Anda di halaman 1dari 204

PETTIBANGUNAN

RENCAI{A PA]{JA]{G
JANGKA
DAERAHKABUPATENBANYUASIN
2006-2025

PEMERINTAHKABUPATENBANYUASII{
BALAI
BAPPEDAPANGKAI.^AN
2009
Puji dan Syukur kami panjatkan kehadirat Allah SUUT, atas
JangkaPanjang(RPJP)
penyusunanRencanaPembangunan
terselesaikannya
Daerah lGbupaten BanyuasinTahun 2006 - 2025. TersusunnyaLaporan
Final ini merupakan hasil pembahasanRancanganAwal RPJP Daerah
lGbupaten BanyuasinTahun 2006 - 2025 melalui Forum Musyawarah
Rencana Pembangunan (Musrenbang), pembahasan Rancangan Akhir
dengan para Eksekutil Legislatifdan perwakilan masyarakatlGbupaten
Banyuasin,diskusidenganTim Teknis BappedaKabupatenBanyuasinserta
mendapatmasukandari Dinas,Badan,Kantor, Sekretariat,
Camatdan Stake
Holder. Masukan dari para Stake Holder sangat membantu untuk
mengakomodirpermasalahan-permasalahan
dalam rangkamerumuskanarah
kebijakandan programpembangunan.

Atas masukandari semuapihak yang telah membantusempurnanya


penyusunanbuku RencanaPembangunanJangka Panjang(RPJP)Daerah
fGbupaten BanyuasinTahun 2006 - 2025 ini kami mengucapkanterima
kasih semoga dapat menjadi pedoman dalam perencanaanpembangunan
lGbupatenBanyuasindi masamendatang.

PangkalanBalai, 2008
lGta Pengantar I

Daftarlsi tl

DaftarTabel iv
DaftarGambar x

BAB I
PDTDAHTII.TIAf,
l.l. LatarBelakang l-l
1.2. MaksuddanTujuan l-3
1.3. Landasan
Hukum l-3
1.4. Hubungan
DenganDokumenPerencanaan
Lainnya........... l-5
l-5. Sistematika
Penulisan l-6

BAB D
I(OIIDISI, AIIAI,ISIS DAIT
PN..DDII(SI I(OXDISI
IIL{IILT DADN.AH
2.1. SejarahPerkembangan
Banyuasin 2-l
2.1.1.fual UsulMasyarakat
Banyuasin 2-l
2.1.2.MasaKemerdekaan 2-4
2.1.3.Detik-detik
Proklamasi
di Banyuasin 2-5

tl
2.2. KondisiUmum Daerah& Prediksi............ 2-6
2.2.1.Geomorfologidan SumberDayaAlam 2-7
2.2.2.Demografi........... 2-3O
2.2.3. Ekonomidan Keuangan 2-39
Budayadan Politik..........
2.2.4.5osial 2-49
2.2.5.Peningkatan
Saranadan Prasarana
...... 2-67
2.2.6.Peningkatan
AparaturPemerintahan 2-79

BAB 3
vrsr, L{rgr , A'.nA.H,
TAHAPAIT
PDL{B AIT GIINAIT D AD N.AH
3 . 1 .Visi KabupatenBanyuasin 3-r
3 . 2 .Misi lGbupatenBanyuasin 3-4
3 . 3 .Arah Pembangunan Daerah 3-7
3.4.Tahapandan SkalaPrioritaspembangunanKabupatenBanyuasin.3-36

BAB 4
PDf,IITITP
PENUTUP 4-l

DAFTARPUSTAKA
|AMPIRAN

ill
Kecamatandi KabupatenBanyuasinTahun 2OO3 L'2

3. JenisPadi, LuasPanendan Total ProduksiPadiMenurut


Kecamatandi KabupatenBanyuasinTahun 2OA4 L-3

4. JenisPadi,LuasPanendan Total ProduksiPadiMenurut


Kecamatandi KabupatenBanyuasinTahun 2OO5 L4

5. JenisPadi,LuasPanendan Total ProduksiPadiMenurut


Kecamatandi KabupatenBanyuasinTahun 2006

6. LuasPanendan ProduksiTanamanPalawijadi Kabupaten


BanyuasinTahun 2OO2- 2006 L-6

7. PopulasiTernakdan JenisTernakBesardan Kecilper


Kecamatandi KabupatenBanyuasinTahun 2002.-2006 L-7

8. PopulasiUnggasMenurut JenisUnggasper Kecamatan


Tahun 2OO2- 2006 .....r-i-.-.r-
di KabupatenBanyuasin L-B

9. ... L-9
ProduksiPerikanandalam KabupatenBanyuasin2OO2-2006

lO. lkan PerairanLautdi Perairan


JumlahUnit Alat Penangkapan
Umum dalam KabupatenBanyuasinTahun 2002-2006 .----------L-lO

