada dijelaskan dengan sangat masuk akal mekanisme, atau
hewan pengerat disarankan bahwa kepentingan kesehatan masyarakat. Non-obat
obat anti – inflamasi mungkin merupakan faktor yang juga diputar, dan itu dalam
mengurangi terjadinya kanker usus perjalanan lampiran seperti yang kami amati asosiasi
besar. Sebuah analisis data CCS tak terduga antara penggunaan alkohol dan kanker
mengungkapkan hubungan terbalik payudara. Contoh asosiasi tak terduga lainnya dari
kanker usus besar dengan penggunaan screening adalah penggunaan kontrasepsi oral dengan
aspirin ,yang sejak itu telah koriokarsinoma dan dengan prnyakit Crohn. Semua
dikonfirmasi dalam banyak studi. asosiasi ini telah menerima konfirmasi independen.
Asosiasi juga diidentifikasi oleh Untuk validitas temuan lampiran adalah munculnya
sistematis "Screening" dari data, banyak asosiasi dikenal yang ditemukan sebelumnya,
dimana prevalensi penggunaan dari seperti peningkatan risiko infark miokard dan
obat tertentu atau kelas obat (standar tromboemboli vena yang berhubungan dengan
untuk usia, jenis kelamin, dan rumah menggunakan kontrasepsi oral.
sakit) di antara pasien dengan kanker
Asosiasi yang timbul dalam beberapa
tertentu atau penyakit lain yang
perbandingan mungkin saja terjadi karena kebetulan.
menarik dibandingkan dengan
Bahkan jika asosiasi tidak karena kebetulan, besarnya
prevalensi di antara pasien dengan
asosiasi akan cenderung "regresi dengan rata-rata" pada
penyakit lain. Sering hubungan yang
studi berikutnya. Untuk alasan ini, asosiasi baru
signifikan (p <0,05) terlihat di
disajikan dengan sangat hati-hati.
lampiran menghilang sekali lebih
lanjut kasus dan kontrol terdaftar di
KEKUATAN penyakit adalah penting untuk kesehatan masyarakat.
PENILAIAN NON-RESEP CCS telah mendokumentasikan efek samping
PENGOBATAN DAN SUPLEMEN dari obat-obatan, seperti peningkatan risiko kanker hati
MAKANAN SERTA dan kanker payudara terkait dengan penggunaan
PENGOBATAN RESEP kontrasepsi oral, dan peningkatan risiko kanker
endometrium lokal dan maju terkait dengan
CCS dapat digunakan untuk pascamenopause estrogen penggunaan suplemen. Efek
menguji hipotesis mengenai pelindung juga telah didokumentasikan dengan Data
penggunaan semua melaporkan resep CCS, misalnya, penggunaan kontrasepsi oral yang
obat dari sumber manapun. berhubungan dengan risiko penurunan kanker ovarium
Pemantauan sistem yang dan endometrium, dan penggunaan aspirin dikaitkan
mengandalkan data farmasi dapat dengan risiko penurunan kanker kolorektal dan kanker
menilai hanya mereka obat yang perut. CCS sering mendokumentasikan keamanan obat
diresepkan dalam sistem; resep setelah alarm dibesarkan tentang efek samping.
diperoleh di tempat lain (misalnya, Misalnya, dalam percobaan pada hewan pengerat
klinik keluarga berencana, teman, dan diberikan phenolphthalein, agen yang digunakan dalam
kerabat) tidak dapat dinilai. Terkadang obat pencahar non-resep, ada peningkatan risiko
obat yang diresepkan tidak diambil, beberapa kanker. FDA menyebutkan data manusia pada
yang merupakan kerugian pertanyaan ini. CCS merespon dan menemukan tidak
mengandalkan data resep. ada peningkatan risiko. Sebuah penelitian kohort kecil
CCS adalah satu-satunya sistem menunjukkan bahwa calcium channel blockers
pengawasan yang sistematis menilai meningkatkan risiko beberapa kanker; bahwa hasil jauh
penggunaan produk non-resep, baik lebih besar dari basis data dimana CCS membantah
obat-obatan non-resep dan suplemen temuan itu. Data hewan mengangkat kekhawatiran
makanan. Itu prevalensi penggunaan bahwa benzodiazepin meningkatkan risiko beberapa
suplemen makanan telah menjadi kanker; Data dari CCS adalah tidak ada. Data hewan
penilaian yang cukup tinggi bahwa mengangkat kemungkinan peningkatan risiko kanker
pengaruhnya terhadap terjadinya yang berhubungan dengan penggunaan hydralazine;
hasil CCS yang tidak ada/batal.
Banyak kasus-kontrol atau sistem ini memiliki kapasitas untuk penemuanasosiasi
penelitian kohort telah melaporkan tak terduga. Sebagai contoh, hubungan berbanding
pada obat yang dipilih, seperti terbalik yang terjadi
estrogen tanpa kontrasepsi atau antara penggunaan aspirin dan risiko kanker kolorektal
kontrasepsi oral, namun informasi didokumentasikandi CCS. Penelitian ini mempublikasi
yang komprehensif tentang berbagai 40penelitian selanjutnya yang terprovokasi, yang telah
obat tidak dikumpulkan secara rutin. dikonfirmasi oleh asosiasi.
Efek dari banyak obat belum dinilai The National Cancer Institute menemukan temuan yang
baik. CCS telah disediakan data menjadi potensi penting dalam kesehatan masyarakat
tentang risiko berbagai hasil dalam yang cukup untukmendukung uji coba secara acak dari
kaitannya dengan berbagai obat, aspirin sebagai pencegahan
termasuk inhibitor ACE, polip kolon. Asosiasi lain ditemukan di CCS
acetaminophen, antidepresan, adalahasosiasi positif dari penggunaan kontrasepsi oral
antihistamin, aspirin dan NSAID jangka panjangdengan 59 penyakit kehamilan trofoblas
lainnya, benzodiazepin, beta blocker-dan 60 penyakit crohn dan konsumsi alkohol dengan
androgenik, calcium channel blockers, resiko peningkatan kangker payudarah 58 asosiasi ini
suplemen hormon wanita, hydralazine, telah dikonfirmasi dalam penelitian berikutnya 61-65.
kontrasepsi oral , phenolphthalein
yang mengandung obat pencahar,
PENILAIAN EFEK SAMPING SETELAH
fenotiazin, alkaloid rauwolfia, selektif
INTERVAL ATAU PENGGUNAAN JANGKA
serotonin reuptake inhibitor, statin,
PANJANG
tiazid, dan suplemen tiroid (lihat daftar
publikasi di Lampiran). Karena efek obat, terutama efek karsinogenik,akan

