Anda di halaman 1dari 65

DILA (191-192)

Tentang Ego

Saat kematian Freud, psikoanalisis mulai berfokus pada sifat unik ego dalam
membimbing kemampuan seseorang untuk mengumpulkan tuntutan hidup dan tidak hanya
membacakannya kepada mereka.

Prikologi ego psikoanalitik muncul sebagai upaya untuk memperluas dan menyelesaikan
teori Freudian yang ditujukan pada inkonsistensi antara teori dorongan Freudian klasik mengenai
sistem energi yang bersaing dan pengamatan klinis yang dapat dibuka orang untuk mengalihkan
dorongan.

Dalam pandangan ini, kepuasan datang tidak hanya dari pengurangan ketegangan pasif
tetapi dari rasa penguasaan aktif dalam mengatasi hambatan hidup.

Ketidakmampuan untuk menyesuaikan diri bukanlah hasil dari benturan antara id, ego,
dan superego, neurosis, mungkin juga ada pada orang-orang yang tidak memiliki tujuan hidup,
yang tidak dapat membangun rasa harmoni dan keteraturan dengan diri mereka sendiri dan dunia
sosial mereka.

Anna Freud memulai pengembangan pendekatan ini dalam usahanya untuk bersikap
secara psikoanalis dengan anak-anak. Dia secara bertahap mengubah teori ego dari penunggang
kuda kuda yang tak berdaya yang digambarkan oleh Sigmund Freud menjadi pengendara yang
lebih cerdas dengan rute yang ditempuh untuk bepergian.

Margaret Mahler mengeksplorasi akar awal perkembangan ego dalam interaksi antara
bayi dan ibu. Karyanya membentuk urutan teoritis dari kemampuan ego penting, seperti
kemampuan untuk empati, pengekangan tindakan dan toleransi karena menjadi orang yang
terpisah. Dengan Mahler, perkembangan awal kognitif dan emosional begitu juga dengan relasi
objek yang ditekankan, kasih sayang ibu bertumbuh dalam psikologi analitik ego mengambil
tempat di samping penekanan klasik pada konflik anak-anak.

Mengesahkan Psikologi Ego


Mengingat Freud sedang merekonstruksi masa kanak-kanak pasiennya dari ingatan
orang dewasa, Anna mengobservasi pasien anaknya dalam tindakan membangun sifat khas yang
dimiliki oleh mereka. Freud membebaskan pasiennya dari ketidaktahuan masa lalu mereka
sendiri. Anna Freud berusaha untuk memelihara penguasaan pasiennya terhadap masa lalu yang
belum mereka jalani. Dalam beberapa hal, Anna mengikuti jejak ayahnya namun, ia juga
mengembangkan teori dan praktik baru.
Mulai diresmikan pada tahun 1922, dengan penerbitan untuk anak-anak Anna
mengabdikan hampir 60 tahun untuk penerapan teknik analitik bekerja dengan remaja, sementara
ayahnya tidak melakukan banyak psikoanalitik atau remaja yang lebih muda. Sepanjang
perjalanan, hampir tidak sengaja sepertinya dia menjadi prestise(memiliki wibawa) dan bakatnya
untuk mengesahkan studi langsung tentang ego. Bisa dilihat dari tulisan-tulisannya,
mengungkapkan bahwa konspesi Anna tentang psikologi ego sangat berhubungan dengn teori
Freundan ortodoks. Pandangan dalam ego adalah objek sah dari studi psikoanalitik jika
dianalisis, mengingat bahwa pada dasarnya ego tersebut terikat dengan id dan tidak dapat
dihindari diatur oleh superego. Bagi Anna Freud kepala teoritis untuk pembenaran ego adalah
:,jadi, untuk berbicara medium, kita mencoba untuk mendapatkan gambaran dari dua institusi
lainnya.
Bagi Anna Freud, memperluas cakupan psikoanalisis berarti menerapkan penemuan
mendasar ayahnya ke ranah perilaku baru, kepada anak-anak, remaja, persemaian, hukum
keluarga, dan teknik pendidikan dan perawatan anak. Teori egoisme psikoalitik yang melebar
tidak termasuk meninggalkan konsepsi ayahnya tentang kekuatan instink id, potrais ego-nya
sebagai pengembangan kontinjensi kelangsungan hidup sang id, dan keyakinannya bahwa
setelah, pembalap ego memimpin kuda id dimana kuda id itu ingin pergi. Tapi ceritanya tentang
sejarah karya Anna freud bukanlah sejarah yang secara kaku dikhususkan hanya untuk maksim
(pernyataan ringkas) gurunya. Ini adalah narasi inovasi, revisi, dan penciptaan yang hampir
enggan enggan namun dengan kecemerlangan. Melihat psikoanalitiknya, karir pada tahun 1964
sebagai bagian dari pidato penerimaannya untuk gelar doktor dari Jefferson Medical School,
Anna Freud menggambarkan perbedaan penting antara dirinya dan banyak teoretik psikoanalitik
kontemporer lainnya:
Berbeda dengan banyak kolega, saya tidak pernah berpikir satu sama lain dengan id,
ego, atau suporego tapi selalu ada interaksi di antara mereka. Dinamika kehidupan mental
yang membuat saya terpesona, terpikir oleh saya untuk menemukan ungkapan paling
jelas dalam organisasi pertahanan ego dengan memperjuangkan kepribadian rasional
untuk menangani hal-hal irasional.

Di dalam karya Anna Freud kita dapat mendeteksi ketegangan yang pasti timbul ketika
seorang siswa inovatif berjuang untuk mempertahankan dasar teoritis gurunya dengan ragu-ragu
menuntut pertimbangan yang adil untuk gagasan baru dan independen. Karena pada akhirnya,
posisi Anna Freud memang dalam psikoanalisis kontemporer, dalam keseluruhan sejarah
kedisiplinan, harus selamanya unik dan sangat kontradiktif. Dalam peran utamanya sebagai
pewaris intelektual mandiri Sigmund Freud, dia adalah pimpinan yang menjadi penjaga kunci,
penjaga iman, dan konservator tradisi. Paham motif putrinya terhadap perannya yang bersaing
sebagai teoretikus independen yang berusaha untuk mengeksplorasi ke wilayah baru secara
maksimal mengurangi kegunaan peta lama. Warisan keluarganya tidak hanya memastikan sikap
protektif terhadap psikonalisis klasik, namun ini juga mendukung keingintahuan yang menantang
untuk membuat penemuan baru. Bagaimanapun, bukanlah neo-Freudian; dia adalah seorang
Freud.
NOVINA (192-194)

SUMBER PRIBADI: Dari yang tidak diinginkan menjadi sangat diperlukan

Pada saat Sigmund freud dan Martha freud menyadari bahwa Martha hamil lagi, mereka telah sepakat
bahwa anak kelima mereka, sophie, adalah yang terakhir mereka. Memang, fase awal kehamilan martha
disalahartikan dan disambut sebagai awal menopause (Roazen, 1960, p 40; 1971), hal. 52 ff andpp 436 ff
breeder muda 1988 hal 35 ff). Ketika menjadi jelas bahwa jeda dalam menstruasi martha bukanlah akhir
dari kesuburan tapi awal kehidupan baru, freud mendapati dirinya mengharapkan anak laki-laki lain. Dia
menulis kepada temannya Wilhelm terbang pada bulan Oktober 1895 "Anda tidak akan keberatan
dengan panggilan saya anak saya berikutnya Wilhelm! Jika ternyata menjadi anak perempuan dia akan
disebut anna "(s freud 1954 hal 130). Dia adalah dia, saat freud dan Martha belajar pada sore hari
tanggal 3 Desember 1895. Freud dengan pasrah mengumumkan kelahiran anna untuk terbang dengan
cara yang paling aneh ini

: Jika sudah menjadi anak laki-laki, saya seharusnya mengirimi Anda berita itu melalui telegram. Tapi
karena ini adalah gadis kecil dengan nama anna, Anda akan mendapatkan berita nanti (S. Freud, hal 136;
lihat bentuk alternatif jika kutipan ini di freud, 1985 hal 153)

Meski pengumuman kelahiran ini lalat, freud nampaknya sudah menyayangi semua anaknya. Anna, anak
bungsunya dan yang terakhir, akan jatuh tempo untuk menjadi ahli waris intelektual yang tidak dapat
ditemukan di jung, adler, rank, atau rekan kerja psikoanalitik laki-laki lainnya..

Atas dasar penelitiannya yang ekstensif dalam arsip arsip jones yang tidak dipublikasikan, wawancara
dengan kerabat, kolega, dan mantan pasien freud yang masih hidup, paul roazen (1968, 1967, 1971)
telah menggabungkan sejarah pribadi kemungkinan perjalanan terakhir anna freud. ke dalam disiplin
ayahnya. Penelitian dan kesimpulan Roazen belum menjadi tidak tertandingi. (anna freud sendiri
menemukan pekerjaan roazen tidak pantas, seperti yang dilaporkan oleh bruehl muda, 1988 hal 432 ff)
kami mengikuti akun Rooney ditambah beberapa surat Sigmund untuk membebaskan surat-surat di sini.

MUDA DUDUK: Analisis Pelatihan dengan freud \


Beberapa waktu sebelum 1918, ketika anna berusia awal dua puluhan, dia melakukan analisis
dengan ayahnya. Hubungan unik ini tampaknya berlanjut selama beberapa tahun (Dyers, 1983, p
26, merasa bahwa durasinya agak pendek, roazen 1971 hal 439 bruehl 1988 memberikan akun
terlengkap dan menarik.Lihat terutama breeder muda 1988 hal 171). Dengan demikian, tanpa
pelatihan akademis formal atau mandat kedokteran atau psikologi, anna freud tetap berkomitmen
terhadap psikoanalisis oleh ikatan terkuat: dia terlibat dalam pemboman intelektual dan
emosional dengan pendiri psikoanalisis, ayahnya sendiri, yang harus berfungsi dalam peran
kontradiktif intim profesional dan paternal. Roazen menjelaskan konsekuensi pengembangan
anna freuds dengan cara ini:
Motif Freud mungkin yang terbaik, tapi secara medis dan manusiawi situasinya aneh. Sebagai
analisnya, dia pasti akan memobilisasi perasaan over overvaluation-nya, sementara pada saat
bersamaan menyerukan kerahasiaan jiwanya; Dia menambahkan emosi transferensi baru pada
hubungan mereka, tanpa kemungkinan untuk benar-benar membubarkan mereka. Seorang jenius
yang juga merupakan sosok besar dalam kehidupan fantasi daugher-nya, karena analisnya
mengikatnya secara permanen kepadanya (1971, p.440; italic added)
Freud memecahkan peraturan yang dia ciptakan sendiri untuk perilaku psikoanalis yang benar
dengan membawa putrinya sendiri ke dalam hubungan seperti itu. Mengapa dia melanggar
peraturan seperti itu? Salah satu kemungkinannya adalah bahwa ia harus memiliki kepentingan
khusus untuk memiliki ahli waris intelektual yang dapat dipercaya dan kompeten. Dengan
mengajarkan putrinya teknik profesinya, Freud mewariskan kepadanya sebagai pemimpin
gerakan psikoanalitik.
Salah satu sumber untuk memahami makna analisisnya dengan ayahnya adalah anna freud
sendiri. Dalam sebuah surat yang menasihati seorang teman, eva rosenfeld, untuk menjalani
perawatan dengan ayahnya, yang sebelumnya sudah dikenal dalam konteks sosial, anna
membuat ucapan pedih ini:
Anda tahu, tidak ada kontradiksi dalam analisis Anda yang sedang berlangsung di tempat yang
lebih Anda sukai untuk dilakukan demi cinta saja. Saya melakukan hal yang sama, dan mungkin
karena itu, kedua hal menjadi saling terikat erat untuk saya. Pada akhirnya Anda akan menyadari
bahwa ini adalah satu-satunya cara untuk masuk ke analisis.right sekarang Anda terganggu oleh
perasaan bahwa di mana Anda mencintai Anda pasti sangat baik. Anda akan melihat bahwa
menjadi baik dan sedang dalam analisis akhirnya mencapai hal yang sama (sebuah freud
1929/1992 huruf 8 hal 112)

Anna freud mulai menghadiri ceramah ayahnya, dan dia diizinkan untuk mengikuti seminar wadnesday
Wina yang terkenal di masyarakat psikoanal Wina (Roazen, 1971 hal 438). Dia bahkan diberi kesempatan
pertama untuk menjalani psikiatri klasik dengan diizinkan menghadiri ronde di rumah sakit psikiatri di
Wina, di bawah profesor wagner-jauregg, seorang teman Sigmund freud dari masa studinya sendiri
(sebuah freud 1967 p 152) Heinz hartmann , yang kemudian dikenal sebagai bapak psikologi ego,
menjabat sebagai asisten kedua pada putaran kejiwaan ini. Pada bulan Mei 1920, dua tahun setelah
analisis pelatihannya oleh satu akun, Sigmund menganugerahkan salah satu cincinnya yang terkenal
pada putrinya. Freud memberikan cincin seperti itu kepada anggota jika siklus dalamnya dan tentu saja
caranya untuk memastikan tempat khusus Anna sebagai anggota masyarakat psikoanal Wina yang
lengkap dan diterima (Dryer, 1983 hal 32)
FIRMAN (194-195)