ll. Volume lQyu Menurut Jenisdi KabupatenBanyuasin L-11

12. PeredaranPengirimanHasil Hutan KayuBulatdalam Negeri


KabupatenBanyuasinTahun 2OO2-2006 L-12

13. LuasAreadan ProduksiTanamanKaretRakyatdan KelapaSawit


Rakyatper Kecamatandi KabupatenBanyuasinTahun 2OO2... L-13

14. LuasAreadan ProduksiTanamanKaretRakyatdan KelapaSawit


Rakyatper Kecamatandi KabupatenBanyuasinTahun2OO3... L'14

15. LuasArea dan ProduksiTanamanKaretRakyatdan KelapaSawit


Rakyatper Kecamatandi KabupatenBanyuasinTahun2AO4... L-15

V
16. LuasArea dan Produlai TanamanlGret Rakyatdan KelapaSawit
Rakyatper Kecamatandi KabupatenBanyuasinTahun 2OO5... L-16

17. LuasArea dan Produki TanamanKaret Rakyatdan KelapaSawit


Rakyatper Kecamatandi KabupatenBanyuasinTahun 2006 ... L-17

18. LuasArealdan ProduksiTanamanPerkebunanKelapaSawit


di KabupatenBanyuasinTahun 2OO2- 2006 L-18

19. LuasAreal dan ProduksiTanamanPerkebunanlGret


BanyuasinTahun 2OO2- 2006
di K..abupaten L-19

20. LuasPanendan ProduksiBuah-buahan


di KabupatenBanyuasin
Tahun 2OO2- 2006 l-2O

21. LuasPanendan ProduksiSayurandi KabupatenBanyuasin


Tahun 2OO2- 2006 L-21

22. LuasPanendan JenisProduksiTanamanPerkebunan


di KabupatenBanyuasinTahun 2OO2- 2006 L-22

23. JumlahProduksiJenisBahanGalianGolonganC dan Bahan


TambangdiKabupatenBanyuasinTahun2oo2-2oo6

24. JumlahPerkembanganPendudukdan TingkatKepadatan


Di KabupatenBanyuasinTahun 2OO2- 20A6 L-24

25. JumlahPendudukMenurut JenisKelamindan SexRatiodi


KabupatenBanyuasinTahun 2OO2- 2006

26. JumlahAkseptorAktif Menurut JenisKontrasepsi


di
KabupatenBanyuasin
......... L-26

27. KebutuhanHidup Minimum Pekerjadan Perkembangan


Upah
Minimum Regionaldi KabupatenBanyuasin L-27

VI
28. Upah Minimum Sektoraldi KabupatenBanyuasin L'28

29. Jumlahdan LokasiPenempatanTransmigrasidi lGbupaten


BanyuasinTahun 2OO2- 2006 L-29

30. Jumlah KeluargaSejahteradan Pra Sejahteradi Kabupaten


Banyuasin L-30

3t. Perkembanganlndikator Makro Ekonomi di Kabupaten


Banyuasin -...-........: L-31

32. lndustriMenurut TenagaKerjadi


JumlahPerusahaan
KabupatenBanyuasinTahun 2OA2-2006 """""""" L-32

33. JumlahTempat Usaha/Kegiatan Unit PasarYang DikelolaOleh


lGntor PengelolaPasardi lGbupatenBanyuasin.............. L-33

34. BanyaknyaKoperasiKUD dan Non KUD per Kecamatan


di KabupatenBanyuasinTahun 2OO2- 2006 L-34

35. BanyaknyaJenisKegiatanUsahaKUD dan Non KUD


per Kecamatandi lGbupatenBanyuasin..-...-.- L-35

36. JumlahPuskesmas, PKM Pembantu,RumahBersalin'PolikliniV


Polindesdan Dokter per Kecamatandi KabupatenBanyuasin
Tahun 2OO2- 2006 .-.---:.-.-.-. L-36

37- JumlahPenderitaPenyakitTertentuMenurut JenisPenyakit


Tahun 2002'2006 ..... L-37
per Kecamatandi KabupatenBanyuasin

38. di KabupatenBanyuasin
JumtahTenagaMedisper Kecamatan
Tahun2oo2 - 2006 L-38

39. JumlahSekolah,RuangKelas,Guru dan Murid sD Negeri


per Kecamatandi KabupatenBanyuasinTahun 2002'2006 -.... L-39

40. JumtahSekolah,RuangKelas,Guru dan Murid 5D Swasta


per Kecamatandi KabupatenBanyuasinTahun 2002-2006 -.-.. L-4O

G ..
vll
41. JumlahSekolah,RuangKelas,Guru dan Murid Ml Swasta
per Kecamatandi lGbupaten BanyuasinTahun 2002-2006 ..... L41