PENEMUAN TAK TERDUGA terlihat jelas setelah bertahun-tahun lamanya, sangat


ASOSIASI penting untuk menggunakan sistem pengawasan yang
tepat untuk menilai laten dalam interval atau jangka
waktu yang panjang. Kasus desain kontrol yang
Karena CCS memperoleh data pada
digunakan oleh CCS ini efisien untuk menilai efek dari
banyak eksposur dan banyakhasil,
eksposur yang terjadi di masa lalu atau setelahjangka
waktu yang panjang. Misalnya, CCS seperti riwayat penyakit dan berkaitan erat dengan
mendokumentasikanbahwa efek risiko penyakit. CCS sistematismengumpulkan
samping dari suplemen estrogen pada informasi rinci tentang potensi pembaur yang menjadi
risiko faktor penting dalam hal ini. Ini termasuk karakteristik
kanker endometrium berlangsung demografi,aspek sejarah medis, reproduksi dan
selama 15-19 tahun setelah ginekologisejarah, riwayat keluarga kanker,
penghentian penggunaan suplemen penggunaan tembakau dan alkohol,
tersebut.25 studi Cohort yang dan menggunakan perawatan medis, selain
digunakan tidak cocok untuk penilaian menggunakan resepdan obat non-resep dan suplemen
inikecuali penelitian telah makanan. Dengan demikian, diharapkan dapat
mengumpulkan informasi selama 37 mengendalikan faktor-faktor dalam
tahun. multivariabelanalisis.

AKURASI HASIL DATA

CCS mengumpulkan informasi dan merekan data pasien


193 PENGAWASAN KASUS penderita kangker yang ada dalam suatu rumah
CONTROL yang sakit.Dengan data yang didapat secara akurat dapat
MEMBINGUNGKAN mengklasifikasikandiagnosis pada pasien yang dirawat.

TINGGI DAYA STATISTIK


Dalam penelitian observasional, faktor
yang mempengaruhi pengendalian
CCS telah memperoleh data yang besar, dengan
sangat penting
sejumlah yang besar terhadap
untuk divaliditas. Seperti halnya
pasien penderita kanker dan berbagai penyakitnya dari
penggunaan narkoba adalah kegiatan
berbagai situs (Tabel 11.1). Obat atau banyak golongan
yang berhubungan dengan kesehatan
obat telah diambilsetidaknya 1% dari populasi (Tabel
dan dihubungkandengan faktor-faktor
11.4 dan 11.5).
CCS memiliki kekuatan statistik yang subkelompok yang didefinisikan olehpolimorfisme
tinggi terhadap studi kohort relatif, genetik atau tidak, polimorfisme genetik adalah
sangat penting untuk menilai efek dan polimorf yang memodifikasi obat untuk asosiasi
eksposur yang baik bagi kesehatan penyakit . Ini dapat berfungsibaik untuk
masyarakat. Seperti terlihat pada mengidentifikasi populasirentan dan untuk menjelaskan
Tabel 11.6, keanehan kecil pada rasio mekanismenya.
yang terkait dengan pajanan obat
jarang terdeteksidalam penyakit
PRODUKTIVITAS DAN SUBSTANTIFTEMUAN
penyakit kangker. Pada umum dalam
38 penyakit kanker, terdapat rasio
keanehan yang terjadi terkait dengan CCS telah sangat produktif dalam makalah yang
eksposur yang lebih umum telahditerbitkan (lihat Lampiran79). Beberapa asosiasi
dapatterdeteksi. Untuk kanker yang yang telah dinilai dijelaskan secara singkat dalam bab
sangat langka, hanya efek yang relatif ini.
besar hanya dapatterditeksi untuk
eksposur relatif umum. Namun, KELEMAHANPOTENSI BIAS
jumlah yang memadai dari kasus
kanker langka akandisebabkan oleh
Bias Seleksi
paparan ketika rasio keanehan
Dalam studi kasus-kontrol berbasis populasi diharapkan
besardan paparan umum.
dapat bekerja optimal. CCS berbasis populasi yaNG
tidak layak untuk logistik dengan alasan anggaran.
BIOLOGIS KOMPONEN Bahkan dalam data berbasis populasi, namun pada
kasus dan kontrol ditemukan bias yang terjadi karena

efek yang merugikanatau tidak adanya partisipasi yang terkait. Di CCS, tingkat
menguntungkan obat yang tak terduga partisipasi yang tinggi dapat mengurangipotensi
mungkin terbatas pada subkelompok bias.Selain itu, kasus-kasus di CCS adalah orang orang
yang rentan. CCS memilikikapasitas dengan berbagai kanker yang dirawat di rumah sakit
untuk menilai apakah mereka dan berada di bawah pengawasan, mereka
mendefinisikandasar sekunder yang adanya bias seleksi.untuk mengetahui bias lainnya,
terdiri dari anggota yang terdapat penyakit yang tidak terkait dengan obat dan paparan
didalam populasi dan pada umumnya yang dipermasalahkan dapat dimasukkan dalam
pasien yang dirawat di rumah sakit penilaian relasi tersebut untuk hasil yang menarik.
yang samauntuk mengembangkan Misalnya, penilaian acetaminophen dalam kaitannya
Pendaftaran cancer. Pada 82-84, kasus dengan risiko transisikanker sel, kami juga menilai
dan kontrol yang tinggal dalam waktu kanker sel ginjal karena yang terakhir hasilnya belum
kurang lebih 50 mildari rumah sakit terkait dengan penggunaan acetaminophen.
terbatas . hal ini bertujuan untuk
Recall bias
menyertakan pasien hanya pada pasien
dari menengah dan mengecualikan Diinginkannyauntukmemperoleh data

rujukan dari luarbahwa basis. Tentu eksposurberdasarkancatatanygakuratdanlengkap,