Anna Freud menggambarkanceritafantasiprogresiftentangseoranggadisdariusiaprasekolahhingga


masa remaja di mana temautamanyaadalah "anakdipukuli." Kami tidakakanmelacak detail
analisisnyadisini. Poinpenting, bagaimanapun, karenapembahasan kami
tentangsumberpribadigagasan Anna Freud adalahbahwamakalahtahun 1922
inimengungkapkanbeberapapengalamanpribadi di mana Anna Freud
mendasarkanmetodeterapeutiknyauntukbekerjadengananak-anak. Gadis yang dijelaskan di
korannyaakhirnyamengembangkanserangkaian "fantasibagus" yang
menurutnyatidakbanyakatautidakadahubungannyadengan "fantasipemukulan" yang
diatemukansangatmenyedihkan.Sebenarnya, fantasibaguslebihdisengaja di permukaan,
lebihdalamkontrolsukarela. Tapi, seperti Anna Freud mengungkapkan di koran, melaluianalisis,
"pasien" belajarbahwa "ceritabagus" secaraperlahanmenyamarkankelanjutanfantasipemukulan.
Sepertiayahnya, diamenafsirkanfantasipemukulansebagaitingkatmenengahpenyamaranuntuktabu,
hasratseksual incest terhadapsosokdewasa, kemungkinanbesar ayah sigadis. Yang
membuattulisaninibegitupedasadalah Anna Freud rupanyamenggambarkandirinyasendiri.

Anna Freud menganalisisperkembangandarifantasipemukulanke "ceritabagus"


sebagaistudipenindasandansublimasi, duamekanismepertahanan yang
kemudiandiagambarkansecararinci.
Diamenyiratkanbahwagadisitupadaperkembangannyalebihdewasapadasaatdiabisamengenalihubu
nganantarafantasipemukulan yang sebelumnyatidakdiinginkandanbahkan "ceritabagus" yang
lebihdefensif. Anna Freud
menunjukkanbahwagadisituakhirnyamengubahkombinasidirinyadenganmemujafantasidan
"ceritabagus" menjadiperusahaan yang
kreatifdanlebihrasionaldikendalikandenganmenulisceritapendek yang
menarikbahwadiabisaberbagidengan orang lain. Dalammakalahawalini,
temapenguasaankreatifkonfliksebagai motif dasarsudahjelasdalambukti, sebuahtema yang
kemudiandiaraihdalamkonsepteoritis yang disebut "garisperkembangan."
Diamenyimpulkanmakalahdengan kata-kata ini:

Denganmelepaskankesenanganpribadinya demi memberikesanpada orang lain,


penulistelahmenyelesaikanlangkahperkembanganpenting:
transformasiautismemenjadiaktivitassosial. Bisakitakatakan: diatelahmenemukanjalan
yang mengarahdarikehidupanfantasinyakembalikekenyataan. (A. Freud, 1922, hal 157)

padaputarankejiwaanini. Padabulan Mei 1920, duatahunsetelahanalisispelatihannyaolehsatuakun,


Sigmund menganugerahkan salah satucincinputrinya yang terkenal. Freud
memberikancincinsepertiitukepadaanggotalingkarandalamnya,
dantentusajainiadalahcarauntukmemastikantempatistimewa Anna sebagaianggota Masyarakat
PsikoanalitikWina yang lengkapdanlengkap (Dyer, 1983, hal 32).

Anna sebagaiAnalis Dini

Padatahun 1923,
setelahmempresentasikanmakalahpsikoanalisispertamanyakemasyarakattahunsebelumnya, Anna
Freud siapmemasukipraktikpsikoanalitik (A. Freud, 1922). Sayangnya, tahun 1923 juga
merupakanawaldariakhiruntuk Sigmund Freud. Kanker di langit-langitataspertama kali
terdeteksidandioperasikanpadatahunitu,
dankomplikasiakibatpemindahannyaadalahuntukmenandaidimulainyapertarungan 16
tahundengan rasa sakit.

Kertaspertamanyaadalahperpanjangandari salah satuesaiayahnyasendiritentang


"pemukulanfantasi" yang dirancangolehanak-anak. Penatua Freud (1919)
telahmenulissebuahmakalahberjudul "A Child Is Being Beating" di mana
diamenggambarkanfantasibeberapapasienperempuannyakarenaapa yang
merekaungkapkantentangplastisitas motif seksual. Analisis Freud
menunjukkanbahwalamunanfantasiseperti: pasiennya yang membayangkan orang tua yang
memukulataumenghukumseoranganak, adalahpenggantiterselubunguntukkeinginanseksual yang
tertindas.

Kontribusipertama Anna Freud (1922)


untukpsikoanalitikadalahperpanjangandarianalisisfantasipemukulandenganperbedaanbesardaripe
kerjaanayahnya. Pasienwanita yang diagambarkan di korantentusajadirinyasendiri (Young-
Bruehl, 1988,
SANDI (195-196)
ALIFAH (196-197)

Tema utama: pengabdian, perlindungan, dan inovasi yang enggan

Tiga tema mendasar yang mengatur jalannya karya anna freud muncul dari kunci singkat kita dalam
kisah hidupnya. Pertama, anna menemukan seluruh hidupnya berpusat pada satu orang dan secara
intelektual dan emosional memusatkan perhatian pada hubungannya dengan ayahnya. Kebutuhan
Freud sendiri untuk keintiman emosional dan intelektual mengenalkan momentum ketergantungan
timbal balik mereka

Tema relevan kedua dari riwayat hidup Anna Freud adalah pendekatannya yang protektif dan
konservatif terhadap teori psikoanalitik. Anna freud menganggap penemuan dasar ayahnya sebagai batu
fondasi yang tidak dapat dibuang atau dimodifikasi tanpa menghancurkan seluruh bangunan yang
mereka dukung. Dia dengan cernik berpendapat bahwa analisis psikologi secara historis mencapai
keunikan dan nilainya sebagai studi tentang keseluruhan kepribadian baik di sisi sadar dan sadar (Flead,
1936, hlm. 3-5. 1969a). Membatasi penyelidikan terhadap satu aspek fungsi kepribadian atau
mengabaikan faktor-faktor intinctual yang mendukung budaya lingkungan yang sangat jauh dan
melanggar prosedur dan teori psikoanalitik.

Tema ketiga dan terakhir yang dapat dilihat dalam hafis Anna Freud mengikuti dua tema pertamanya
dan kreativitas dan inovasi sendiri. Anna freud terjebak antara kesetiaan sejati dan kepercayaan pada
taher dan karyanya dan bukti kuat dari penemuannya sendiri dalam analisis anak dan fungsi ego.
Dengan demikian, dia tidak pernah mempresentasikan kontribusinya sebagai revisi atau modifikasi teori
psikoanalitik. Dia membayangkan pekerjaannya sendiri karena lebih mirip dengan penyempurnaan
sabtle, klarifikasi yang canggih, atau pergeseran penekanan. Namun, terlepas dari kecenderungan untuk
meminimalkan kebaruan gagasannya sebagai solusi terhadap konflik antara kesetiaan dan
kreativitasnya, penemuan dan penemuan baru yang benar-benar baru ditemukan dalam tulisan Anna
Freud. Beberapa dari gagasan ini telah sangat mempengaruhi pekerja psikoanalitik lainnya untuk
mengubah jalannya psikoanalisis kontemporer, mengubah evolusi teori dalam arah yang tidak pernah
dipikirkan oleh Sigmund Freud dalam masa hidupnya.

Tidak ada cara yang lebih baik untuk mengilustrasikan dan meringkas konflik abadi antara sikap
proteksionis setia Anna Freud dan penemuan sulitnya yang dimenangkannya sendiri daripada mengutip
sebuah contoh dari prosa yang bimbang:

... Penting diingat bahwa sekitar empat puluh tahun yang lalu, jauh sebelum waktu dimana kerja sama
dengan para pekerja akademis dapat berperan, pelajaran anak psikoanalisis itu sendiri telah melanggar
batasan ketat teknik dan situasi psikoanalitik, dan telah menciptakannya sendiri. bidang pengamatan
langsung, dengan caranya sendiri. Memang benar bahwa semua data penting tentang psikoanalisis telah
membangun pandangannya tentang masa kanak-kanak ... berasal dari latar analitik, rekonstruksi dari
analisis orang dewasa, dan kemudian dari analisis anak-anak. Tapi setelah penemuan itu dilakukan,
sejumlah pengamat bekerja, di luar pengaturan analitik, secara sistematik, dan mengikuti peluang yang
ditawarkan oleh situasi kehidupan saat mereka muncul, bertaruh menyediakan sejumlah data berguna,
yang berguna untuk memeriksa dan mengecek ulang, menambahkan atau menolak temuan analitik
Propen (A Freud 1951. hal. 139-140; huruf miring ditambahkan)

Klaim Anna Freud yang terdiam untuk keaslian dan independensi analisis anak, cabang disiplinnya yang
khusus, tidak dapat dipisahkan dalam bagian ini dengan pengakuannya yang tulus tentang keutamaan
psikoanalisis klasik. Namun dia mengakhiri perjalanan dengan peringatan untuk mengingat bahwa data
analisis anak memiliki status khusus untuk dijadikan "pemeriksaan balasan" yang dengannya teori klasik
dikonfirmasi atau ditolak.
INNA (197-199)

WIDENING THE SCOPE OF ANALYSIS : LITLE PATIENTS’ PROBLEMS

By extending psychoanalytic tecnique from the reconstruction of childhood events in adults to


direct exploration of children’s histories as they live them, Anna freud quickly made to discoveries. Little
patients are often exuberant free spirits but lackadaisicaal freeassociates. As might be expected, the use
of disciplined verbal-analytic technique with small children, with small vocabularies and limited verbal
skill, is not a promising undertaking. Furthermore, unlike adults, child patients typically do not perceive
themselves as needing aid, do not comprehend the role of psychoanalyst, and parent themselves for
treatment only at the urging or command of parents. Because traditional psychoanalysis requred that
patients be intelectually and emotionally engaged in their on treatment, chil patients constited a
gormidable challenge.

How do we decided when a child requires psycoanalysis? One viewpoin, represented by other
chil analytic workes in the 1920s and 1930s, wa that any emotional or intelectual disturbance in the
child analytic wuld benefit from psychoanalystic treatmen. Anna Freud’s own early view during this
same period was that psychonalysis was indicated only for children in whom a full-blwn childhood
neurosis was stangling further davelopment ( A.Freud, 1927).

After considerable experience, Anna Freud conceptualized the creteria for treatment of
children. For adult patients, thee saverity of neurotic disturbance is indicated by the degree of damage
to their capacities to lead a conflict-free love life and work productively wit ( A.Freud,1945,p.15). these
creteria are inapplicable to children. Childhood inyolves cognitive, emotional, and behavioral
davelopment.

In cildhood there is only there is only one factor of such central importance the is impairment
though a neurosis calls for immediate action; namely, the child’s ability to develop, not to remain fixated
at some stage of davelopment before the maturation process han been concluded. ( A.Freud, 1945, p.
17)

The broadening in theory to encompass the facts of childhood change was required by the
demands of child patients whose unconscious proccesses were not accessible by stricly verbal produres.
The refocusing of theory was necessited by the shift from treatments for outright pathology to theraphy
for davelopmental, transitional impairments (A. Freud, 1968). Thus the cretion by which a child’s need
for analytic treatmen was to be assessed was no longer the presence of explicit neurotic symptoms.
Threatened fixaction to some single phase of davelopment became a sufficient indicator to warrant
analytic intervention.

MAKING THE CHILD ANALYZABLE: THE PREPARATORY PHASE

PRIOR TO Anna Freud’s work with children, Melanie Klein (Chapter7) of the Berlin School of
Psychonalysis had used a method for treating children almost exactly the same as adult psychoanalysis
(Sayers, 1991, p.153). Anna set about to davelop a therapeutic method more suited to children. Many
of the approaches and methods she daveloped were damentally different from the more arthodox, or
conventional freudin approach daveloped by Klein. It could be argued thet, even though Anna Freud’s
tecniques with children differed from her fathe’s tecniques with adult, that her work was still
nonetheless in keeping with Freudin theory. This was poshible because children were not simply little
adults. The were major differences between the psyches of children and adults whit which Sigmund
Freud was more familiar Melani Klein, following the latter of Freudin tecnique, my have not “gotten it”
as well as Anna Freud.