42. JumlahSekolah,RuangKelas,Guru dan Murid SLTPNegeri


per Kecamatandi lGbupaten BanyuasinTahun 2002-2006 -.... L42

43. JumlahSekolah,RuangKelas,6uru dan Murid SLTPSwasta


per Kecamatandi KabupatenBanyuasinTahun 2002'2006 -.--. L43

44. JumlahSekolah,RuangKelas,Guru dan Murid MTs Swasta


per Kecamatandi lGbupaten BanyuasinTahun 2002'2006 .---- L-44

45. JumlahSekolah,RuangKelas,Guru dan Murid sMU Negeri


.---. L-45
per Kecamatandi tGbupaten BanyuasinTahun 2OO2-2OOO

46. JumlahSekolah,RuangKelas,Guru dan Murid $MU Swasta


per Kecamatandi KabupatenBanyuasinTahun 2002'2006 .---- L46

47 - JumlahSekolah,RuangKelas,Guru dan Murid MA Negeri


per Kecamatandi KabupatenBanyuasinTahun 2002-2006 .---- L47

48. JumlahSekolah,RuangKelas,6uru dan Murid MA Swasta


per Kecamatandi KabupatenBanyuasinTahun 2002-2006 .-... L-48

49. Nilai dan Kualitasobyek dan DayaTarik wsata (oDTW)


Di KabupatenBanYuasin L-49

50. Produksi,Air Minum yang Didistribusikan


BanyaknyaKapasitas
dan JumlahPelangganAir Minum di KabupatenBanyuasin
Tahun 2OOZ- 2006 L-50

51. PanjangJatan,Jembatandan StatusJalandirinciMenurutJenis


di KabupatenBanYuasin L-51

52. JumlahKendaraanAngkutanDaratMenurut Jenisnya


di KabupatenBanYuasin L-52

vlll
53. JumlahSaranaAngkutansungaiMenurutJenisnya
L'53
Di KabuPatenBanYuatin
lan D anrrtracin

Jaringanlrigasidi Kab.Banyuasin' L'54


54. Kondisidan Perkembangan

Sentral
55. Kapasitas TeleponMenurut
danJumlahSambungan
Kecamatandi lGbupatenBanyuasin L-55

56. JumlahPelanggan, KVATersambung Energi


dan Pemakaian
Listrikdi KebupatenBanyuasin L-56

57. RencanaPengembangan Permukiman


dan FungsiPusat-pusat
sampaiTahun2Ol3
Di KabupatenBanyuasin V57

lx
Crambar Halaman

2.1. PetatGbupatenBanyuasin 2'1O


2.2. JumlahTempatPeribadatan ..............2-64
di lkbupatenBanyuasin

x
DAERAHKABUPATEN
PER,ATURAN BANYUASIN
NOAiOR16 TAHUN 2OO9
TENTAN6
RENCANAPEAABANGUNANJANoKA PANJANoDAERAH
KABUPATENBANYUA5INTAHUN 2006-2025

DENOANRAHi,IATTUHAN yANO IAAHAESA

BUPATI BANYUASIN,

rlAenimbotg : o; bohwoRenconoPembongunon JongkoPonjongDoeroh-odoloh


dokumenperenconoonuntuk periode 20 (duo puluh) tohun
doerohyong
yong memuotvisi, misi don oroh pembongunon
mengocu podo Rencono PembongunonJongko Ponjong
Nosionol;
b . bohwoPqsol150 oyot (3) huruf e Undong-UndongRapublik
Indonesia Nomor 32 Tohun ?0O4 tentong Pemerintohan
Doeroh don Posol 13 oyot (2) Undong-Undong Republik
fndonesio Nomor 25 Tohun ?OO4 tentohg Sistem
Pembqngunon
Per encanaon kon Rencono
Nqsionol, mengomonot
PembcngunonJongko Ponjong Dqeroh ditetopkon dengan
PeraturonDoeroh;
c . bohwo berdosorkon pertimbongonsebogoimonodimoksud
Pembongunon
podohuruf o don b, perlu membentukRencono
Jangka PanjangDoeroh KobupatenBonyuosinTohun 2OO9-
2029 dengonPeroturonDoeroh.
iAengirgot : 1. Posol 18 oyot (6) Undong-Undong
Dosor Negoro Republik
fndonesioTohun1945:
2 . Undong-Undong Nomor 6 Tohun20O?tentongPembentukon
Kobupoten Bonyuosin di Provinsi Sumotero Selqton
(LemboronNegoro RepublikfndonesioTqhun ?OOZNomor
19, TqmbohonLemboronNegoroRepublikfndonesioNomor
4t8t):
3 . Undong-UndongNomor 10 Tohun2004 tentong Pembentukon
PeroturonPerundong-undongon(LemboronNegoro Republik
fndonesio Tohun ?OO4 Nomor 53, TombohqnLemboron
NegoroRepublikfndoenesio Nomor 4389):
4. Undong-UndangNomor ?5 Tohun 2OO4 tentong Sistem
Perenconoon PembongunonNosionql (Lemboron Negoro
2