saja, pola rujukan untuk kanker yang denganperingatanbahwa orang

berbeda hasilnya jugabisa tidakselalumengisiresepataumengambilobat yang

berbeda.Dalam analisis risiko kanker diresepkan.Studivalidasipenggunaanresepobat yang

tertentu, kita sering memilih kelompok dilaporkanyaitupadaumumnyasulit di AS karena orang


kontrol pasien dengan kanker lainnya, mendapatkanobatdaribanyaksumber, catatan yang

ini dinilai tidak efisien dengan seringtidakada, dantariff partisipasiygmungkin

eksposur, kontrol tersebut suboptimal.Karena kami percayabahwabaru-

mungkinperwakilan dari basis yang baruiniataupenggunaanjangkapanjangyg paling diingat,


sama dengan kasus yang sama. kitafokuspadakategoriini.Literaturtentangvalidasipengg
Sementara pada kelompok kontrol unaannarkobamenunjukkanbahwapenggunaanbaru-
mengakui untuk kondisi kanker ganas baruinidankontrasepsi
dijaga terhadap kemungkinan bahwa oraljangkapanjangdansuplemenhormonwanitadilaporka
paparan dapat menyebabkan ndenganditerimaketepatan; nama-namaproduk yang
semuakanker. Kami memeriksa kurangbaik
keseragaman paparan yang menarik di reported.Studivalidasirelatifsedikitreseplainnya.obattela
berbagai kategori kontrol, hmenghasilkanhasil yang variabel,

keseragaman menunjukkantidak dengankesepakatanterbaik, untukobat yang


digunakansecarajangkapanjang, hatimencarimasalalumerekasebagaikasuspasienuntukka
sepertiuntuk diabetes dan nker.Sebagaimemeriksapelaporan bias,
hypertension.Peninjauanvalidasi kitadapatmenilaisuatuobatataukelasobat yang
studies dihalaman 43 tidakterkaitdenganhasilnya.Misalnya, beta-blockerdan
menyimpulkanbahwapelaporandipeng ACE inhibitor
aruhiolehjenisobatdanpenggunaannark dinilaidalamanalisisberisikokankerdalamkaitannyadeng
obapola (misalnya, pelaporan yang ancalcium channel
lebihbaikuntukkronisdigunakanresep) blockers,karenagolonganobattidakdikaitkandengan
danolehdesain data koleksi. (Lihatjuga factor risikokankernondifferential
Bab 45.)Untuk non-resepobat-
obatandansuplemen diet,
validasitidaklayakkarenacatatanpengg Kesalahanklasifikasinondifferential
unaantidakada. underascertainmentnondifferentialpenggunaannar

CCS mengurangipelaporan bias kobaakanmelemahkanasosiasi. Sebagaicontoh,

(yaitu, efeknyapada "true" odds rasio 3, 2, dan 1,5 dari 30%

pelaporandiferensialolehkasusdankont underascertainmentpenggunaannarkoba di

rol) kalangankasusdankontroluntukberbagai "true"

denganmenggunakanwawancaraterstru prevalensikontroldi paparanadalahdiberikandalamTabel


kturygsangatsamadanpengaturanwawa 11.7.
ncara yang Sementaraefeknondifferentialunderascertainmentadalah
samauntukkasusdankontrol.Pasiendita untukestimasiuntukbergerakkearahnol, perubahankecil,
nyatentang 43 tidaklebihdari10% dalamkasusterburuk.Efek yang

indikasiuntukpenggunaannarkobadank tentusajalebihkeciljikaunderascertainmentpenggunaann
elasobat.Pendekataninihipotesistentan arkobakurangdari
gnarkobatertentu.Selanjutnya, control 30%.Demikian,kesalahanklasifikasinondifferentialmung
pasienmengakuuntuk yang kinhanyamemilikiefekkecilpadarasio odds

kondisiseriusnonmalignant diperkirakanuntukeksposur yang menarikdi CCS.