Coming from her experiences as teacher of children (A.Freud,1952), Anna Freud understood the
importance of engaging children’s interest at the outset and the necessity of winning their respect for
the superior skills of the adult participant. In the early years of formulating usable principles of child
analysis, Anna Freud felt the necessity of a lengthy preparatory phase of give-and-take relationship
building before analytic work was begun. This prepatory ohase was made more elaborate later with her
addition of a “metapsychological asessent” produre based on direct observation of a child and reports
by others who able to observe the chiild’s family interactions.

MEMENUHI LINGKUP ANALISIS: MASALAH PASIEN KECIL

Dengan memperluas teknik psikoanalitik dari rekonstruksi peristiwa masa kecil pada orang
dewasa untuk mengeksplorasi langsung sejarah anak-anak saat mereka menghidupinya, Anna freud
dengan cepat melakukan penemuan. Pasien kecil sering riang bebas semangat tapi bebas dari lesu.
Seperti yang bisa diharapkan, penggunaan teknik analisis verbal-analitik dengan anak kecil, dengan kosa
kata kecil dan keterampilan verbal terbatas, bukanlah usaha yang menjanjikan. Selain itu, tidak seperti
orang dewasa, pasien anak biasanya tidak menganggap diri mereka membutuhkan bantuan, tidak
memahami peran psikoanalis, dan orang tua sendiri untuk perawatan hanya atas desakan atau perintah
orang tua. Karena psikoanalisis tradisional mengharuskan pasien untuk terlibat secara intelektual dan
emosional dalam perawatan mereka, pasien chil menjadi tantangan yang tidak dapat disembuhkan.

Bagaimana kita memutuskan kapan seorang anak membutuhkan psycoanalysis? Satu


pandangan muncul, diwakili oleh karya analitik chil lainnya di tahun 1920-an dan 1930an, bahwa
gangguan emosional atau intelektual apa pun dalam analisis analitis anak mendapat manfaat dari
perlakuan psikoanalistik. Pandangan awal Anna Freud sendiri pada periode yang sama ini adalah bahwa
psikoalalisis hanya diindikasikan untuk anak-anak di mana neurosis masa kecil penuh melengkung lebih
jauh (A.Freud, 1927).

Setelah pengalaman yang cukup, Anna Freud mengkonseptualisasikan creteria untuk perawatan
anak-anak. Bagi pasien dewasa, kelegaan gangguan neurotik ditunjukkan oleh tingkat kerusakan
kapasitas mereka untuk menjalani kehidupan cinta bebas konflik dan bekerja secara produktif (A.Freud,
1945, hal.15). Kreteria ini tidak bisa diterapkan pada anak-anak. Masa kanak-kanak melahirkan
perkembangan kognitif, emosional, dan perilaku.
Pada masa kanak-kanak hanya ada satu faktor yang sangat penting yaitu kerusakan, walaupun
neurosis memerlukan tindakan segera; yaitu, kemampuan anak untuk berkembang, jangan sampai
terpaku pada beberapa tahap davelopment sebelum proses pematangan selesai. (A.Freud, 1945, hal 17)

Meluasnya teori untuk mencakup fakta-fakta perubahan masa kanak-kanak dibutuhkan oleh
tuntutan anak-anak yang prosesnya tidak sadar tidak dapat diakses dengan hasil yang sangat gamblang.
Memfokuskan kembali teori diperlukan oleh pergeseran dari perawatan untuk patologi langsung ke
terapi untuk gangguan pereda transisi, (Freud, 1968). Dengan demikian, kreteria dimana kebutuhan
anak akan treatmen analitik harus dinilai tidak lagi menjadi gejala neurotik eksplisit. Fiksasi yang
terancam pada fase tunggal davelopment menjadi indikator yang cukup untuk menjamin intervensi
analitik.

PEMBUATAN ANAK ANALYZABLE: FASE PERSIAPAN

Sebelum Anna Freud bekerja dengan anak-anak, Melanie Klein (Bab7) dari Sekolah Tinggi
Psikologi Berlin telah menggunakan metode untuk merawat anak-anak hampir persis sama dengan
psikoanalisis orang dewasa (Sayers, 1991, p.153). Anna mulai meredam metode terapeutik yang lebih
sesuai untuk anak-anak. Banyak pendekatan dan metode yang dia daveloped sangat berbeda dari
pendekatan yang lebih arthodox, atau konvensional yang didahului oleh Klein. Bisa dikatakan, meski
tecniques Anna Freud dengan anak-anak berbeda dari teknik humornya yang dewasa dengan orang
dewasa, bahwa pekerjaannya masih tetap sesuai dengan teori Freudin. Ini bisa terjadi karena anak-anak
bukan hanya orang dewasa kecil. Perbedaan utama antara kecerdasan anak-anak dan orang dewasa
dengan Sigmund Freud yang lebih mengenal Melani Klein, mengikuti karya terakhir Freudin, saya tidak
"mendapatkannya" dan juga Anna Freud.

Berasal dari pengalamannya sebagai guru anak-anak (A.Freud, 1952), Anna Freud memahami
pentingnya melibatkan minat anak sejak awal dan kebutuhan untuk memenangkan rasa hormat mereka
terhadap keterampilan unggul peserta dewasa. Pada tahun-tahun awal perumusan prinsip-prinsip
analisis anak yang dapat digunakan, Anna Freud merasakan perlunya tahap persiapan membangun
hubungan yang memberi dan menerima sebelum kerja analitik dimulai. Tahap persiapan ini dibuat lebih
rumit kemudian dengan penambahan produk "metapsikologis asessent" berdasarkan pengamatan
langsung seorang anak dan dilaporkan oleh orang lain yang dapat mengamati interaksi keluarga chiild.
ICAL (199-200)

Engaging the Child’s Self-Interest; Estabilishing the Analyst’s Usefulness

Awalnya, Anna Freud melakukan masa persiapan untuk "memecahkan anak" untuk
dianalisis dengan membantu anak melihat perlunya perawatan tersebut, lihat analis sebagai
teman sekerja dan sekutu, dan kembangkan tekad sejati untuk mengatasi kesulitan eksplorasi
diri.Dalam prakteknya, tujuan ini ditransformasikan menjadi strategi kreatif. Analis membantu
anak secara bertahap mengembangkan wawasan akan kesulitan anak dan menghasilkan
kerjasama yang lebih baik.Dalam usaha ini, analis mengungkapkan minat dan keinginan tulus
untuk pengelolaan diri anak tersebut.Sebagai ilustrasi, pertimbangkan pendekatan terampil Anna
Freud kepada anak laki-laki berusia 10 tahun yang diajukan untuk perawatan oleh orang tuanya
karena berbagai kecemasan, keadaan gugup, kecenderungan membungkam dan membuat cerita,
dan untuk serangkaian pencurian.Dengan beberapa anak, analis dapat mengambil peran sebagai
sekutu yang membantu melawan dunia orang-orang yang tidak bersahabat atau calon pembantu
potensial dalam menghadapi kesengsaraan batin.Bagi anak ini, tidak ada kemitraan semacam itu
yang bisa diajukan. Sikapnya sejak awal adalah penolakan bermusuhan terhadap analis yang
diajukannya, dan, paling tidak di permukaan, dia tidak tertarik untuk melihat atau mengubah
aspek dirinya sendiri.

Awalnya, anna freud menghabiskan waktu bersama hanya untuk mencerminkan


suasana hatinya.Saat dia tampak ceria, dia ceria; Saat dia serius atau depresi, dia bertingkah
serius.Pada satu titik, dia lebih suka menghabiskan seluruh sesi di bawah meja di ruangan itu,
sebuah kegiatan yang dianalisis oleh anna freud tanpa perhatian khusus. Dia hanya mengangkat
taplak meja untuk berbicara dengannya seolah itu percakapan yang paling biasa. Bersamaan
dengan itu, bagaimanapun, dia juga secara halus merenungkan superioritas kemampuan dan
kebijaksanaan orang dewasa:

Jika dia datang dengan seutas tali di sakunya, dan mulai menunjukkan simpul dan trik yang luar
biasa, saya akan membiarkan dia melihat bahwa saya bisa membuat simpul yang lebih rumit dan
melakukan trik yang lebih luar biasa. Jika dia membuat wajah, saya menarik yang lebih baik; dan
jika dia menantang saya untuk uji coba kekuatan, saya menunjukkan diri saya sebagai orang
yang tidak terbantahkan. (A. Freud, 1927, p.12)

Sepanjang percakapan mereka, Anna freud mengikuti setiap keinginan dan pilihan
topiknya, tanpa subjek terlalu sensitif atau terlalu dewasa untuk didiskusikan. "Sikap saya seperti
sebuah film atau novel dimaksudkan untuk menarik penonton atau pembaca dengan melayani
kepentingan mereka yang lebih rendah". Dengan demikian, Anna freud tidak hanya berhasil
menarik minat anak itu, tapi juga dalam mempelajari minat, sikap, dan perilaku dan aktivitas
khasnya.

Tahap kedua dalam karya persiapan ini dimulai ketika anna freud menunjukkan bahwa
dia bisa berguna untuk membeli dengan banyak cara kecil, seperti dengan mengetikkan surat
untuknya, dengan memunculkan dan menuliskan lamunannya, dan dengan membuat mainan
kecil selama sesi terapi mereka. . Dalam proses pencatatan lamunan, analis juga bisa belajar
sesuatu tentang kehidupan fantasi anak. Anna freud berkomentar tentang pasien lain, "... Saya
dengan rajin rajutan dan rajutan selama pengangkatannya, dan secara bertahap mengenakan
semua boneka dan boneka beruangnya" jika kita mengambil pernyataan terakhir ini sebagai
tipikal, ini memberi kesan bahwa fase persiapan semacam itu adalah relativitas yang panjang. -
Hidup dan membutuhkan banyak patokan sampai pasien anak akhirnya berkomitmen terhadap
proses terapeutik.

Estabilishing the Analyst Power and the Child’s Vulnerability

Tahap ketiga dari masa persiapan memiliki asal-usulnya dalam manuver terampil
lainnya yang dirancang untuk meningkatkan nilai anak laki-laki tersebut bagi analisnya. "Saya
membuat dia menyadari bahwa analisis yang diraih memiliki keuntungan praktik yang bagus;
bahwa misalnya, tindakan yang dapat dihukum memiliki hasil yang sama sekali berbeda dan jauh
lebih beruntung ketika mereka pertama kali diberitahu kepada analis, dan hanya melalui dia
mereka yang bertanggung jawab atas anak tersebut (A Freud 1927. hal 13).
Akhirnya anak laki-laki itu mengandalkan Anna Freud untuk melindunginya dari
hukuman karena tindakannya yang terburu-buru, untuk mengaku kepada orang tuanya untuknya,
dan untuk mengembalikan uang curian sebelum dia tertangkap. Hasil utama dari tahap persiapan
ini adalah bahwa Anna Freud sekarang menjadi tidak hanya menarik, bermanfaat, dan bijak, tapi
juga kuat, seseorang "tanpa membantu dia tidak bisa lagi akur" (1927, hal.13) Pada Poin ini
menjadi momen krusial ketika Anna Freud akhirnya bisa meminta kerjasamanya yang lengkap
dalam membuka rahasia berharga dan dijaganya. Dia bisa menuntut dia setara dengan aturan
analitik dewasa. Katakan semuanya, jangan menyimpan rahasia.
Tahap persiapan diakhiri ketika anak-anak telah mengembangkan wawasan yang cukup
untuk mengenali perlunya bantuan luar untuk kesulitan mereka. Memang, anak penderita harus
belajar memahami bahwa mereka mengalami kesulitan. Sinyal yang jelas tentang kesediaan tulus
untuk mencoba eksplorasi jual yang meningkat dan menyakitkan terjadi ketika anak tersebut
telah mengalami kerentanannya sendiri dan perlu menginvestasikan analis dengan
ketergantungan yang lengkap dan saling percaya. Singkatnya, analis bekerja sangat keras selama
tahap persiapan untuk membangun hubungan transferensi positif yang kuat.