Republik fndonesio Tohun 2AA4 Nomor lO4, Tombohon


LemboronNegoroRepublikfndonesiaNomor 4421)
5 . Undcng-Undcng Nomor 3? Tohun 2OO4 tentcng
PemerintohonDoeroh(LemboronNegoro RepublikIndonesio
Tohun ?zOC4Nomor 125,TombohonLemboronNegoroNomor
4437) sebogoimonoyong teloh diuboh keduokoli ferokhir
dengonUndong-undong RepublikrndonesioNomor 12 Tohun
2OO8 (LemboronNegoro Republik rndonesio Tohun 2005
Nomor 59, TambohonLemboronNegoro Republikrndonesio
Nomor 4844):
6. Undong-undong Nomor 33 Tohun2OO4tentong Perimbongon
Keuongonontoro PemerintohPusotdon PemerintohonDoeroh
(LemboronNegoro RepublikfndonesioTqhun ?OO4Nomor
!26, TombohonLemboron Negoro Republik fndonesio
Nomor4438);
7. Undong-UndongNomor 17 Tohun 2OO7 tentong Rencono
Pembongunon Jongko ponjong Nosionol Tohun 2AO5'2O?5
(LembaranNegora Repubfikfndonesio Tohun 2OO7 Nomor
3g),
8 . Peroturon Pemerintoh Nomor 1OB Tohun 2OOOtentong
Totocoro Pertonggungjowobon Kepolo Dqeroh (Lemborqn
Negoro Repubfik Indonesio Tohun 2OOO Nomor 2O9,
Tombohon Lemboron Negoro Republik fndonesio
Nomor4027):
9. PeroturonPemerintohNomor 39 Tohun2006 tentong Toto
cora Pengendaliandon Evoluosi Peloksonoon Rencono
Pembongunon(LemboronNegoro RepublikfndonesioTohun
2006 Nomor 96, TombohanLemboron Negoro Republik
IndonesioNomor 4663):
10.PeroturonPemerintohNomor 40 Tohun ?006 tentong Toto
RenconoPembongunon
Cara penyusunon Nosionol(Lemboron
Negoro Republik Indonesio Tohun 2006 Nomor 96,
Tombohon Lemboron Negcro Republik fndonesio
Nomor 4664\:
1 1 . Peroturon Pemerintoh Nomor 38 Tohun 2OO7 tentong
Pembogion Uruson Pemerintohon cntqrc Pemerintoh,
PemerintohanDoeroh Provinsi don PemerintohonDoeroh
Kobupoten/ Koto (LemboronNegoro Republikrndonesio
Tqhun2OO7Nomor 86, TombohonlemboronNegoroRepublik
3

IndonesioNomor4738);
12. Peroturon Doeroh KobupctenBonyuosinNomor 15 Tohun
2OOB tentong PembentukonOrgonisosi Lembogo Teknis
Doeroh KobupotenBonyuosin(LemboronDoeroh Kobupoten
Nomor 17 Tohun2008).
Bonyuosin,

DengonPersetujuonBersomo
DEWANPERWAKILAN RAKYATDAERAH
KABUPATENBANIYUA5IN
don
BUPATXBAI{YUASIN

IAEAAUTUSKAN:
: PERATURAN
AAenetopkon DAERAHTENTANaRENCANAPE'IABANzuNAN
BA}WUASIN
JANoKA PANJANoKABUPATEN
TAHUN 2006-2025

BAB I
KETENTUAN UAAUAA
Posol I

DolomPeraturonDoerohini, yongdimoksuddengon:
Bonyuosin;
t. PemerintohDoerohodolohPemerintohKobupoten
2. BupotiodolohBuPotiBonYuosin;

3. RenconoPembongunon Jongko Ponjong Doeroh Kobupoten Bonyuosin


Tohun 2006-?025, yangselonjutnyodisebut sebogoiRPJPDKobupoten
odolohdokumenPerencanaon
Bonyuosin, Pembongunon Doeroh Kobupoten
Bonyuosin periode 20 (duo puluh)tohun terhitung sejok tqhun ?006
sompoidengontohun2025:
4. RenccnoPembongunon Doeroh KobupotenBonyuasin
Jongko ,V\enengoh
yong selonjutnyodisebut RPJMD KobupotenBonyuasinodaloh dokumen
perencanaon pembongunan dqeroh KobupotenBonyucsinuntuk periodeS
(fimo) fohunon, ycitu RPJMD KobupctenBonyuosinTohun 2006-2008
yong merupokonpenjoborondori visi, misi, don progrom KepoloDoeroh
dengon berpedomon podo RPJPD Kobupoten Banyuosin serto
memperhatikon RPJPDProvinsi;
4
BAB II
KABUPATEN
PE,TABANoUNAN
PROoRAAA
Posol 2