adalahcenderunghati- Prevalensikontrolpenggunaannarkoba
3,0 True odds 1,5 n di bagiansebelumnya, CCS
ratio 2,0 telahmendokumentasikanpeningkatanrisiko,penurunanri
Observed siko, dantidakadanyaresiko. Selainitu, CCS
odds ratio memilikihasilhipotesisbaru yang penting, mungkin yang
15% 2,7 1,9 1,5 paling
10% 2,8 1,9 1,5 pentingadalahasosiasipositifdarialkoholldengankankerp
5% 2,9 2,0 1,5 ayudaradanhubunganterbalikdariobatnonsteroid anti-
1% 3,0 2,0 1,5 inflamasidengankankerususbesar.Sekarang,
Table 11.7 diamatirasio odds apaPenggunaansuplemenmakanantelahmenyebarluas,
diberikan 30% underascertainment CCS akanmenilaiefekkesehatan yang
dari penggunaan narkoba dalam kasus-tidakdiinginkandariagenini. Kapanisu-isutertentutimbul,
kasus dan kontrol sistemdapatmengarahkanuntukbertambahselektifpadaka
hasilakhirdarivaliditasCCS suspenyakit yang menarik,
adalahapakahpenelitianmerekadikonfir tapipenyakitsangatlangkaberada di luarlingkup CCS
masiyang danpemantauan system rutinlainnya.
dilakukandenganmenggunakanmetode
yang berbeda. Hasil CCS telahberkali- Ruanglingkup CCS yangluas,
kali menghasilkandarihasiltes. dengankontribusibesaryang
telahdilakukanuntukevaluasiefekkesehatanberbagaiobat
dalamkaitannyadenganberbagaipenyakit.Dalambeberap
atahunterakhir,
Aplikasitertentu telahadafokuskhususpadanonpresepobat-obatan,
sepertinonsteroidbanyakdigunakanobat anti-inflamasi,
CCS sebagianbesardiperoleh over-the-counter.Penyakit yang
memilikikapasitasuntukmenilairisikop dinilaimeliputikankerpayudara, kankerovarium,kanker
enyakitterkaituntukmenggunakanresep endometrium, koriokarsinoma, kankerprostat,
obat, obat non-resep, dansuplemen besarkankerususdankankerpencernaanlainnya,
diet yang kankerparu-paru,melanoma, kankerhati,
dilaporkanolehpeserta.sepertidijelaska penyakitradangpanggul, kolesistitis,dantromboemboli
vena. Obat- adanya resiko. Selain itu, CCS telah menghasilkan
obatandankelasobattermasuk ACE hipotesis baru yang penting, mungkin yang paling
inhibitor, acetaminophen,antidepresan, penting adalah hubungan positif dari alkohol dengan
antihistamin, aspirin dan NSAID kanker payudara dan hubungan terbalik obat anti-
lainnya, inflamasi nonsteroid dengan kanker usus besar. Saat ini
benzodiazepin, beta-blockers, calciumpenggunaan suplemen makanan telah menyebar luas,
channel CCS akan menilai efek kesehatan yang tidak diinginkan
blockers,suplemenhormonwanita, dari bahan ini. Ketika isu-isu tertentu muncul, sistem
hydralazine, dapat mengarahkan untuk lebih selektif terhadap
kontrasepsioral,phenolphthalein, bertambahnya kasus penyakit yang menarik, tapi
fenotiazin, rauwolfiaalkaloid,statin, penyakit sangat jarang berada di luar lingkup CCS dan
tiazid, dansuplementiroid. CCS system pemantauan rutin lainnya.
jugamemilikiuntukmembuatkontribusi
Ruang lingkup CCS cukup luas luas, dengan
penilaianefekkesehatanfaktor non-
kontribusi besar yang telah dilakukan untuk
obat, seperti tar
mengevaluasi efek kesehatan dari berbagai obat dalam
dannikotinygterdapatdalamrokok,
kaitannya dengan berbagai penyakit. Dalam beberapa
mentolrokok, alkoholdankonsumsi
tahun terakhir, telah ada fokus khusus pada obat-obatan
kopi, danvasektomi.
non-resep, seperti non-steroid anti-inflamasi yang
APLIKASI TERTENTU
digunakan secara luas, sebagian besar diperoleh melalui
CCS memiliki kapasitas untuk counter. Penyakit yang dikaji meliputi kanker payudara,
mengkaji risiko penyakit dalam kanker ovarium, kanker endometrium, koriokarsinoma,
kaitannya dengan penggunaan obat kanker prostat, kanker usus besar dan kanker
resep, obat non-resep, dan suplemen pencernaan lainnya, kanker paru-paru, melanoma,
makanan yang dilaporkan oleh kanker hati, penyakit radang panggul, kolesistitis, dan
partisipan. Seperti dijelaskan di bagian tromboemboli vena. Obat-obatan dan golongan obat
sebelumnya, CCS telah yang dikaji meliputi ACE inhibitor, acetaminophen,
mendokumentasikan peningkatan antidepresan, antihistamin, aspirin dan NSAID lainnya,
risiko, penurunan risiko, dan tidak benzodiazepin, beta-blockers, calcium channel
blockers, suplemen hormon wanita, makanan telah menyebar secara luas. CCS akan
hydralazine, kontrasepsi oral,melaksanakan pemantauan obat over-the-counter yang
phenolphthalein, fenotiazin, alkaloid masih baru dan yang sudah lama, dan suplemen
rauwolfia, statin, tiazid , dan suplemen makanan.
tiroid. CCS juga telah membuat
Beberapa obat menjadi perhatian khusus. Statin,
kontribusi untuk penilaian efek
yang pertama diperkenalkan ke pasar pada tahun 1987,
kesehatan dari faktor non-obat, seperti
adalah salah satu obat yang paling banyak digunakan di
tar dan kadar nikotin rokok, rokok
Amerika Serikat. Data dari dalam percobaan in vitro
mentol, alkohol dan konsumsi kopi,
menunjukkan bahwa statin dapat memiliki potensi
dan vasektomi.
kemopreventif pada berbagai situs, tetapi ada juga
MASA MENDATANG kekhawatiran mengenai potensi untuk meningkatkan
risiko kanker. Selective serotonin reuptake inhibitor
penggunaan obat di Amerika
juga banyak digunakan, seringkali oleh orang yang
Serikat tersebar luas dan meningkat,
sehat. Sebuah laporan terbaru dari tiga kasus neoplasia
sebagian didorong oleh pemasaran
payudara di kalangan orang-orang yang mengkonsumsi
langsung kepada konsumen. obat
SSRI menimbulkan kekhawatiran bahwa obat ini dapat
resep baru terus diperkenalkan ke
mempengaruhi Insidensi kanker payudara. antagonis H2
pasar. Sampai obat dan suplemen telah
histamin mungkin memiliki efek stimulasi pada sistem
digunakan oleh sejumlah orang yang
kekebalan tubuh. Kini telah dikemukakan bahwa
cukup besar dalam periode cukup
cimetidine bisa mencegah kanker prostat, tetapi ada
lama, efek kesehatan mereka tidak
juga ada kekhawatiran tentang kemungkinan adanya
dapat dan tidak akan dimonitor secara
kenaikan risiko kanker payudara. obat anti-inflamasi
memadai.
nonsteroid juga membutuhkan perhatian terus karena
CCS akan terus memantau efek digunakan secara luas, dan karena adanya pengenalan
obat yang diresepkan. Peralihan dari obat baru. Hubungan terbalik dalampemakaian dengan
resep ke counter penjualan telah risiko kanker usus besar telah meningkatkan minat
meningkat dalam beberapa
tahun dalam pengkajian efek potensial pada tempat kanker
terakhir, dan penggunaan suplemen lainnya. Efek kesehatan dari suplemen makanan yang
hampir seluruhnya tidak diketahui; farmasi, yang diakui dalam makalah yang didasarkan
CCS dapat memusatkan perhatian pada dukungan mereka.
yang kaitannya dengan risiko kanker.
( Hal. 194 Particular Application-195
Pengetahuan tentang tindakan
Acknowledgments)
polimorfisme genetik telah meningkat
pesat dalam beberapa tahun terakhir.
Gen dengan variabilitas alel yang MASA MENDATANG
mengatur metabolisme obat mungkin
Di masa depan, PEM bertujuan untuk
merupakan kandidat untuk modifikasi
memanfaatkan perbaikan dalam teknologi informasi,
dari hubungan kanker obat. CCS akan
penerapan desain studi tambahan seperti studi case-
memiliki kapasitas untuk mengkaji
control bertingkat, dan penerapan perkembangan
hipotesis yang masuk akal yang timbul
biologis baru seperti pharmacogenetics untuk
di masa depan tentang modifikasi efek
meningkatkan proses PEM. Modifikasi metode PEM
obat pada risiko kanker oleh
kadang-kadang diperlukan untuk memeriksa pertanyaan
polimorfisme genetik.
keamanan obat tertentu. Selain itu, ada kemungkinan
untuk memodifikasi proses PEM mengkaji pertanyaan
PERNYATAAN RESMI terkait dengan manajemen risiko produk obat yang
dipasarkan.