Analis harus menjadi ego anak yang ideal agar perawatan bisa dilanjutkan dan akhirnya
berhasil. Analis kemudian memindahkan orang tua dari peran ini dan merebut sebagian besar
wewenang mereka: "Sebelum anak dapat memberi tempat tertinggi dalam kehidupan
emosionalnya, cita-cita ego, ke objek cinta baru yang sesuai dengan orang tua, dia perlu
merasakannya. bahwa otoritas analis lebih besar daripada kemampuan mereka (A Freud 1927, p
60). Dalam beberapa kasus, di mana orang tua sendiri menjadi sumber kesulitan anak-anak atau
secara negatif dilepaskan untuk menjalani perawatan, menjadi penting bagi analis anak untuk
bekerja secara aktif melawan pengaruhnya.
DIKA (200-201)
ASKAR (201-204)
SHADIQ (204)
BAYEK (205-206)
RIDWAN (206-207)

Batas analisis anak yang tak terhindarkan: Hidup yang tidak dapat diubah

Hasil teoritis keempat dari karya anna freud dengan anak-anak adalah penemuannya bahwa seseorang
dapat melakukan eksplorasi terapeutik terlalu jauh. Analis lain yang memasuki bidang terapi anak sering
kali mengejar gangguan kepribadian pada anak sampai akar mereka di tahun pertama kehidupan. Dalam
usaha untuk melampaui gangguan yang nyata pada pendahulunya kepribadian terdahulu, analis anak,
yang sampai pada awal kehidupan singkat anak, mungkin akan sangat cepat menghadapi kepribadian
kepribadian konstitusional atau lingkungan yang tidak berubah-ubah;

Menurut pendapat saya, ada pengaruh lingkungan paling awal pada anak tersebut yang menciptakan
negara-negara yang sebanding dengan penyakit kekurangan pada sisi fisik. Sementara efek dari
kekurangan awal tersebut dapat dikurangi dengan pengaruh yang menguntungkan kemudian, mereka
tidak dapat dibatalkan atau dibalik atau dipecahkan dalam keadaan baru. cara yang lebih sesuai usia,
karena konflik dapat terjadi: ini berarti bahwa mereka sebenarnya bukan maksud sebenarnya dari kata
alegitimate object of analic effort. (A.Freud, 1970a, hlm. 18-19)

Anna freud dengan demikian mengakui bahwa analisis anak tidak mencegah semua kesengsaraan
psikologis. Faktor lingkungan dan kondisional yang tidak dapat diatasi tidak dapat dibatalkan. Elemen
spesifik dari kondisi manusia dapat merusak kehidupan anak-anak, namun tetap berada di luar
jangkauan usaha yang paling baik sekalipun. Kegagalan untuk mengenali batas-batas nyata ini mengarah
pada aspirasi yang tidak realistis untuk memperluas analisis anak-anak melalui periode perkembangan
penuh dan sampai dewasa.
NAHDAH (207-209)

Signifikansi Realitas Sosial Kontemporer: Bulldogs Bank Children

Hasil teoritis kelima dari karya Anna Freud adalah penemuannya bahwa praktisi analitik
harus menyadari bahwa, tidak seperti orang dewasa, anak-anak lebih bergantung pada dan lebih
mudah dipengaruhi oleh realitas eksternal anak-anak mereka saat ini. Analis anak harus siap
menerima proposisi bahwa dependensi pasien anak saat ini pada orang tua, konflik mereka
dengan saudara kandung dan teman sebaya, dan gangguan mereka. Tidak seperti pasien analitik
dewasa yang gangguan neurotiknya hampir sepenuhnya diinternalisasi dan sebagian besar
disebabkan oleh hubungan masa lalu atau sebelum konflik yang belum terselesaikan, anak-anak
dapat terganggu dengan hubungan mereka saat ini dalam kenyataan saat ini:

Dalam perawatan, terutama yang sangat muda mengungkapkan sejauh mana mereka
didominasi oleh dunia objek, seberapa besar perilaku dan patologi mereka ditentukan oleh
pengaruh lingkungan seperti sikap orang tua yang melindungi atau menolak, mencintai atau
acuh tak acuh, kritis atau mengagumi, serta dengan harmoni seksual atau ketidakharmonisan
dalam kehidupan pernikahan mereka ...

Anak yang bersikap analetik yang menafsirkan secara eksklusif dalam hal dunia batin berada
dalam bahaya mossong terhadap aktivitas pelaporan orang tuanya mengenai dirinya-pada
saat yang sama pentingnya - keadaan lingkungan. (A. Freud, 1965b, hlm. 50-51; huruf miring
ditambahkan)

Analis anak harus menyadari bahwa gangguan pasien kecil tidak secara eksklusif
mencerminkan apa yang salah, telah terdistorsi, atau terblokir di ranah dunia internal anak.
Gangguan anak mungkin sangat mencerminkan hubungannya dengan kenyataan (A. Freud,
1958, hal 127).

Pentingnya lingkungan eksternal anak-anak dan kemampuan mereka untuk mengatasi


ancaman serius sangat mengesankan Anna Freud dalam pekerjaannya dengan anak-anak yang
terpisah dari orang tua mereka selama Perang Dunia II dalam penggerebekan di London. Anak-
anak, dengan persetujuan orang tua mereka, dievakuasi dari daerah yang sangat terancam bahaya
dan dipindahkan ke rumah asuh yang lebih aman di luar zona pengeboman. Tiba-tiba, ribuan
anak yang belum pernah terpisah dari rumah dan keluarga berada di bawah perwalian orang
asing (A. Freud, 1953, hal 511). Anak-anak lain yang kurang beruntung mengalami kematian
anggota keluarga atau anggota melalui kehancuran yang terjadi di London oleh serangan udara
Jerman. Anak-anak seperti itu telah menyaksikan kematian dan penghancuran secara langsung
dan, oleh karena itu, telah jauh lebih traumatis terpisah dari orang tua mereka atau orang yang
mereka cintai.

Pada tahun 1940 Anna Freud mengumpulkan kontribusi keuangan dari beberapa sumber
untuk membuka dan mengelola pusat anak-anak di Hampstead, London. Akhirnya pusat istirahat
bayi dan rumah pedesaan di Essex juga dibuka dan dipenuhi anak-anak yang dievakuasi. Secara
kolektif dikenal sebagai pengaturan kelembagaan namun sebagai rumah pengganti yang akan
memberikan keamanan, pengasuhan, dan cinta untuk anak-anak (A. Freud & D. Burlingham,
1944).

Efek pemisahan membawa korban terbesar pada anak-anak dan bayi termuda. Anak-anak
antara 5 dan 12 bulan menanggapi dengan segala macam gangguan tubuh, mulai dari kesulitan
makan, gangguan tidur, dan masalah makan hingga masalah pernafasan dan hilangnya
kemampuan yang baru didapat seperti berbicara dan berjalan. Anak-anak lain membuktikan
adanya reaksi duka yang tidak terkendali dan menolak semua kontak. Ketika bersatu kembali
dengan ibu mereka atau diberi ibu pengganti, sebagian besar bayi yang sedih ini kembali ke
responsivitas emosional dan perilaku normal. Dalam pandangan Anna Freud, bencana perang
dan evakuasi telah menunjukkan validitas hipotesis psikoanalitik mengenai pentingnya hubungan
ibu-anak (1958, hal 515).

Beberapa tahun kemudian, pada Agustus 1945, enam anak muda akhirnya sampai di Inggris.
Mereka adalah anak yatim Jerman-Yahudi yang orang tuanya terbunuh di kamar gas sesaat
setelah kelahiran mereka dan kemudian dievakuasi dari satu tempat dan satu keluarga ke
keluarga lainnya. Selama tiga tahun mereka benar-benar ditahan di kamp konsentrasi Jerman.
Kita hanya bisa membayangkan penderitaan mereka dalam kondisi seperti itu. Seorang mantan
kontributor Pembawa Hampstead Anna Freud menyumbangkan satu tahun tenancy sebuah
rumah pedesaan di Sussex bernama Bulldogs Bank. Bersama Sophie Dann, salah satu perawat
yang bertanggung jawab atas Bank Bulldog, Anna Freud menerbitkan sebuah catatan tentang
kehidupan kelompok mereka (A. Freud, 1951c).

Anak-anak Bulldog Bank berfungsi sebagai satu unit; Tidak ada anak yang ingin dipisahkan
dari yang lain, juga tidak akan membiarkan anggota kelompoknya berpisah. Ketidaksamaan
mereka untuk terus-menerus bersama-sama menyebabkan beberapa kesulitan dalam rencana
staf untuk memperlakukan mereka sebagai individu. Misalnya, John, yang tertua (3 tahun, 10
bulan), hanya perlu menyingkirkan piringnya saat makan malam karena kelima anak lainnya
berhenti. makan. Tidak seperti anak normal, kelompok anak yatim ini tidak menunjukkan rasa
iri, cemburu, atau persaingan di antara mereka sendiri. Mereka secara spontan akan bergiliran
bermain. Sama-sama berbagi setiap harta, dan sangat sensitif terhadap kebutuhan dan
perasaan masing-masing. (A. Freud, 1951, hal.174)

Anak-anak Bulldog Bank jarang menyerang atau saling menyakiti selama beberapa bulan
pertama mereka di rumah pedesaan. Perselisihan biasanya berupa pertempuran kata, yang
berakhir dengan serangan massa terhadap orang luar, seperti orang dewasa yang campur tangan.
Cara mereka mengekspresikan agresi kurang canggih daripada yang diharapkan anak-anak seusia
mereka. Menggigit dan meludah adalah cara biasa mengekspresikan kemarahan, meski terkadang
mereka kencing di lantai atau pakaian mereka untuk mengekspresikan perasaan mereka. Semua
perilaku ini bersifat regresif, yaitu karakteristik anak-anak yang jauh lebih muda. Tapi setelah
beberapa minggu, mereka bisa menambahkan memukul dan menampar orang dewasa ke
repertoar mereka yang terus berkembang.

Hubungan positif dengan orang dewasa pertama kali dilakukan secara berkelompok. Mereka
mulai berharap bahwa orang dewasa harus bertindak seperti mereka. Misalnya, anak-anak
akhirnya mulai berkeras agar orang dewasa berbelok atau berpaling. Kemudian mereka
mengungkapkan kekhawatiran tentang perasaan orang dewasa. Akhirnya, keterikatan pribadi
individu kepada orang dewasa mulai muncul dan memiliki kualitas hubungan antara orang tua
dan anak.

Anak-anak telah terpapar kesalahan dan kekurangan selama berada di kamp konsentrasi.
Meskipun mereka biasanya tidak mengungkapkan kenangan masa lalu mereka, mereka
membuktikan tanda-tanda pengalaman mereka. Misalnya, keenam anak itu takut pada anjing,
mungkin karena anjing pengawal kamp konsentrasi. "Suatu ketika, ketika dia bertemu dengan
seekor anjing besar yang aneh di jalan-jalan, John menggigit bibirnya yang ketakutan dan
mengira anjing itu telah menggigitnya saat dia berdarah." (A. Freud, 1951c, hlm.216). Dengan
cara yang sama, anak-anak takut dengan truk besar, mungkin karena mereka mirip dengan van
kamp konsentrasi. Bahwa anak-anak tidak menunjukkan ketakutan dan kecemasan yang lebih
besar mungkin disebabkan oleh kohesi dan dukungan bersama mereka, dimana masing-masing
anggota mendapatkan kekuatan dari yang lain. Anna Freud dan Shopie Dann merangkum
pengamatan mereka dengan cara ini:

Mereka kehilangan cinta ibu, kepuasan statik, stabilitas dalam hubungan dan lingkungan
sekitar mereka. Mereka berpindah dari satu tangan ke tangan lainnya selama tahun pertama
mereka, tinggal di sebuah kelompok usia, bukan sebuah keluarga selama tahun kedua dan
ketiga mereka, dan dicabut lagi tiga kali selama tahun keempat mereka ... Anak-anak itu
hipersensitif, gelisah, agresif. , sulit ditangani. Mereka menunjukkan autoeroticism yang
tinggi dan beberapa di antaranya memulai gejala neurotik. Tapi mereka tidak kekurangan,
nakal, atau psikotik. Mereka telah menemukan palungan alternatif untuk libido mereka [satu
sama lain] dan, pada kekuatan ini, telah menguasai beberapa kecemasan mereka dan
mengembangkan sikap sosial. (1951c, hlm. 228 - 229).