1. Progrom PembongunonKobupoten Bonyuosin periode 2@6-20?5


diloksanokon sesuoi dengon RPJPD Kobupcten Bonyuosin Tohun
20a6-2025:

? , Rinciondori progrom pembongunonKobupotenBonyuosinsebogoimono


dimoksudpodooyot (1) terdopot podoLompironPeroturonDoerohini.

Posol 3

RPJPDKobupotenBonyuosinmemuqt visi, misi dqn oroh pembcngunon


yongmengocupodoRPJPDProvinsi;
DoerohKobupotenBonyuosin

Posol4

1 . RPJPDKobupotenBonyuosinsebogoimonotercontum dolomLompironini
merupokansotu kesotuon don bogion yang tidok terpisohkon dori
PeroturonDoerohini;
dimoksudpodooyot (1) menjodi
sebogoimono
2 . RPJPDKobupotenBonyuosin
pedomondolom Penyusuncn RPJMD KobupotenBanyuosinyong memuot
Visi,Misi don Progrom6ubernur.

Posol5

1. Dolom rongko menjogo kesinombungonpembongunondon untuk


menghindorkon kekosongonrenconopembongunon KabupatenBonyuosin,
Bupotiyong sedongmemerintohpodo tohun terokhir pemerintohonnyo
diwojibkonmenyusunRenconoKerjo PemerintohDoeroh (RKPD)untuk
tohun pertoma periodepemerintohonBupotiberikutnyo;

dimqksudpodo oyot (1) digunokonsebogoipedomon


2 . RKPDsebogoimqno
untuk menyusunAnggoronPendopoton don BelonjoDoerohtohun pertomo
periodepemerintchonBupotiberikutnyo.

Posol6

l. RPJPDKobupotenBonyuosinmenjodiocuondolom penyusunonRPJMD
KobupotenBonyuosinYangmemuot visi, misi, don oroh pembongunon
jangkoponjongdoeroh KabupctenBonyuosin;
)

dimoksudPodo oyot (1)


2. RPJMD KobupotenBonyuosinsebogoimono
dengon
disusun RPJMDProvinsi'
memperhotikon

BAB III
PENoENDAUTANDAN EVALUA5I
Pasof7

l. Pemerintoh Doeroh KobupotenBonyuosinmelckukonpengendoliondon


RPJPDKobupotenBonyuosin;
evoluosipeloksonoon
-evoluosi
Z Totc coro peng.ndoliondon peloksonoonrencono pembongunon
ditetopkonlebih lonjut denganPeroturonKepoloDoeroh.

BAB IV
KETENTUANPERAIJHAN
Posol8

1. Ketentuon mengenaiRPJMD KobupotenBonyuosinyong teloh odo mosih


PeroturonDoerohini;
tetop berlokusejoktonggolpengundongon

Z. RpJpDKobupotenteloh odo mosihtetop berloku don wojib disesuoikon


denganRJPJPProvinsiSumoteroSelotonini polinglombot1 (sotu)tohun
sejok diundongkon;

3. RpJllD KobupotanBonyuosinyong telah ado mosih fetop berloku don


wojib disesuoikondengon RPJPD Kobupoten Bonyuosinyong teloh
disesuoikondengonRPJPDProvinsiSumotero Seloton poling lornbot6
(enom)bulon.
6

BAB V
KETENTUANPENUTUP
Posol9

PeraturanDaerah ini muloi berloku pada tanggafdiundongkan.Agar setiop


orong dopot mengetohuinyo, memerintohkon pengundongonPeroturon
Doeroh ini dengon penempotonnyodolom Lembqron Doeroh Kabupoten
Bonyuosin.

Boloi
Ditetopkondi'Pongkolon
podotonggol 2OO9
BUPATTBANYUASIN,

H. AMIRUDDININOED

Diundongkon Boloi
di Pongkolon
podotonggol 2OO9
5EKRETART5 DAERAH
KABUPATEN BANYUASTN,