CCS berawal pada tahun 1975 STUDI CASE-CONTROL BERTINGKAT


oleh Dr Samuel Shapiro dan
PEM kohort memberikan kesempatan untuk
almarhum Dr Dennis Slone. Awalnya
melakukan studi kasus-kontrol, misalnya, untuk pasien
didukung oleh kontrak dari Food and
yang mengembangkan ADR terpilih dan pasien yang
Drug Administration AS. Sejak tahun
sesuai menerima obat yang sama tanpa
1988, CCS telah didukung oleh
mengembangkan ADR. Sebuah studi case-control
National Cancer Institute (CA45762).
direncanakan untuk mempelajari pasien yang
Dukungan tambahan ini untuk
dilaporkan telah memiliki kejadian jantung iskemik
menganalisis data yang telah
dalam kelompok pengguna dari tadalafil PDE5 inhibitor
disediakan oleh berbagai perusahaan
dan kontrol yang sesuai, untuk
meneliti faktor-faktor risiko kejadian
seperti hipertensi, merokok, dll. Ada
rencana untuk memperluas ruang
lingkup untuk aplikasi studi kasus-
kontrol bertingkat ke PEM.
12 yangdianggap secara medis dibenarkan. Pasien akan
Prescription-Event Monitoring mengambil resep dari apoteker, apoteker lalu akan
SAAD A.W. SHAKIR memberikan obat berdasarkan resep dan kemudian
Drug Safety Research Unit, mengirimkan resep untuk Otoritas Harga Resep pusat
Southampton, UK. (PPA) untuk penggantian. DSRU ini, pengaturan secara
rahasia, dilengkapi dengan elektronik salinan dari
DESKRIPSI semua resep yang dikeluarkan di seluruh Inggris untuk
bisa di pantau penggunaan obatnya. Produk yang dipilih
Pada proses PEM diringkas dalam
untuk
(Gambar 12.1). Di Inggris, hampir
Penelitian oleh PEM adalah obat baru yang diharapkan
semua pasien terdaftar padaNational
akan banyak digunakan oleh dokter; dalam beberapa
Health Service (NHS) dan
kasus DSRU tidak dapat mempelajari produk yang
praktisiumum (GP), yang
cocok karena sumber daya yang terbatas. Selain itu, di
menyediakanperawatan medis secara
DSRU melakukan kajian pada produk yang didirikan
primer dan bertindak sebagai pintu
ketika ada alasan untuk melakukannya, misalnya,
gerbang ke spesialis danperawatan
indikasi baru atau memperluas penggunaan untuk
rumah sakit. File catatan dalam
populasi baru. Koleksi data paparan biasanya dimulai
praktek umum di Inggristermasuk
segera setelah obatbaru
tidak hanya informasi yang diperoleh
telah diluncurkan atau dipasarkan.
dalam perawatan primer tetapidata
Pengaturan ini bertujuan untuk waktu yang lama yang
tentang semua kontak dengan
diperlukan untuk DSRU dalam pengumpulan pertama
perawatan sekunder dan tersier,seperti
pada 50.000 resep yang mengidentifikasi 20.000-30.000
pada surat dari klinik spesialis, rumah
pasien yang akan diberikan obat baru yang akan
sakit, dan hasil laboratorium dan
dipantau. Untuk setiap pasien di setiap penelitian PEM,
pemeriksaan lainnya. Ini adalah rekor
yang DSRU mempersiapkan pemanjangan record
seumur hidup; ketika pasien bergerak
komputerisasi dalam penulisan tanggal penggunaan
ke daerah baru,semua catatannya
obat. Dengan demikian, dalam PEM, data yang
dikirim ke GP barunya.GP akan
terpapardalam lingkup nasional akan memberikan
mengeluarkan resep untuk obat
informasi pada kelompok pertama yang akan menerima
obat yang sedang dipantau setelah dan penyebab dari kematian. Tanda warna Hijau
diluncurkan ke penggunaan secara meliputi definisi “proses” yaitu setiap baru diagnosis,
klinis dalam sehari-hari. Data paparan alasan untuk rujukan ke konsultan atau masuk ke rumah
obat baik yang diresepkan dan sakit, setiap kerusakan tak terduga (atau perbaikan)
dikeluarkan, tetapi ada ukuran dalam penyakit secara bersamaan, setiap reaksi obat
kepatuhan. Setelah selang waktu 3-12,yang dicurigai, setiap perubahan kepentingan klinis
tetapi biasanya 6, bulan dari tanggal laboratorium atau keluhan lain yang dianggap cukup
resep pertama untuk setiap pasien penting untuk masuk dalam catatan pasien atau reka
dalam kelompok, DSRU mengirimkan medik.
ke prescriber "bentuk warna hijau"
dalam kuesioner dilakukan untuk DSRU memberitahukan PPA obat baru
mencari informasi pada setiap yang akan dipelajari
"kejadian" yang mungkin terjadi saat
pasien mengkonsumsi obat atau di Pasien membutuhkan resep dari
bulan-bulan setelah dikonsumsi. Hal apoteker
ini terjadi secara individu pada pasien.
Untuk membatasi beban kerja dokter,
Apoteker memberikan obat dan meneruskan resep untuk PPA
maka tidak ada dokter yangcopy resep
atau
meresepkan obat dengan bentuk tanda
warna hijau dalam satu bulan. Bentuk PPA mengirimkan data resep untuk DSRU
warna hijau, diilustrasikan pada yang dijamin kerahasiaannya
Gambar 12.2, dimaksudkan untuk
menjadi sederhana. Ini meminta DSRU mengirimkan kuesioner (bentuk
informasi tentang usia, indikasi untuk hijau) untuk GP
pengobatan, dosis, tanggal mulai dan
menghentikan tanggal (durasi GP mengembalikani kuesioner untuk DSRU setelah
pengobatan), alasan untuk berhenti lebih dalam
dalam terapi, semua peristiwa yang
telah terjadi sejak awal pengobatan,
Data dari kuesioner yang
dimasukkan pada
database DSRU

tindak
an
lanjut
an

Menyeleksi Pada Kematian


angka kondisi Penyebab
kejadian kehamilan kematian
daftar Daftar
pertanyaan pertanyaan
yang akan yang akan
dikirim ke dikirim ke
GP GP untuk
hasil lebih
lanjut