Jadi, bahkan pada anak-anak yang sangat kehilangan dan trauma, Anna Freud mengakui
usaha yang mereka buat untuk bertahan hidup secara psikologis di lingkungan yang
menghancurkan.
MUTI (209-211)

Menguasai tugas kehidupan; garis pengembangan


Hasil teoritis keenam dan terakhir dari karya analitik anak anna freud adalah pengamatannya
tentang bagaimana masalah guru ego yang ditimbulkan oleh kehidupan. Garis perkembangan
adalah istilah anna freud untuk rangkaian perkembangan interaksi id-ego. Ketika mereka
melanjutkan jalur perkembangan ini, anak-anak mengalami kemajuan, dalam langkah bertahap,
ketergantungan mereka pada kontrol eksternal dan mendapatkan penguasaan ego atas realitas
internal dan eksternal (A.freud, 1965b, hal 63). Fokusnya bukan hanya pada penguasaan ego,
karena dorongan id adalah dorongan utama untuk kewaspadaan ego terhadap tuntutan dalam dan
luar.
Garis perkembangan dapat dianggap sebagai urutan yang dapat diandalkan dalam pematangan
anak dari ketergantungan hingga kemerdekaan yang relatif lengkap, dari rasionalitas hingga
rasionalitas, dan dari kepasifan ke aktivitas. Garis perkembangan ini mengungkapkan usaha ego
untuk menghadapi situasi kehidupan dengan sukses, tanpa retret yang menyakitkan dan tanpa
penghambatan yang terlalu defensif. Situasi hidup seperti itu mencakup perpisahan dari ibu,
kelahiran saudara laki-laki atau saudara perempuan, penyakit, sekolah, hubungan sesama,
bermain, munculnya ketertarikan seksual pada masa pubertas, dan, tentu saja, cinta (A. Freud,
1962, hal 34)
Enam garis perkembangan (tabel 6.2) adalah;
1. Dari ketergantungan terhadap kemandirian emosional
2. Dari menyusui sampai makan rasional
3. Dari membasahi dan mengotori kandung kemih dan kontrol usus

ENAM PEMBANGUNAN GEDUNG


I. Saya Ketergantungan terhadap kemandirian emosional
1. Ketergantungan biologi pada ibu; tidak ada pengakuan pemisahan antara diri dan orang lain
2. Hubungan yang perlu dipenuhi, dengan ibu terlihat memuaskan sebagian
3. Fase keberagaman objek, di mana citra mather dipertahankan bahkan saat dia tidak hadir
4. Pre-oedipal, clinging stage, ditandai dengan fantasi mendominasi objek cinta
Fase fana-oedipal, ditandai dengan posesif orang tua lawan jenis dan persaingan dengan orang
tua bercinta yang sama
6. Fasa latency dengan mengurangi urgensi drive. Denigrasi model orang tua, transfer libido ke
teman sebaya, kelompok, figur otoritas
7. Tahap remaja kembali ke perilaku awal hubungan pemenuhan kebutuhan dengan benda cinta
8. Fase remaja, ditandai dengan perjuangan untuk memenangkan kemerdekaan dan memutuskan
hubungan dengan benda cinta masa kecil (orang tua), dan kebutuhan untuk menetapkan
keutamaan genital.

II Mengisap makan rasional


1. Dipelihara sesuai jadwal atau sesuai permintaan
2. Menyapih dari payudara atau botol yang diawali baik oleh bayi atau oleh keinginan ibu,
kesulitan makanan baru
3. Transisi dari diberi makan untuk memberi makan sendiri, "makanan" dan "ibu" masih
teridentifikasi satu sama lain
4. Makan sendiri, ketidaksetujuan dengan ibu tentang kuantitas, makanan sebagai medan
pertempuran untuk kesulitan lain dari hubungan ibu dan anak.
5. Teori seksual bayi membentuk sikap terhadap fantasi makanan akibat impregnasi melalui
mulut, ketakutan hamil (takut menjadi gemuk).
6. Fading sexualization of feeding, dengan kenikmatan makan kembali atau meningkat, lebih
menentukan sendiri kebiasaan makan.

III Membasahi dan mengompol sampai kontrol kandung kemih


1. Lengkapi kebebasan untuk membasahi tanah dan dikontrol oleh ibu, bukan diri
2. Tahap anal langsung oposisi anak terhadap pengendalian eliminasi oleh orang lain;
Kotoran diperlakukan sebagai "pemberian" berharga bagi ibu: peperangan untuk latihan toilet
3. Identifikasi dengan aturan orang tua, pengendalian diri kandung kemih dan usus;
Kekhawatiran kebersihan berdasarkan rasa jijik dan rasa malu belajar. Ketertiban dan minat
yang serius berdasarkan keteraturan anal
4. Kekhawatiran kebersihan dikejar demi kepentingan mereka sendiri, terlepas dari tekanan
orang tua; ego otonom dan kontrol superego dari supir anus.
IV Tidak bertanggung jawab terhadap tanggung jawab dalam pengelolaan tubuh
1. Agresi beralih dari diri ke dunia luar. Cedera diri dari gigitan, kebutaan, pemetikan
dibatasi oleh fokus pada benda eksternal, anak mengenali penyebab rasa sakit yang
disebabkan sendiri
2. Ego kemajuan pemahaman prinsip sebab-akibat, keterlambatan keinginan berbahaya,
pengakuan bahaya eksternal seperti kebakaran, ketinggian, air
3. Dukungan sukarela tentang aturan higiene dan kebutuhan medis, menghindari makanan
yang tidak sehat, kebersihan tubuh, sesuai dengan perintah dokter hanya jika rasa takut atau
rasa bersalah memaksakannya. Keyakinan bahwa ibu dapat memulihkan kesehatan yang
terancam punah.

TABEL 6.2 (LANJUTKAN)


V. egosentrisitas terhadap persahabatan
1. pandangan egois dan narsistik, di mana anak-anak lain tidak peduli atau dipandang sebagai
gangguan dan saingan untuk cinta orang tua.
2. Anak-anak lain yang terkait dengan benda tak bernyawa atau mainan, ditangani dengan kasar
dan diperlakukan kasar tanpa tanggapan yang diharapkan darinya
3. Anak-anak lain dipandang sebagai pembantu dalam tugas, durasi kemitraan yang ditentukan
oleh persyaratan tugas
4. Anak-anak lain dilihat sama dan memiliki pasangan dalam hak mereka sendiri, mereka dapat
dikagumi, dikhawatirkan, atau bersaing dengan, dicintai, dibenci, atau dikenali dengan,
persahabatan sejati yang diinginkan.

VI. Tubuh untuk mainan dan bermain untuk bekerja


1. Bermain bayi adalah sensualitas tubuh pada jari, kulit, dan mulut, tubuh sendiri atau ibu tanpa
perbedaan yang jelas antara keduanya.
2. Sifat sensual tubuh sendiri dan ibu memindahkan beberapa benda lunak; misalnya, teddy,
bear, blanket
3. Menutupi satu objek "lunak" tertentu tumbuh sesuai keinginan umum untuk hal-hal yang suka
diemong, tapi semua benda mati dan tidak membalas untuk penanganan balita yang ambivalen.
4. Benda Ceddly yang digunakan sendiri hanya pada waktu tidur, mainan lain untuk bermain
seharian
5. Kesenangan dalam menyelesaikan aktivitas bermain, dan senang dalam melakukan
archievement
6. Mainkan nilai kerja melalui hobi, lamunan, permainan, olahraga keterampilan. Anak bisa
menghambat impuls sendiri

4. Dari tidak bertanggung jawab terhadap tanggung jawab dalam pengelolaan tubuh
5. Dari tubuh ke mainan dan dari bermain ke tempat kerja
6. Dari egosentrisitas sampai persahabatan
Anna freuds pengenalan konsep garis perkembangan adalah kontribusi asli psyvhoanalysis.
Konsep garis perkembangan yang dirumuskan oleh anna freud memusatkan perhatian pada
kemampuan ego untuk menyesuaikan diri dengan tuntutan kehidupan, tuntutan tersebut dapat
bersifat situasional, interpersonal, r pribadi. Dengan demikian, anna freud telah membawa teori
psikoanalitik klasik lebih dekat untuk melihat dunia hubungan dan jauh dari fokus eksklusif pada
dinamika intrapsik.
ILA (211-212)
NABILA (212-213)

Motif untukpertahanan

Mengikutijejakayahnya.annafreudmembedakantigasumberbahayadimana ego
merespondengandefensif.

Pertamadalamkasusneurotik orang dewasa, adaketidakpuasan superego dengancara ego


berusahamemberikepuasanpadausahaseksualdanagresif. ironidaribentukkegelisahaniniadalahbahwa
ego itusendiritidakmenganggapdoronganseksualatauagresif yang
dengannyaaktivitasnyadapatmengancamdirinyasendirisebagaiberbahayaatauterkutuk.
"Naluridianggapberbahayakarena superego melarangpemenuhannya, danjika (naluri)
mencapaitujuannya, pastiakanmenimbulkanmasalahantara ego dan superego".Karena superego
mampumenetapkanstandar ideal yang kakudantidakterjangkau, ego
neurotikbekerjauntukmelepaskansemuaimpulsseksualdanagresifketingkat yang
tidaksesuaidengankesehatan mental yang baik.Ego neurotikdengandemikianmelayani superego
ketingkat yang dilampaui, bahkanpadabiayakonflik internal.

Kedua, dalamkasusneurotikanak, yang belummembentuk ego super yang parah, ego


mungkinmenjadiancamanbahayabagidunialuar.Karenatakutnalurikarena orang
tuatelahmelarangungkapanmereka, ego anakbereaksiterhadap rasa takutakanketidaksenanganmereka.
kecemasan yang "obyektif" initetapcukupuntukmemicumanuver ego yang ego
terhadapimpulsseksualdanaggresive.

Ketiga, adaketakutan ego akanbahayakekuatanimpulstaksadar.


sigmundfreudberpikirbahwaketakutaninidiakibatkanolehdiferensiasi ego dari id padamasakanak-
kanakdanpemisahanbertahapdari proses utama id olehpengembangan proses pemikiranlogissekunder
yang berorientasipadakenyataan. Dengandemikian, ketikanalurimenjaditerlalukuat, ego
merasakanimpulssebagaiancamankarenaindepedensinya, sebagaisinyalbahayadibanjiriolehkekacauan
proses utama. alih-alihmenyerahtanpadayakeinvasi, ego
membawapertahanankedalampermainan.Dalambeberapakalimat,
freudringkasmerangkumtigajeniskecemasan yang memicupertahanan ego dansituasisulit di mana id
menemukandirinya:

Dengandemikian ego, yang didorongoleh id, dibatasioleh superego, ditolakolehkenyataan,


berjuanguntukmenguasaitugasekonominyauntukmewujudkanharmoni di antarakekuatandanpengaruh
yang bekerja di dalamnya; dankitabisabagaimanabegituseringkitatidakdapatmenekantangisan:
"hidupitutidakmudah" jika superego tersebutinginmengakuikelemahannya,
halitumengherankankarenakegelisahan - kenyataannyatamengenai kata eksternal, kecemasan moral
mengenai superego danneurotucKarenakekuatanhasrat di id.

Di tanganannafreud, analisis ego defensifmenjadialatdiagnostik yang sensitif. Bagianalisanak,


sangatterbatasdalampenggunaananalisispertahananasosiasibebasmenjadisangatdiperlukanunt
ukmemahamisejarahperkembangannaluriahanak.Denganmembiarkandedikasihasrat id
tertentu, masakehidupanketikamuncul, dananak-anak yang spesifik yang
diikatdenganjalanmelawannya, analisispertahananmembukajalan yang
tersembunyidalamsejarahanak-anak.

annafreudmendaftarkansepuluhpertahanan ego yang diisyaratkanataudijelaskanolehayahnya,


dan lima elaborasidaridirinyasendiri. Tabel 6.3 memberikandefinisidanilustrasimasing-
masingpembelaanklasikini.Harusditunjukkanbahwapsikoanalis lain memilikibanyakhal lain,
jadijumlahpertahanan yang mungkinjauhlebihbesardaripada yang ditunjukkandalamtabel.
NADIAH (213-216)

SEBUAH KATA TERAKHIR TENTANG ANNA FREUD

Karya Anna Freud mewakili satu solusi yang mungkin, atau lebih tepatnya, sekelompok solusi,
untuk masalah yang belum selesai diwariskan oleh Sigmund Freud. Karakter solusi Anna Freud
adalah tiga kali lipat.

Pertama dan terutama, dia berusaha memperbesar batasan psikoanalisis klasik dengan
pertimbangan langsung tentang fungsi ego dalam realitas sosial tanpa meninggalkan dasar teori
naluri psikoanalitik. Bagi Anna Freud, ego masih dalam kemitraan dengan id, masih terikat
terutama untuk memenuhi tugasnya atas perintah id tersebut. Tapi ego juga mampu beberapa
fungsi independen dalam bidang penguasaan hidup.