H. PART6AN,MM
BANYUASINTAHUN2OO9
DAERAHKABUPATEN
LEAABARAN
NOMOR26
RencanaPembangunan
JangkaPanjangDaerah
Tahun2006 - 2025

l\I I

Babini memuat tentanglatar


belakang maksuddan tujuan
disusunnyaRPJP,beberapa
peraturan perundangan yang
menjadi landasanserta
hubunganRPJPini dengan
dokumenperencanaanlainnya
I.I. LATARBELAIGNG

abupatenBanyuasinmerupakanpemekarandari lGbupaten
Musi Banyuasin berdasarkanUndang-undangRepublik
Indonesia Nomor 6 Tahun 2OO2 tentang pembentukan
tGbupaten Banyuasinsebagaidaerah otonom. Pembentukankabupatenini
berdasarkanpertimbangan karena semakin pesatnya perkembangandan
kemajuan pembangunan di Propinsi Sumatera Selatan umumnya dan
lGbupaten Musi Banyuasin khususnya,yang diperkuat dengan aspirasi
untuk meningkatkanpemerintahandemi mencapaikesejahteraan
measyarakat
denganlebih merata.
masyarakat
BerdasarkanUndang-undangNomor 6 Tahun 2OO2 diatas, maka
Menteri Dalam Negeri dengan KeputusanMenteri Nomor 131.26-255Tahun
2OO2menetapkanlr. H. Amiruddin lnoed sebagaiPejabatBupati lGbupaten
Banyuasin. Selanjutnya melalui proses pemilihan yang demokratis,
lr. H. Amiruddinlnoed terpilihsecaradefinitifsebagaiBupatiBanyuasin
untuk
masajabatan 2OO3- 2008. Pembangunan
yang dilaksanakan
oleh Pemerintah
KabupatenBanyuasinsampai saat ini merupakan rangkaiankegiatanyang
berlangsung secara berkesinambungan dari kegiatan pembangunan
sebelumnya.Hal ini dalam rangkamewujudkankesejahteraan
masyarakatdi
l(abupaten Banyuasin. Pelaksanaanpembangunan tersebut selain telah
Ratinm hnfungnnnthrgro
Partarg OsrahAilrffiU6

ffi
menghasilkan keberhasilan yang telah dicapai, iuga masih menyisakan
masalah-masalahpembangunanantara lain isu kemiskinan,Penganggurandan
rendahnyapendapatan perkapita yang perlu diantisipasidan segeradicarikan
jalan keluarnya.
Untuk menjawab kebutuhan tersebut, disusun suatu pendekatan
perencanaanpembangunan yang bersifat partisipatif yakni Undang-undang
Republik lndonesia Nomor 25 Tahun 2OO4 tentang Sistem Perencanaan
PembangunanNasional (SPPN)dan Lampiran Undang-undangNomor 25
Tahun 2OO5tentang RencanaPembangunanJangkaPanjang(RPJP)Nasional
Tahun 2006 2025. Melalui Undang-undangini, diharapkan seluruh
pembangunanyang diselenggarakanbaik itu yang bersidat tahunan, jangka
menengah maupun jangka panjang yang dilaksanakanoleh pemerintah
yang utuh.
terintegrasidalam suatusistemPerencanaan
Dalam rangka mememenuhi semua ketentuan normatif aturan
perundangan mengenai PerencanaanNasional dan Daerah, serta dengan
mengacu pada periodisasipembangunanjangka panjang nasional, maka
pemerintah Daerah Kabupaten Banyuasin perlu menyesuaikan Sistem

PerencanaanPembangunanDaerah atau yang lebih dikenal dengan Rencana


PembangunanJangkaPanjang(RPJP)DaerahTahun 2006 - 2025 lGbupaten
Banyuasin.

H a lI - 2
Renam funfungnaPn rtdglkt
PadaW Oacnh zfrffiUri

I.2. MAKSUD DAN TUJUAN

Maksud; Rencana Pembangunan Jangka Panjang (RPJP) Daerah


Kabupaten Banyasinditetapkan dengan maksud memberikan arah sekaligus
sebagai acuan dalam penyelenggaraan pemerintahan, pengelolaan
pembangunan dan pemberian pelayanan kepada masyarakatkhususnyadi
Kabupaten Banyuasin. RPJP Daerah lGbupaten Banyuasin bertujuan
mewujudkan kehidupanmasyarakatyang lebih demokratis.
Tujuan; Rencana Pembangunan Jangka Paniang (RPJP) Daerah
lGbupaten . Banyuasin bertujuan mewujudkan kehidupan yanS lebih
demokratis, berkeadilan sosial, melindungi hak asasi manusia, kesetaraan
gender, menegakkan supremasi hukum dalam tatanan masyarakat yang
beradab, berakhlak mulia, bebas,mandiri, maju dan lebih sejahterauntuk
kurun waktu 20 tahun ke dePan-
Di dalam mewujudkancita-citadan tujuan KabupatenBanyuasinsesuai
dengan visi, misi dan arah pembangunandaerah yang disepakatibersama'
sehingga seluruh uPaya yang dilakukan oleh masing-masingpelaku
pembangunanbersifatsinergis,koordinatif dan salingmelengkapiantara satu
denganlainnyadi dalam satupola sikapdan pola tindak dalam melaksanakan
pembangunandaerah.