Gambar 12.1 Proses PEM


Setelah selang waktu 3-12 bulan, tetapi biasanya 6
bulan dari tanggal resep pertama untuk setiap pasien
dalam kelompok, yang DSRU mengirimkan ke
prescriber "formulir hijau" kuesioner mencari informasi
pada setiap "peristiwa" yang mungkin terjadi saat
pasien mengambil obat atau di bulan-bulan berikutnya.
Ini terjadi secara individu pada pasien. "tambahan" pertanyaan dalam bentuk hijau. Pertanyaan
Untuk membatasi beban kerja dokter, tersebutseperti bertujuan untuk menguji aspek seperti
tidak ada dokter yang dikirim lebih pengganggu oleh indikasi, penyakit bersama, dan obat-
dari empat formulir hijau dalam satu obatan secara bersamaan.Misalnya, bentuk hijau dalam
bulan. formulir hijau, diilustrasikan studi PEM dari COX-2 inhibitor, misalnya, celecoxib,
pada Gambar 12.2, dimaksudkan termasuk obat tentang riwayat kondisi dispepsia, dan
untuk menjadi sederhana. Ini meminta bentuk-bentuk hijau untuk studi PEM dariPDE5
informasi tentang usia, indikasi untuk inhibitor untuk disfungsi ereksi, seperti sildenafil,
pengobatan, dosis, mulai tanggal dan termasuk obat tentang riwayat penyakit kardiovaskular.
berhenti tanggal (durasi pengobatan),
GP tidak dibayar untuk memberikan informasi
alasan untuk menghentikan terapi,
kepada DSRU, yang disediakan, dalam kondisi
semua peristiwa yang telah terjadi
kepercayaan medis, untuk kepentingan keamanan obat.
sejak awal pengobatan, dan penyebab
Sistem ini menyediakan kontak yang baik dengan
dari kematian jika berlaku.
dokter dan memfasilitasi pengumpulan ada tindak lanjut
Formulir hijau meliputi
atau data tambahan yang dianggap perlu oleh penelitian
definisi "acara," yaitu: "setiap
para ilmuwan / dokter memantau setiap studi dan
diagnosis baru, alasan untuk rujukan
bekerja dalam DSRU. Tabel 12.1 berisi daftar kategori
ke konsultan atau masuk ke rumah
peristiwa medis yang tindak lanjut yang dicari oleh
sakit, setiap kerusakan tak terduga
rekan-rekan peneliti. Tabel 12.2 daftar peristiwa medis
(atau perbaikan) dalam penyakit
serius yang telah dikaitkan dengan penggunaan obat-
bersamaan, setiap reaksi obat yang
obatan; Informasi tindak lanjut dicari untuk ini juga.
dicurigai, setiap perubahan
Semua kehamilan dilaporkan selama pengobatan atau
kepentingan klinis nilai laboratorium
dalam waktu tiga bulan menghentikan obat
atau keluhan lain yang dianggap
ditindaklanjuti untuk menentukan hasilnya.
cukup penting untuk masuk dalam
catatan pasien. " PEM mengumpulkan data dan tidak meminta

Sebuah perkembangan baru dokter untuk menentukan apakah peristiwa tertentu


dalam proses PEM adalah merupakan ADR.
dimasukkannya sejumlah kecil
Tabel 12.1. Data yang menindaklanjuti  edema angioneurotic
informasi dicari dari dokter  aritmia
 sumsum tulang yang abnormal
• efek samping medis penting
dilaporkan selama pengembangan  kelainan bawaan
premarketing  dermatitis eksfoliatif
 Disseminated intravascular coagulation
• peristiwa medis penting dilaporkan
 eritema multiforme
selama postmarketing di negara lain
 eritroderma
(produk yang diperkenalkan di tempat
 Sindrom Guillain-Barré
lain sebelum Inggris)
 gagal hati
• peristiwa medis penting dianggap  Hepatitis
kemungkinan terkait dengan produk  Penyakit kuning
selama PEM
 Leukopenia
• Semua kehamilan  kegagalan multiorgan
 nefritis
• Setiap kematian yang penyebabnya
 sindrom nefrotik
tidak diketahui atau yang mungkin
 sindrom neuroleptik ganas
berhubungan dengan obat
 neutropenia
• Laporan overdosis dan bunuh diri
 pankreatitis
 pansitopenia
 kolitis pseudomembran
Tabel12.2. Efek samping serius yang
 Gagal ginjal akut
telahterkait dengan penggunaan obat-
 fibrosis retroperitoneal
obatan.
 Sindrom Stevens-Johnson
 Agranulositosis  Kematian mendadak yang tak terduga
 Alveolitis  Trombositopenia
 anemia aplastik  Torsade de pointes
 anafilaksis  Nekrolisis epidermal toksik
 Setiap event yang ada positif re- Ringkasan dokter (sebagian dekat mungkin dengan
tantangan istilah yang digunakan oleh dokter pelaporan, misalnya,
crescendo angina) dan 1720 istilah-tingkat yang lebih
Daftar ini didasarkan pada daftar
rendah dipetakan ke 1185 istilah-tingkat yang lebih
serupa yang digunakan oleh
tinggi , yang berjarak
ObatBadan Pengawasan (MCA), UK.
analisis sementara dari data komputerisasi biasanya
Namun, jika suatu peristiwa dianggap dilakukan setiap 2.500 pasien di setiap studi dan kontak
sebagai ADR atau telah dilaporkan yang ada, bila memungkinkan, dipelihara dengan
dengan cara skema "kartu kuning", memegang perusahaan
maka dokter diminta untuk lisensi produk, sehingga perusahaan farmasi (Meskipun
menunjukkan ini pada formulir hijau. penelitian independen dari mereka) dapat mematuhi