Kedua, Anna Freud mengartikulasikan apa yang telah menjadi wawasan yang tersebar di seluruh
pekerjaan ayahnya. Dengan demikian, perhatiannya pada pertahanan ego, adaptasinya terhadap
metode psikoanalitik untuk terapi dengan anak-anak, dan skema klasifikasi metapsikologinya
didasarkan pada rumusan teoritis klasik. Pada saat yang sama, masing-masing prestasi

Tabel 6.3 Sepuluh Mekanisme Pertahanan Ego Anna Freud

Mekanisme Pertahanan Pengertian dan Ciri-ciri Ilustrasi

1. REPRESSION Pengambilan yang tiba-tiba dan Gadis remaja merasa


[Motivated Forgetting] tidak disengaja dari kesadaran bersalah karena impuls
REPRESI akan dorongan, gagasan, atau seksualnya, sering
[Usaha untuk ingatan yang mengancam. Yang "menghalangi/memblok"
Melupakan] paling berbahaya dan salah satu impuls tersebut kepada
pertahanan paling kuno, keluarga dan temannya.
penindasan atau penolakan adalah
prasyarat untuk mekanisme
pertahanan lainnya yang tercantum
di bawah ini.
1A. DENIAL Pemblokiran kejadian eksternal Seorang janda baru-baru ini
[Motivated Negation] dari masuk ke kesadaran, saat terus memberi tempat di
DENIAL persepsi rangsangan semacam itu meja untuk almarhum
[Usaha untuk secara simbolis atau terkait dengan suaminya. Dia juga sering
Penyangkalan] dorongan mengancam. Penolakan berkhayal tentang
menghapuskan bahaya "di luar percakapan yang dia hadapi
sana" dengan meniadakannya. bersamanya.

2. ASCETICISM Karakteristik pubertas, asketisme Remaja yang memulai pada


[Renunciation of Needs] lebih bersifat karakter daripada apa yang tampaknya menjadi
ASKETISME pertahanan. Penderita remaja diet makanan "mode", atau
[Penolakan Kebutuhan] merasa diliputi oleh impuls seksual minat "mode" dalam usaha
yang muncul dan melindungi diri fisik yang ketat mungkin
mereka sendiri dengan menyangkal mencoba mengendalikan
semua keinginan, semua impulsnya.
kesenangan. Pada ekstrem, remaja
mungkin "membuat malu" diri
mereka sendiri dengan membatasi
asupan tidur dan makanan, dan
mempertahankan air kencing dan
kotoran selama mungkin.
3. PROJECTION Atribusi ke orang lain atau lakukan Seorang suami yang nyaris
[Displacement impuls, keinginan, atau pikiran tidak menahan godaan untuk
Outward] seseorang yang tidak dapat tidak setia pada istrinya,
PROYEKSI diterima. Kemudian, impuls ini mulai curiga tentang
[Perpindahan Keluar] menjadi "ego-alien" seolah-olah kesetiaan istrinya kepadanya.
bukan bagian diri.
3A. ALTRUISTIC Suatu bentuk proyeksi di mana Seorang karyawan yang
SURRENDER orang tersebut memenuhi terlalu malu untuk meminta
[Sacrifice Self] kebutuhannya sendiri secara kenaikan gaji untuk dirinya
PENYERAHAN simultan dengan mengidentifikasi sendiri menganjurkan pekerja
ALTRUISTIK dengan kepuasan orang lain; lain mengenai hak pekerja,
[Pengorbanan Diri] Dalam bentuk yang ekstrem, orang yang menyatakan ketegasan
bahkan mungkin melepaskan ekstrim.
ambisi sendiri untuk membiarkan
ambisi orang lain digenapi.
3B. DISPLACEMENT Pengalihan impuls, biasanya Seorang wanita muda, yang
[Redirection of Impulse] agresif, ke target pengganti saat pada masa kanak-kanak
[Pengalihan Impuls] target yang tepat terlalu sangat iri dengan hubungan
mengancam saudara laki-lakinya dengan
ibu mereka, hanya bisa
mengekspresikan perasaan
marah kepada wanita lain,
biasanya kerabat perempuan
lainnya.
4. TURNING Pengalihan impuls ke dalam hati Wanita yang sama seperti di
AGAINST SELF terhadap diri sendiri bukan secara atas (3B) juga mengubah
[Self as Object or lahiriah/keluar diri terhadap target kebenciannya terhadap ibu ke
Target] yang tepat. Biasanya berakibat dalam, menjadi diri yang
[Diri Sebagai Objek pada perasaan tidak percaya, menuduh, pasif, penyerahan,
atau Target] perasaan bersalah, depresi. dan perasaan inferior.
5. REACTION- Transformasi impuls yang tidak Seorang anak yang bersikap
FORMATION dapat diterima menjadi hal yang agresif terhadap ibunya
[Believing the berlawanan dan bentuk yang lebih menjadi sangat prihatin atas
Opposite] dapat diterima; Biasanya memiliki keselamatannya, demi
[Mempercayai yang kualitas "Perempuan terlalu kesejahteraan ibunya, dan
Sebaliknya] banyak protes." Benci menjadi menjadi sangat khawatir
cinta; cinta menjadi benci. bahwa beberapa bahaya akan
menimpa ibunya.
5A. REVERSAL Mirip dengan formasi reaksi, Dorongan sadis bisa menjadi
[Active into Passive] pembalikan mengubah impuls dari masokis, dengan sendirinya
[Aktif menjadi Pasif] mode aktif ke pasif. Begitu juga sebagai target pasif agresi
dengan Turning-Against-Self. dan impuls seksual.
6. SUBLIMATION Transformasi impuls ke dalam Seorang veteran Vietnam
[Acceptable Substitutes] bentuk sosial produktif dan dapat yang, sebagai seorang Beret
[Pengganti yang dapat diterima. Hijau, telah menikmati
diterima] pasukannya, menjadi seorang
polisi yang memilih tugas di
lingkungan yang paling
berbahaya.
7. IDENTIFICATION- Mengadopsi sifat atau perilaku Penyanderaan di skyjackings
WITH-THE- orang yang ditakuti atau objek. sering terasa melindungi
AGGRESSOR penculik mereka. Seorang
[Adopting Feared gadis kecil yang takut
Traits] berjalan menyusuri lorong
[Mengadopsi Sifat gelap rumahnya karena takut
Takut] bertemu hantu yang
memecahkan masalah
dengan "mencemooh"
jalannya menyusuri lorong:
'Anda hanya perlu berpura-
pura bahwa Anda adalah
hantu yang mungkin bisa
bertemu dengan Anda. "
8. ISOLATION Ciri khas neurosis obsesif- Anak laki-laki berusia tujuh
[Stripping of Emotion, kompulsif, dorongan impuls yang belas tahun dengan kesalahan
Meaning] tidak dapat diterima dipertahankan masturbasi akut, membagi
[Pelepasan Emosi, Arti] dalam kesadaran tapi melepaskan seluruh pikirannya menjadi
emosi dan terpisah dari orang yang dapat diterima
menghubungkan gagasan untuk dan tidak dapat diterima.
mencapai karantina emosional- Kedua kategori gagasan tidak
intelektual. dapat dipikirkan secara
bersamaan tanpa gagasan
yang tidak dapat diterima
yang mencemari yang dapat
diterima. (Fenichel, 1945)
9. UNDOING Karakteristik kepribadian obsesif- Anak laki-laki yang sama
[Magical Cancellations] kompulsif, yang melakukan seperti di atas (8), harus
[Pembatalan Ajaib] gerakan magis, atau ritual, untuk melakukan ritual setiap kali
membatalkan pemikiran atau pikiran yang tidak dapat
tindakan yang tidak dapat diterima diterima dan dapat diterima
telah selesai. terjadi bersamaan. Misalnya,
dia harus melafalkan alfabet
ke belakang setiap kali dia
memiliki pikiran seksual,
atau berbalik dan meludah
kapan pun dia bertemu
dengan anak laki-laki lain
yang dia tahu juga
melakukan masturbasi.
10. REGRESSION Mungkin tidak benar-benar Pada pemisahan pertamanya
[Developmental pertahanan, sama seperti dari ibu yang dirawat di
Retreat] primitivisasi perilaku dalam rumah sakit karena
[Retret menghadapi stres: kembali ke cara melakukan tonsilektomi,
Pembangunan] respons sebelumnya saat Timmy mulai mengisap
menghadapi kecemasan. jempol dan mengotori
celananya, perbuatan yang
"dia lakukan" dua tahun
sebelumnya.

melampaui teori klasik dengan cara yang signifikan namun terkadang tidak kentara. Modifikasi
utamanya adalah penekanannya untuk melihat perkembangan kepribadian karena lebih
dipengaruhi oleh lingkungan, karena lebih mudah dibentuk oleh hubungan interpersonal, dan
lebih banyak berubah-ubah daripada teori klasik yang memilikinya.

Ketiga, karya Anna Freud jauh dari asumsi neurologis implisit tentang ciptaan Sigmund
Freud. Bagi Anna Freud, anak-anak, dan mungkin juga orang dewasa, aktif, asertif, dan ahli.
Mereka tidak perlu menjadi korban abadi konflik internal atau lingkungan mereka yang luar
biasa.
AINUN (216-217)
AUL (217-218)
AYYUB (218-219)
OCENG (220-221)
IFAH (221)

Substansi pertama: diferensiasi dan pengembangan citra tubuh

Pada usia empat sampai lima bulan, saat simbiosis berada pada puncaknya, bayi sudah mulai
menunjukkan tanda-tanda untuk membedakan diri mereka dari orbit simbiotik. Disebut "proses
penetasan" ini menandai awal kemunculan anak tersebut sebagai makhluk yang sadar secara permanen
dan sadar.

Penetasan adalah kelahiran psikologis, karena subfase pertama ini menandai dimulainya usaha tentatif
dan sehat anak untuk melepaskan diri, sebuah indera benar-benar jasmani, dari "masa awal persalinan"
yang sebelumnya pasif selama persatuan simbiosis dengan ibu (Mahler et al, 1975, hal 55) Seluruh
subfase diferensiasi dan perkembangan citra tubuh berlangsung dari kira-kira empat atau lima sampai
usia sembilan bulan.

Pada tanda enam bulan, bayi menunjukkan awal diferensiasi dan perkembangan citra tubuh. Berbagai
perilaku baru terlihat: menarik rambut, telinga, dan hidung ibu: memasukkan makanan ke dalam
mulutnya, mundur dari Lengannya untuk lebih melihatnya atau hal menarik lainnya di luar orbitnya. Bayi
menghabiskan banyak waktu untuk menjelajahi lingkungan luar saat terbangun, dan penyelidikan ini
mencakup pemeriksaan kontur wajah ibu. kacamata atau anting-antingnya, dan benda lain yang bisa
digenggam, diucapkan, dicabut. Bayi bahkan mungkin menikmati permainan peekaboo, menandakan
dalam kegembiraan mereka, serentak tawa dengan samar bahwa ibu bisa menghilang dan kembali
muncul tak terduga, yaitu, kehadiran dan ketidakhadirannya tidak tergantung pada pola perilaku kontrol
bayi yang muncul.

pada tujuh atau delapan bulan , seorang "memeriksa kembali ke ibu" orang, fitur dengan fitur yang
sepertinya bayi membandingkan ibunya atau ibunya. Dia sepertinya lebih membiasakan dirinya dengan
lebih teliti, seperti apa adanya, apa yang dirasakan, kasta, bau, penampilan seperti, dan memiliki
"dentang 'ibu (1975, hal 56)." Kecemasan yang asing "juga merupakan perkembangan dari periode ini,
dan anak tersebut merasa khawatir dengan tatapan orang asing dan sangat terpesona dengan rincian
"other-than-mommy "orang.