Hall-3
RctwmMryrnnn.ta&e
PetFW OacnhZWeUrS

I.3. IANDASANHUKUM

RencanaPembangunanJangka Panjang (RPJP)Daerah lGbupaten


Banyuasindisusunatas dasar landasanoperasionalyang meliputi seluruh
ketentuan Perundang-undanganyang berkaitan langsung dengan
pembangunandaerah,yaitu sebagaiberikut:
ldiil
t) Landasan : Pancasila
Konstitusional
2) Landasan : Undangundang Dasar1945
Operasional
3) Landasan

a) Undang-UndangRepublikIndonesiaNomor lO Tahun 2OO4tentang


Pembentukan Peraturan Perundang-undangan(Lembaran Negara
Republik lndonesiaTahun 2OO4Nomor 53, Tambahan Lembaran
NegaraNomor 4389);
b) Undang-UndangRepubliklndonesiaNomor 25 Tahun 2OO4tentang
Sistem PerencanaanPembangunanNasional (Lembaran Negara
Republik IndonesiaTahun 2OO4Nomor 104, TambahanLembaran
Negara Nomor 4421);
c) Undang-UndangRepubliklndonesiaNomor 32 Tahun 2}O4tentang
pemerintahanDaerah (LembaranNegaraRepublikIndonesiaTahun

2OA4 Nomor 125, Tambahan Lembaran Negara Nomor M37)


sebagaimanayang telah dirubah dengan Undang-undangRepublik
lndonesia Nomor I Tahun 2OO5 (Lembaran Negara Republik
IndonesiaNomor lO8, TambahanLembaranNegaraNomor 4548):
d) Undang-UndangRepublikIndonesiaNomor 33 Tahun 2OO4tentang
PerimbanganKeuanganantara PemerintahPusat dan Pemerintah
Daerah (Lembaran Negara Republik Indonesia Tahun 2OO4
Nomor 126,TambahanLembaranNegaraRl Nomor 4438):

H a ll - 4
Rqam &lttt0gittgltfr7,,t rlarylo
Pat&ng eaahAffiAUF

RepublikIndonesiaNomor 17Tahun2@7 tentang


e) Undang-Undang
JangkaPanjangNasionalTahun 2w5'2O25
RencanaPembangunan
(LembaranNegaraRepubliklndonesiaTahun2OO7Nomor 33);
PeraturanPemerintahRepubliklndonesiaNomon lO8 Tahun 2OOO
Kepala Daerah (Lembaran
tentang Tata Cara Pertanggunjawaban
Negara RepubtikIndonesiaTahun 2ooo Nomor 2O9, Tambahan
LembaranNegaraRepubliklndonesiaNomor 4O27):
s) PeraturanPemerintahRepubliklndonesiaNomor 39 Tahun 20O6
dan EvaluasiPelakanaanRencana
tentangTata Cara Pengendalian
pembangunan(LembaranNegaraRepubliklndonesiaTahun 2006
NegaraRl Nomor 4663);
Nomor 96, TambahanLembaran
h) Peraturan Pemerintah Republik Indonesia Nomor 4O Tahun 2006
tentang Tata Cara PenyusunanRencana PembangunanNasional
(LembaranNegara Republik lndonesia Tahun 2006 Nomor 96'
TambahanLembaranNegaraRl Nomor 4663);
i) PeraturanPemerintahRepublik IndonesiaNomor 38 Tahun 2OO7
tentang Pembagian urusan Pemerintahan antar Pemerintah,
pemerintahDaerah Provinsidan PemerintahDaerah Kabupaten/

Kota (LembaranNegara RepublikIndonesiaTahun 2OO7Nomor 86'


TambahanLembaranNegaraRl Nomor 4738):
j) PertauranMenteri Dalam Negeri Nomor 13 Tahun.2A06 tentan
Pedoman Pengelolaan Keuangan Daerah sebagaimana telah
diperbaharuidengan PeraturanMenteri Dalam Negeri Nomor 59
Tahun2OO7:
k) Peraturan Bupati Kabupaten BanyuasinNomor l.a Tahun 2oo5
tentang RencanaPembangunan JangkaMenengahDaerah(RPJMD)
2005-2008.
lGbupatenBanYuasin

H a ll - 5
Rcnamkn&ngrnan.Mt
Pat&ttgMrMUN,

I.4. HUBUNGANDENGANDOKUMENPERENCANMN|JAINNYA

Untuk melaksanakan tersebut,


ketentuandalam Perundang-undangan
maka dibutuhkansejumlahdokumen yang harusdipersiapkanpemerintah,
salahsatunyaadalahdokumenRencanaPembangunan JangkaPanjang(RPJP)