Setiap bentuk hijau terlihat oleh dengan prosedur pelaporan keamanan obat dari
petugas medis atau ilmiah yang peraturan berwenang. Berdasarkan data dari 88 studi
memantau studi di DSRU. Ulasan PEM dilakukan sampai saat ini, tingkat GP respon
awal ini bertujuan untuk (persentase bentuk hijau kembali) telah 56,0% ± SD
mengidentifikasi ADR serius mungkin 8,3%. Mean ukuran kelompok telah 10 942 pasien.
atau peristiwa yang memerlukan Periode pengumpulan (waktu yang sudah diperlukan
tindakan, misalnya, komunikasi untuk mengumpulkan resep menghasilkan ukuran
eksternal atau dipercepat tindak lanjut. kelompok rata-rata lebih dari 10 000 pasien) bervariasi
nyata tergantung pada penggunaan obat. The DSRU
Data dikodekan dan dimasukkan ke
adalah nirlaba medis yang terdaftar independen
dalam database menggunakan kamus
organisasi yang terkait dengan University of
hirarkis, diatur oleh kelas sistem-organ
Portsmouth. Satuan ini secara luas didukung oleh
dengan spesifik istilah "rendah"
sumbangan dan hibah dari industri farmasi. Obat-obatan
dikelompokkan bersama di bawah
yang akan dipantau
yang lebih luas istilah "lebih tinggi".
dipilih oleh DSRU, preferensi diberikan kepada inovatif
The DSRU kamus telah
obat-obatan yang dimaksudkan untuk digunakan secara
dikembangkan selama 20 tahun
luas. Semua Daftar Studi PEM tersedia di website
terakhir dan berisi 11 640 hal
DSRU ini yang sebenarnya terjadi dalam sehari-hari praktek
(Www.dsru.org). klinis. Ini sebagian besar mengatasi masalah membuat
data percobaan klinis benar-benar mewakili
KEKUATAN keseluruhan populasi yang akan menerima obat.
Sebagai contoh, PEM Studi ini mencakup resep tanpa
PEM memiliki sejumlah izin dan unlabelled, misalnya, tanpa izin resep untuk
kekuatan yang penting. Pertama, anak-anak.
seperti yang ditunjukkan Ketiga, seperti ditunjukkan di atas, data eksposur
di atas, metode ini non-intervensi PEM yang berasal dari resep ditiadakan. Mengingat
lingkungan dan tidak mengganggu jumlah besar pasien yang tidak mendapatkan resep
pengobatan dokter sesuai menganggap ditiadakan, ini merupakan keuntungan dibandingkan
sebagai yang paling tepat untuk dengan database pharmacoepidemiologic yang
masing-masing pasien. Informasi mengandalkan data resep.
dikumpulkan setelah keputusan resep Keempat, karena data yang bersangkutan dengan
telah dibuat dan diimplementasikan. peristiwa, Metode bisa mendeteksi reaksi yang
Ini berarti bahwa dalam PEM, data merugikan atau sindrom yang tidak dilaporkan dan
dikumpulkan pada pasien yang akan duga oleh dokter terjadi karena obat. Yang database
menerima obat tersebut dalam sehari- memungkinkan studi penyakit serta drugs. Kedua
hari praktek klinis dan bukan pada keunggulan ini sejalan dengan proposal awal Finney
beberapa kelompok yang sangat pada acara reporting.
dipilih dari pasien yang mungkin non Kelima, metode ini memungkinkan kontak dekat
wakil dari "dunia nyata" populasi. antara staf penelitian di DSRU dan dokter pelaporan.
Dengan cara ini, sistem menghindari Ini memfasilitasi tindak lanjut dari peristiwa penting,
masalah generalisasi yang melekat kehamilan, kematian, dll (Tabel 12.1 dan 12.2), dan
dalam uji klinis acak, termasuk banyak memungkinkan untuk maksimal pemahaman klinis
uji klinis keamanan postmarketing. pembaur dan bias, dan sejarah alam dari ADR.
Kedua, metode ini nasional Keenam, metode meminta dokter untuk mengisi
dalam skala dan memberikan "Dunia form hijau dan tidak bergantung pada dokter
nyata" data yang menunjukkan apa mengambil inisiatif melaporkan. Ini "mendorong" efek
PEM yang paling penting; dua diperoleh di Form hijau awal, informasi lebih rinci
penelitian telah menunjukkan bahwa tentang obat bersamaan dapat diperoleh untuk kasus-
pelaporan ADR lebih lengkap dalam kasus yang dipilih, misalnya, peristiwa medis penting,
PEM daripada di spontan pelaporan selama masa tindak lanjut.
ADR sistem, seperti sistem kartu Kesembilan, sejumlah besar studi PEM selesai
kuning di UK. memungkinkan perbandingan profil keamanan obat di
Ketujuh, metode ini telah groups yang sama terapi Hal ini juga memungkinkan
terbukti berhasil dalam memproduksi untuk melakukan perbandingan dengan data Eksternal.
secara teratur data pada 10 000 atau Akhirnya, metode pharmacoepidemiologic saling
lebih pasien yang diberikan obat baru melengkapi. PEM dapat mengevaluasi sinyal yang
dipasarkan yang, berdasarkan dihasilkan dalam sistem lainnya atau database.
keberhasilan mereka dalam pasar, Demikian pula, ia menyediakan suatu teknik yang dapat
melibatkan paparan pasien substansial. menghasilkan sinyal atau hipotesis yang dapat sendiri
Itu terpenuhi, Oleh karena itu, tujuan dibantah,
asli dari menyediakan
prescriptionbased Metode pengawasan
postmarketing obat baru ditujukan Kelemahan