Dari periode subfase pemisahan pertama ini - individuasi dan seterusnya, anak tersebut memulai sebuah
gerakan yang memiliki dua jalur perkembangan. Jalur pertama adalah pengembangan pemisahan dari
ibu, menjauhkan diri dengan confidenne, membentuk batas-batas diri, dan pelepasan lambat yang
menghasilkan kesadaran subyektif tentang keterpisahan sebagai keadaan positif dan memuaskan. Jalur
kedua adalah pengembangan individuasi melalui internal (naturasi fungsi ego independen di bidang
persepsi, ingatan, kognisi, dan pengujian kenyataan. Individuasi secara harfiah adalah proses psikologis
untuk menggambarkan pengakuan seseorang terhadap keterpisahan fisik dari ibu ke dalam penerimaan
intra psikis yang harmonis terhadap diri seseorang sebagai individu. Pemisahan menjadi entitas
tersendiri: individuasi menjadi orang yang berfungsi.
NINING (221-222)

kita sekarang beralih ke subfase pertama dari .ginningdimana simbiosis berhenti, pada tur ia memegang
bohavior yang tepat, pertama Subphase Pertama: Diferensiasi dan Perkembangan Citra Tubuh Pada usia
empat sampai lima bulan, ketika simbiosis keluar dari pada Puncak bayi sudah mulai mengorbit.
Dipanggil untuk menunjukkan tanda-tanda pembedaan mereka, ini menandai dimulainya proses
kemunculan anak. sebagai makhluk berwajah waspada dan sadar secara sadar. Penetasan adalah
kelahiran psikologis, untuk subfase pertama ini tentatif dan sehat untuk melepaskan diri, dalam tanda
yang ketat menandai awal anak-anak dari masa "persalinan bayi" pasif selama persatuan simbiosis
dengan ibu (Mahlerdkk sebelumnya. Seluruh subfasa pembedaan dan perkembangan Gambar
berlangsung dari kira-kira empat atau empat sampai sembilan bulan dengan variasi perilaku baru dan
perkembangan citra tubuh. A adalah pakaian yang memasukkan makanan ke dalam mulutnya yang
berusaha mundur dari lengan untuk melihatnya atau menarik lainnya. hal-hal di luar orbit mereka. Bayi
menghabiskan banyak waktu untuk mengeksplor lingkungan eksternal saat dan penyelidikan ini
mencakup pemeriksaan wajah ibu, kacamatanya atau wortelnya, dan benda lain yang dapat digenggam,
diucapkan, atau dicabut. Bahkan mungkin menikmati permainan peekaboo, memberi isyarat pada ahli
waris senang, tawa tawa samar-samar memahami bahwa ibu mungkin akan lenyap dan mengingat
keberadaan dan ketidakhadirannya adalah ind Ketergantungan bayi tampak tak terduga id bio. Kontrol
tubuh Pada tujuh atau delapan bulan, "melihat kembali ibu" perilaku pattera muncul, di mana bayi
tampaknya membandingkan ibunya dengan orang lain, yang ditunjukkan oleh fitur Dia tampaknya lebih
mengenalnya dengan lebih teliti. Seperti apa adanya, dengan apa yang ibu, yang rasanya, berbau,
terlihat seperti, dan memiliki "dengkul ibu a975. p, 560." Kecemasan orang asing "juga merupakan
perkembangan dari periode ini, dan anak tersebut merasa cemas tatapan tranger dan sangat
mempesona dengan rincian uis dan Dari periode subfase pemisahan pertama ini - individuasi dan
seterusnya, anak tersebut telah memulai sebuah jalur yang membatasi dua jalur perkembangan. Jalur
pertama adalah pengembangan pemisahan dari ibu, jarak jauh dengan confidenne, membentuk
beundaries ke diri sendiri, dan pelepasan lambat yang berkaitan dengan kesadaran subyektif tentang
keterpisahan sebagai keadaan positif dan memuaskan. Jalur kedua adalah pengembangan tion, memori
pematangan internal ego di zreas kognisi, dan pengujian realitas Individuasi secara harfiah adalah proses
psikologis sebagai pengakuan seseorang terhadap keterpisahan fisik dari ibu menjadi penerimaan secara
intra psikis yang harmonis terhadap diri seseorang sebagai individu. Pemisahan adalah karena Dengan
entitas yang terpisah: individuasi menjadi orang yang berfungsi. 'Subphase Berfungsi: Berlatihlah selama
kira-kira 14 bulan, anak-anak membangun prestasi mereka yang sekarang mampu mewujudkannya.
Khusus untuk mengembangkan ego telah mulai dan semua daya tarik pengujian mereka menjadi p anak
sebagai nitive, dan realitysubphase, tertinggal dengan In theearlypracticetoys, orblanket, jects yang
dipasok oleh ibu popok, botol, secara visual, tactually, ev Anak-anak mengeksplorasinya untuk
mencicipinya, Tapi hough tetap berpusat pada ibu. Bersamaan dengan itu, pengembangan fasilitas
koordinasi lokomotor meningkat. Memperluas kapasitas lokomotor selama subfase latihan awal
memperluas kedekatan anak dan memiliki peran dalam ibu, modalitas yang sampai saat ini adalah untuk
mengeksplorasi eavi yang relatif akrab. Pendeta tiba-tiba mengeksposnya ke segmen realitas yang lebih
luas: ada lebih banyak yang bisa dilihat, lebih banyak untuk didengar, lebih untuk disentuh. (Mahler dkk.,
197S, P. 66) Cara anak-anak dalam pengalaman mereka di dunia baru ini akan dibentuk secara halus
oleh hubungan dekat mereka dengan ibu. Reaksi-reaksinya terhadap pemisahan singkat akan
memperkuat minirinise kekhawatiran apapun yang mungkin mereka hadapi. Dalam perpisahan, ibu
mengundurkan diri dari rumah, tumpahan bahan bakar emosional berhenti di jalan menuju perpecahan
yang jauh lebih lama. Subtitusi yang mempraktekkan dimulai dengan pergeseran ke tegak berjalan di
dekat f 10 atau 12 bulan. Kini seorang anak benar-benar mandiri secara fisik dan bebas untuk
berkeliaran secara luas dan dengan bangga Anak-anak menjadi tertarik pada prestasi tubuh mereka
sendiri yang lebih mudah menahan pukulan dan memar yang pasti akan dibawa petualangan baru.
Akrab orang dewasa selain "Ibu" mudah diterima sebagai pengganti. Beberapa anak laki-laki tampak
lemas saat mereka menyadari ketidakhadiran ibu. Penampilan motilitas dan gerak lambat, minat akan
berkurang. Jika seseorang selain ibu menawarkan kenyamanan, balita mungkin kehilangan
keseimbangan emosional dan menangis. bahwa seorang anak telah memusatkan irnage sang ibu untuk
menahan rasa takut kehilangan benda cinta. Subfase Ketiga: Merancang ulang subfas ketiga dari sekitar
14 bulan sampai 2 anak menjadi lebih , tahun keterpisahan, kesadaran dan kemampuan mereka untuk
memanfaatkan kognitif lebih besar untuk menahan frustrasi. Namun, ada juga peningkatan pada
ketidakhadiran ibu. yang diungkapkan dalam perhatian konstan anak-anak selama dia nampaknya
(Mahlerdkk, 1975.) Kesadaran anak terhadap keterpisahan tumbuh memiliki kebutuhan yang meningkat,
harapan bahkan pada kemampuan dan kemunculannya yang baru dan juga kebutuhan besar untuk
(objek ibu cinta i975, hlm. 76-77) ous Selama subfasa ini, balita mulai "membungkam ibu mereka,
melakukan kewaspadaan dengan mengikuti begitu banyak gerakan. Mereka juga memulai permainan"
melesat pergi "yang bisa ditangkap dan permainan tandangnya mengekspresikan kedua anak tersebut.
Berharap untuk reuni dengan objek cinta dan ketakutan dari fase persesuaian ini adalah masa
kontradiksi, Asloddlers menjadi orang yang tidak sadar, mereka menjadi orang biasa.
VICKY (222-224)
AMAD (224-225)
NILUH 225-226

menolak ibu , ayah penganggu : kecukupan diri adalah segalanya


ingatan masa kecil mahler tentang ibunya adalah bahwa dia adalah "wanita yang sangat
tidak bahagia" Saya datang terlalu dini sembilan bulan dan enam hari setelah pernikahan
dan sangat tidak diinginkan oleh ibu saya, yang baru berusia belasan tahun pada saat itu.
sangat cantik, sangat narsis, dan sangat dimanjakan, dia menyalahkan ayahku atas
kemarahannya yang terlalu dini, dia hanya memiliki sedikit kemampuan untuk
melakukannya seperti yang dia bisa. Selama tahun pertama kehidupan saya, ketika saya
sakit parah dan mengalami gangguan tidur, ayah saya yang, bersama perawat saya, bangun
pada malam hari untuk memikat saya. tahap kehidupan simbiosis saya sulit saya pasti
dipenuhi kemarahan frustrasi pada ibu yang menolak yang sangat saya sayangi. (mahler,
1988).

lahir di desa sopran Hongaria pada tahun 1897, margaret mahler nee schoenberger
tumbuh dengan bahasa dua bahasa. Ayahnya yang berbahasa hungarian, gustav
schoenberger, adalah seorang dokter di bidang genar dan petugas kesehatan kepala distrik
ini. eugneia wiener schoenberger, ibu margaret, berbicara terutama bahasa Jerman di
rumah. Karena takjubnya margarin dewasa itu, selama psikoanalisis dia menyadari bahwa
dia dan adik perempuannya telah berbicara bahasa Hongaria dengan ayah mereka dan
beralih secara otomatis ke jerman saat ibu mereka masuk ke ruangan itu. mahler ingat
bahwa ayah mereka secara sosial menonjol dan aktif, terutama dalam kehidupan politik
kota mereka, sementara ibunya mengabdikan dirinya terutama untuk menjadi "koki dan
ibu rumah tangga yang sangat baik".

didorong oleh perasaan penolakannya sendiri, margaret berusia empat tahun itu menjadi
pengamat kegirangan ibunya yang luar biasa saat melahirkan anak perempuan kedua.
Bentuk sudut pandang margaret, adik perempuannya yang baru suzanne disambut dengan
penuh kasih sayang dan kegembiraan tanggapan ibu margarin yang sekarang dipahami
telah menjadi sasarannya. Memang, si mahler muda mulai berasumsi bahwa ibunya
menginginkannya mati.

Dalam hal yang tampak seperti keterbukaan, mahler menyatakan dalam memoarnya
bahwa kontrasnya dengan penerimaan dan perhatian penuh kasih yang diterima
saudaranya yang mengilhami ketertarikannya pada anak-anak, psikoanalisis terhadap
anak-anak, dan terutama studi tentang hubungan anak-anak. Karena frustrasi, mahler
memperlakukan adiknya dengan penuh kasih, berkata kepada anaknya, "Saya telah
membawa Anda ke dunia ini, saya suka, saya memuja Anda" dan sayang lainnya, yang oleh
margarin muda dilaporkan telah berkata, "dan saya, Saya lahir oleh ayah saya ".
ibunya tidak menyukai pengunjung atau teman margaret atau bahkan pasien suaminya
untuk "mengganggu" ke dalam rumah. Pada suatu kesempatan, mahler mengingat bahwa
ibunya mengizinkannya mengadakan pesta ulang tahun hanya jika dia setuju untuk
memberikan koleksi boneka cokelatnya yang berharga sebagai hadiah untuk salah satu
pesta permainan. Dengan enggan, margaret setuju, tapi pada akhirnya ibunya memberikan
keseluruhan koleksi itu kepada seorang anak yang sangat jauh hubungannya dengannya.
Pengingat mahler menangis "inconsolably" di akhir pesta

"anak laki-laki" ayahnya: kebingungan gender sebagai kepercayaan diri


Karena frustrasi, dan rasa sakit, margaret beralih ke dunia kedokteran, sains, dan
matematika ayahnya yang menangkap minat dan kecerdasannya dan didukung oleh
antusiasme ayahnya, mahler menjadi "anak laki-laki" yang dia inginkan adalah adopsi saya
yang fahter dengan penuh semangat. saya sebagai 'anak' dan kesediaan saya untuk
menerima peran ini, yang dapat menemukan identitas gender masa kecil saya. mahler
melaporkan bahwa tidak pernah dia merasa bahwa dia mungkin adalah "gadis yang cukup
muda" dan perhatian ayahnya terhadapnya adalah perkembangan pendahuluan yang tidak
berguna untuk pengembangan harga diri femininnya. Untuk mengikis genggamannya
dengan identitas feminin lebih jauh, ayahnya akan menyapa sekolahnya. pengakuan
kekaguman atau cinta seorang guru laki-laki dengan ucapan, "Anda cukup jantan untuk diri
sendiri". Keahlian intelektual Mahler memberikan reputasi intimidasi selama tahun-tahun
awal masa remaja. Ketika adiknya menarik jas muda, margaret tidak membaca gagasan
Einstein tentang relativitas. dalam apa yang seharusnya menjadi percakapan sederhana,
yang kemudian dia sesali. Dia memelototi seorang pemuda yang mengajaknya berdansa
dengan proposisi bahwa tuhan ada di dimensi keempat! Tidak ada tanggal kedua.

”Saya cenderung menolak feminitas saya sendiri sepenuhnya. Saya menolak untuk
percaya bahwa ada orang yang layak menyayangi saya jika seseorang menginginkan
perasaan saya. dia langsung mendevaluasi. Tidak pernah belajar bagaimana mengimbangi
wanita lain sebagai wanita. Saya malah belajar bagaimana menghindari kekalahan sebagai
wanita di dunia pria. Singkatnya, saya mengembangkan dorongan kuat untuk kemerdekaan
sejak usia dini.”

tahun kemudian, ketika margaret dewasa akan kembali ke sopron dan berbicara dengan
keluarganya tentang pemuda yang sekarang merayu dia, ayahnya menyuarakan
sanggahannya yang tidak berubah "mengapa saya perlu menikah, dia akan bertanya, kapan
saya begitu mandiri Saya benar-benar jauh 'lebih baik' daripada rata-rata ma ". Ketika,
pada usia 39, dia memperkenalkan paul mahler kepada ayahnya sebagai pria yang ingin dia
nikahi, ayahnya berkata kepada pemuda yang terkejut itu. "Anda harus tahu apa yang Anda
lakukan, dia bukan averege, dari sudut pandang psikoanal mahler di tahun-tahun
berikutnya, dia menafsirkan komentar ayahnya kepada mantan terapis paul karena
mencerminkan kebenciannya terhadap pernikahannya.