untuk luas, penggunaan jangka Seperti semua metode pharmacoepidemiologic,


panjang. tentu saja PEM memiliki kelemahan. Pertama, tidak
Kedelapan, metode semua bentuk hijau dikembalikan dan ini bisa
mengidentifikasi pasien dengan menimbulkan bias seleksi. Kedua, PEM tergantung
Reaksi obat yang merugikan dapat pada pelaporan oleh dokter. Dengan demikian, bisa
dipelajari lebih lanjut, misalnya, di sebagus tapi tidak lebih baik daripada catatan klinis
bersarang studi kasus-kontrol untuk yang dokter dan tergantung pada keakuratan dan
meneliti faktor-faktor risiko untuk ketelitian para dokter dalam menyelesaikan bentuk
ADR termasuk faktor risikohijau. tidak dilaporkan, termasuk tidak dilaporkan dari
farmakogenetik (lihat Bab
37). efek samping yang yang serius dan fatal, mungkin
Relatedly, sementarai nformasi pada dalam PEM.
beberapa obat co-resep dapat
Ketiga, PEM dibatasi hanya Evaluasi awal dilaksanakan dengan pemeriksaan
untuk praktek umum. Obat yang panduanoleh rekan-rekan peneliti dari peneriamaan
terutama digunakan di rumah sakit bentuk hijau baru untu efek samping dimana peristiwa
tidak dapat dipelajari dengan metode yang mungkin dapat berhubungan dengan paparan obat.
saat PEM. penilaian laporan individu atau kelompok laporan
mengambil kemudian mempertimbangkan sejumlah
Keempat, sambil belajar
titik, termasuk:
keterpaparan dengan pengeluaran
lebih dari resep adalah keuntungan,  hubungan temporal (waktu untuk onset);
tidak ada ukuran kepatuhan  karakteristik klinis dan patologis acara;
menggunakan resep ditiadakan, yaitu,  farmakologis yang sesuai berdasarkan
tidak diketahui apakah pasien benar- pengetahuan sebelumnya dari obat dan kelas
benar mengambil obat ditiadakan . terapi jika sesuai;

Akhirnya, deteksi ADRs langka  apakah peristiwa ini sebelumnya dilaporkan

tidak selalu mungkin bahkan dengan sebagai Reaksi yang merugikan dalam uji klinis

kohort dari 10 000 sampai 15 000 untuk pasca pemasaran di Inggris atau di negara-

pasien. negara lain


 setiap kemungkinan peran obat secara bersamaan
APLIKASI TERTENTU
atau obat diambil sebelum peristiwa
MENCARI SINYAL  peran penyakit yang mendasari atau bersamaan;
 pengurangan dosis;
deteksi sinyal dan evaluasi
 peningkatan dosis;
adalah perhatian utama dari
kewaspaan farmakologi Beberapa  karakteristik pasien, termasuk riwayat kesehatan

metode yang diterapkan untuk deteksi sebelumnya,seperti riwayat alergi obat, kehadiran

sinyal dalam PEM. ginjal ataugangguan hati, dll .;


 kemungkinan interaksi obat.
Penilaian tentang Efek Samping
Dalam kegiatan ini, PEM berfungsi dengan cara
yang penting
yang sangat mirip sistem pelaporan spontanitas (lihat
Bab 9, 10, dan 36), meskipun dengan tingkat yang
jauh lebih tinggi dari pelaporan. setiap peristiwa dan digunakan untuk menghasilkan
Sebuah contoh dari sinyal sinyal . Misalnya , PEM telah mengidentifikasi
keselamatan yang dihasilkan dalam mengantuk / sedasi , dan berat badan dengan
KEP sebagai hasil akibat dari antidepresan mirtazapine dan menilai kekuatan sinyal
evaluasi klinis yang cermat adalah yang dihasilkan oleh metode lain dalam PEM .
gangguan lapang pandang dengan
antiepilepsi dengan Obat Analisis Peristiwa Selama Studi / Events Sementara di
vigabatrin. Obat
Tabel 12.3 menunjukkan halaman pertama dari tabel
Kegiatan medis yang penting
yang merangkum semua laporan yang diterima di
Seperti disebutkan di atas, seluruh studi PEM khas, apakah pasien masih pada
pertimbangan khusus diberikan obat. Penyebut diberikan
kepada kategori dan event yang (dalam hal pasien-bulan pengamatan) untuk setiap
tercatat di Tabel 12.1 dan 12.2. bulan penelitian, dan untuk masing-masing 1.700 atau

Alasan untuk Menghentikan Obat lebih peristiwa dalam kamus DSRU. Jumlah kejadian

Bentuk kuesioner meminta dilaporkan ditampilkan untuk setiapbulan penelitian.


hijau
dokter untuk merekam alasan Tabel 12.4 memberikan data yang sama tetapi dibatasi
mengapa obat tersebut ditarik jika , untuk acara dilaporkan antara tanggal mulai dan
pada kenyataannya , itu ditarik alasan menghentikan obat yang dipantau. Masing-masing tabel
klinis untuk menghentikan obat adalah ini menunjukkan peristiwa dikelompokkan ke dalam
peringkat menurut nomor yang kelas organ-sistem dan ditampilkan sebagai istilah yang
diterima dalam daftar , yang sangat lebih tinggi dan lebih rendah di mana kamus telah
informatif karena termasuk efek dibagi dengan cara ini. Setiap tabel juga menunjukkan
samping yang mungkin yang dokter jumlah totallaporan untuk setiap acara, total selama
dan / atau pasien dianggap serius atau enam bulan pertama observasi, dan jumlah kejadian di
cukup sulit untuk menghentikan obat . mana tanggal acara tidak diketahui. Perbandingan dua
Alasan klinis untuk penarikan adalah tabel tersebut (dan meja ketiga daftar acara off-obat
peringkat menurut jumlah laporan dari tanggal tidak diketahui) menunjukkan jumlah laporan
untuk setiap acara ketika pasien tidak menerima obat
yang dipantau. Hal ini memungkinkan acne 13 1 1 1 3
on-obat / off-obat perbandingan acne 8 1 - 1 1
(meskipun periode setelah obat yang Acne rosacea 5 - 1 - 2
dipantau telah ditarik mungkin masa alopecia 1 - - - 1
di mana beberapa obat lain (dan tidak Cyst sebaceous 14 4 3 2 1
diketahui) yang telah diberikan pada dermatitis 43 8 6 2 3
pasien individu). Dermatitis 4 2 - - 1
contact

Tabel ini dapat menghasilkan sinyal: Dry skin 21 5 3 2 3

Jumlah seluruhnya dari sebuah eczema 91 14 12 10 13

peristiwa yang sangat tinggi dan ini eczema 71 10 9 8 9

dapat d