Secara psikoanalisis, ayahku bermaksud (untuk memperingatkan paul) "hati-hati, untuk


apa pun kekuatan dan kelemahannya, dia tidak dikebiri, dan Anda sebaiknya berhati-hati
agar tidak dikebiri olehnya".
RAHMAT (226-228)

Sekolah Kedokteran: Solusi Kompromi

Tidak mengherankan itu. Mahler memilih karir di bidang kedokteran, sebagian meniru ayah yang
memiliki begitu kuat, jika tidak tepat, memupuknya dan sebagian untuk mengejar kekuatan
intelektualnya sendiri. Selama persiapan awal, dia masuk ke dalam hubungan dengan rekan-rekan
psikoanal melalui teman dan kenalan, dan mintanya tercetus.

Pada tahun 1917, dia diterima di sekolah kedokteran Universitas Budapest. Sepanjang masa
sekolahnya, ayahnya sangat mendukung, namun dia mencoba membujuk putrinya untuk menghindari
spesialisasi medis tertentu yang dia rasa tidak sesuai dengan wanita perintis yang mengejar karir medis.
Dia terutama mencoba untuk mencegah putrinya dari karir di bidang psikiatri, yang dianggapnya sebagai
cabang kedokteran kurang ajar dan custodial. Tapi ketika mengetahui bahwa putrinya tertarik pada
Freud, dia membaca Freud (Mahler, 1988, hal 22).

Anti-Semitisme dalam rezim Komunis yang memerintah Budapest semakin meningkat, dan jika
kemungkinan seorang mahasiswa kedokteran Yahudi diizinkan untuk menyelesaikan sekolah kedokteran
kecil, maka peluang bagi seorang mahasiswa kedokteran wanita Yahudi praktis tidak ada. Pada saat yang
hampir bersamaan, adik perempuan Mahler, yang agak tidak dewasa, ingin pindah ke Munich untuk
belajar musik. Orangtua Mahler akan memberi izin kepada adik perempuan hanya jika Margaret yang
lebih tua akan menemaninya dan menjadi orangtua pengganti.

Jadi pada tahun 1919, Mahler masuk universitas di Munich. Dia menjadi mahasiswa bintang dan
beberapa pemuda menjadi tertarik padanya secara romantis. Tapi dia ingat bahwa dia masih berada di
bawah pengaruh ketidaksetiaan ayahnya terhadap setiap interaksi dengan lawan jenis dan tidak percaya
bahwa dia benar-benar dapat menarik perhatian pria. Seperti yang dia ingat, "Saya telah secara efektif
merangkul makna devaluasi ayah saya terhadap usaha feminin saya: bahwa saya netral" (1988, hal 25).

Sesuai dengan sejarah pribadinya, Mahler memilih spesialisasi medis dari pediatri. "Pediatri,
mungkin saya harus menjelaskan, mewakili kompromi macam-macam: saya bisa menjadi seperti apa
ayah saya [yaitu seorang dokter praktek], sekaligus mengakomodasi keinginan saya - mungkin hal yang
luar biasa. Sifat 'feminin' - untuk bekerja dengan anak-anak "(1988, hal 23).

Kondisi di Munich memburuk bagi Margaret dan saudara perempuannya. Anti-Semitisme


semakin terang-terangan, dan pada satu titik, untuk mendorong orang Yahudi meninggalkan Munich,
tampaknya penangkapan acak dilakukan terhadap siswa Yahudi. Mahler dan saudara perempuannya
menemukan dirinya sendiri sebentar di penjara (1988, hal 28). Pada tahun 1920, meningkatnya
penghinaan dan prasangka agresif, serta kebencian yang berkembang bahwa dia terjebak dalam situasi
ini oleh kebutuhan saudara perempuannya, membawa Mahler ke dekisiori bahwa sudah waktunya
untuk pindah ke Universitas Jena di Jerman selatan dekat Weirnar Mahler ' Kakak perempuan terpaksa
kembali ke Wina.
Sebagai asisten peneliti pediatrik terkemuka di Jena, Mahler mendapatkan keterpaparan
pertamanya pada penyakit serius dan gangguan psikosomatik pada masa kanak-kanak. Satu kasus di
bagian tertentu meninggalkan kesan abadi. Seorang penebang kayu membawa anaknya untuk
perawatan dengan gejala gagal berkembang dan kehilangan berat badan, tapi tanpa gangguan medis
lainnya. Ayah dan anak memiliki apa yang nantinya akan dikenali Mahler sebagai simbiotik. hubungan.
Dibujuk untuk meninggalkan anak ini dalam semalam, si penebang kayu pulang ke rumah dan bermimpi
malam itu dalam mimpi simbolis bahwa ia telah menebang pohon dan pohon itu adalah anaknya. Ketika
sang ayah kembali ke klinik keesokan paginya untuk merebut kembali anaknya, dia diberitahu bahwa
anak itu telah meninggal pada malam hari. Mahler mengerti secara intuitif, dan kemudian secara
psikoanalitik dan ayahnya menjadi segalanya bagi anak itu, dan ketika ikatan simbolis itu telah
terganggu, anak tersebut tidak dapat bertahan lagi (Mahler, 1988, hal.31). Signifikansi variabel
emosional dan psikologis menjadi penting bagi Mahler, pelatihan dokter anak dalam spesialisasi medis
yang dapat buta terhadap pentingnya psikologi.

Meskipun kegembiraan dan kesenangan intelektual yang dialami Mahler di Jena, anti-Semitisme
terus berlanjut tanpa henti. Pada satu titik, terlepas dari keunggulan akademis, Mahler berada dalam
bahaya dikeluarkan karena dia adalah "orang Yahudi Eropa Timur" yang oleh badan organisasi siswa
umum dianggap tidak diterangi. Untungnya, teman-teman berpengaruh ikut campur dalam nama
Mahler dan dia dapat lulus magna cum laude dari Universitas Jena dua tahun kemudian, menyelesaikan
semester terakhirnya di University of Hei, delberg, sebuah kota "menyenangkan" dimana anti-Semitisme
belum marak.

Karena dia bukan warga negara Jerman, ijazah medis Mahler tidak memberinya lisensi medis
Jerman. Tapi dia telah mendapatkan kewarganegaraan Austria dalam persiapan untuk acara ini, dan
sekarang dia kembali ke Wina (dekat dengan desa asalnya di Sopron) untuk mendapatkan lisensinya,
untuk melanjutkan pelatihannya dalam psikoanalisis, dan untuk memulai praktik pediatri.

Sebagai bagian dari pelatihan lanjutannya, dia menjadi asisten di sebuah institusi pediatrik
terkenal di bawah pediatrician wanita terkemuka von Pirquet. Profesor von Pirquet telah menciptakan
sebuah sistem makan yang terkenal untuk bayi yang sangat sakit yang disebut "sistem nem." Seorang
bayi ditempatkan di sebuah bilik steril dengan satu atau lebih dinding kaca dan memberi makan bagian
susu yang diukur dengan tepat yang disebut "nems." adalah unit pengukuran yang sesuai dengan nilai
kalori satu gram ASI. Seluruh prosedur pemberian makan tidak melibatkan kontak manusia dengan bayi!

Sebaliknya, Mahler menghabiskan bulan-bulannya di sebuah lembaga anak-anak yang saingan


yang menekankan pentingnya mengasuh ibu dari anak yang sakit itu dan "komunikasi" yang penting
antara keduanya dalam perawatan pasien kecilnya. Jauh menjelang waktunya, Lembaga Leopold Moll
mengakui anak-anak yang sakit untuk diobati dengan ibu mereka, dan menerapkan secara ketat filosofi
bahwa "bayi tidak hanya 'milik ibunya tapi juga kehadiran ibu ... sangat penting jika bayi yang sakit
sembuh. "(Mahler, 1988. hal 47). Bayi secara rutin ditugaskan ke perawat siswa khusus untuk
memberikan perawatan "matemal" sehingga perawat dan perawat mendapat makanan dari
pengalaman. Begitu berdedikasi dan penuh kasih adalah para perawat ini sehingga mereka sering
mengenakan masker bedah dan menghabiskan sepanjang malam sambil memegangi, berpelukan, dan
berbicara dengan anak yang sekarat. Yang mengejutkan Mahler, banyak dari anak-anak ini ditemukan di
bawah rejimen ini. Kontras dengan Institut von Pirquet dan makanan neminya sangat mencolok.
Pengalaman masa kecil Mahler sendiri sangat peka dan mempersiapkannya untuk menyerap pelajaran
penting tentang kekuatan keintiman dalam dualisme ibu-anak.
HALIMAH (228-229)
IMA (230)

KATA AKHIR PADA MARGARET S. MAHLER

Tidak seperti hampir semua ahli teori lain yang memiliki informasi sumber pribadi, mahler telah
melakukan pekerjaan kami untuk kami. Dia dengan jujur memamerkan tiga tema utama kehidupan
awalnya yang menyebabkan ketertarikannya pada psikiatri anak dan akhirnya pada teori pemisahan -
individuasi.

 Ketidakpedulian dan penolakan ibu digabungkan dengan dukungan emosional yang kuat dan
seringkali tidak tepat dari ayahnya.
 gender dan identitas pribadi kebingungan yang dibentuk oleh usaha ayahnya untuk
memperlakukannya sebagai anak yang tidak dimilikinya
 Kemandirian yang diberlakukan secara paksa berdasarkan kebutuhan ayahnya untuk memiliki
anak laki-laki dan kebutuhan ibunya untuk menjauhkan putrinya.

ditambah dengan tema yang dikenali sendiri ini, kita bisa menambahkan tema dasar rasa tidak aman
dan perasaan inferioritas yang diharapkan sehingga mahler begitu berhasil untuk dikuasai. dia telah
berjuang secara langsung dengan pengalaman penolakan awal, dengan rasa sakit karena menemukan
keistimewaannya yang tidak diinginkan di dunia yang lebih luas, dan dengan keyakinan bahwa, sebagai
seorang wanita, dia tidak akan pernah "cukup baik". Dari pengalaman ini, dia mendapat perhatian pada
anak-anak, tentang konsekuensi emosional dari "ibu" dan ketertarikannya terhadap apa yang
dibutuhkan untuk menjadi orang yang kompeten dan mandiri.

Ekor margaret mencapai beberapa kesimpulan utama berdasarkan pengamatan klinis dan pertimbangan
teoretisnya.

 Kelalaian maladjustment proporsi psikotik memiliki asal egonya dalam kegagalan perkembangan
untuk memisahkan diri dari ibu sebagai agen otonom, atau kegagalan menggunakan ibu sebagai
alat bantu hidup dalam memahami kata yang hidup. Psikoterapis simbolik mencontohkan anak
mantan dan anak autistik bentuk patologi ego yang terakhir.
 kelahiran psikologis sebagai manusia dapat dicapai hanya oleh anak-anak yang usaha
bawaannya terhadap individualitas tidak rusak dan yang ibunya mendorong, bagaimanapun,
dengan enggan, perjuangan mereka yang berkembang menuju pemisahan, tanpa melebihi
kemampuan mereka untuk bertahan dalam kesendirian.
 tinggi individuasi ego mewujudkan kemampuan untuk mensintesis bukan hanya usaha agresif
dan libidinal terhadap ibu, tetapi juga kemampuan untuk menarik rezeki dari representasi yang
diimunisasi kepadanya.

Dengan demikian, karya mahler telah menunjukkan, bertentangan dengan skema klasik freud, bahwa
akar identitas, resolusi konflik, dan kekuatan ego jauh lebih awal dalam perkembangan bahwa kompleks
oedipus; dan fungsi ego ini lebih dipengaruhi oleh ibu yang bisa ditunjukkan oleh paternalistik freud.
MENGEVALUASI PSIKOLOGI EGO

Sebagian besar diskusi evaluasi kami tentang psikoanalisis klasik freud berkaitan dengan karya putrinya,
anna dan margaret s.mahler. Seperti pendekatan klasik freud, psikologi ego mewakili upaya kolektif
untuk memahami fungsi normal dan abnormal manusia. dan seperti karya freud, psikolog ego, seperti
anna freud dan mahler, bertujuan untuk mengklarifikasi hubungan dan konflik antara akal dan gairah.
Tapi tidak seperti freud, psikiater ego ini secara bertahap mengalihkan psikoanalisis menjauh dari
fokusnya pada dorongan dan kepuasan instingtual dan lebih mengarah pada kekhawatiran akan akal dan
pengetahuan yang hebat dalam menghadapi kehidupan.
ATIKA (231)