Daerahsebagaidokumen induk perencanaanpembangunandaerah dalam


kurunwaktu 2Otahun mendatang.
RencanaPembangunan JangkaPanjangDaerahmerupakanpenjabaran
dari visi, misi dan arah kebijakan Kepala Daerah yang Penyusunannya
berpedomanpada RencanaPembangunan JangkaMenengahDaerahdan
Pembangunan
Rencana
denganmemperhatikan Nasional-
JangkaPanjang

PENULISAN
T.5. SISTEMATII(A

Ruang lingkup Rencana Pembangunan Jangka Panjang Daerah


Kabupaten Banyuasin mencakup aspek pembangunan di segala bidang
kehidupan untuk jangka waktu 20 tahun yang disusundengan sistematika
sebagaiberikut :

Bab I Pendahuluan,pada bab ini memuattentanglatar belakang,maksuddan


tujuan disusunnyaRencanaPembangunanJangkaPanjang(RPJP)Daerahini
dan beberapaPeraturanPerundanganyang berlaku yanS dijadikan sebagai
landasandalam penyusunanRPJPsertahubunganRPJPini dengandokumen
perencanaanlainnYa.

H a ll - 6
Rqwm futthngwun{atvk,
Pat&rrgMcrahM

yang memuat
Bab 2 Kondisi,Analisisdan PrediksiKondisi umum Daerah,
serta
secaraumum kondisidan potensiyang dimiliki KabupatenBanyuasin
lebihdijabarkanlagi dalamkondisifisik,sosial,ekonomidan kepemerintahan'
Kemudiandengan memperhatikankondisi tersebut dapat diformulasikan
prediksitantanganyang akan dihadapi pemerintahdalam kurun waktu 20
tahunmendatang.

Bab 3 Visi, Misi dan Arah PembangunanDaerah, yang memuat tentang


langkahstrategisyang dilakukanPemerintahKabupatenBanyuasindengan
merumuskannya menjadi visi, misi dan kemudianmenentukanarah dan
yangmeliadi prioritaspembangunan'
sasaran

Bab 4 Penutup, memuat harapan-harapanterhadap pembangunandi


KabupatenBanyuasinyang hendaknyadapat sejalan dan berada dalam
koridor yang telah di tentukan dalam dokumen penyusunanRencana
Pembangunan Tahun
JangkaPanjang(RPJP)DaerahKabupatenBanyuasin
2006- 2Q25ini.

H a ll - 7
RencanaPembangunan
Jangka Paniang Daerah
Tahun 2006 - 2025 ' :'il, ,u r\

Bab ini memuat tecara umum


kondisi dan Potensi Yang
dimiliki Kabupaten BanYuasin
yang diiabarkan dalam bentuk
fisik, sosial, budaYa, ekonomi
C dan kepemerintahan serta
prediksi tantangan Yangakan
dihadapi dalam kurun waktu 20
tahun mendatang
Kondlsl, Anal tsrs dan
UmumDaerah
PredikiKondisi

BANYUASIN
2.I. SEJAMHPERKEMBANGAN

terbentuknyalGbupatenBanyuasindalam
rosesperkembangan
lima tahun terakhirini, tidak terlepasdari perjalanansejarah
yang panjang.Oleh sebabitu dibutuhkansuatuanalisishistoris
untuk dapat mengevaluasidiri terhadap kekuatanpada masa sekarangdan
masayang akan datangdengansedikitmenolehke masalalu yang merupakan
pitar-pilar sejarah perjatananrakyat, mulai dari komunitas kecil sampai
menjadisebuahwilayah otonom yang dapat dijadikanbahan pertimbangan
untuk meyelaraskandan menSSagasprogram-programpada masa sekarang
dan masayang akandatangdenganlebihoptimislagi-

2.1.1.AsalUsulMaqyarakatBanyuasin

Kata "Banyuasin"diangkatdan bersumberdari keadaanalamnyayang


sebagianbesarmerupakanwilayahperairan,baikdi muaralaut maupunaliran
sungai dan lebak. Topografis seperti ini hampir mendominasiwilayah
l6bupaten Banyuasin.Kata "banyu" memiliki padanankata dalam Bahasa
lndonesiayang berarti "air", sementarakata "asin" merupakangambarandari
rasaair tersebut.Dengandemikianarti dari banyuasinbersinonimdengan"air
asin"(airyang memilikirasaasin).
Rqc*n PenfuWnPa,tevilQ
Par&rrg OaenhZW62AIS

hal ini
lGbupaten Banyuasin sudah dikenal sejak zaman Sriwijaya'
Talang Tuo,
dibuktikan dengan adanya temuan arkeologis,misalnya Prasasti
Pedang
candi Kunti sintalangyang terdapat di DesaBukit KecamatanBetung,
Kecamatan
Batu di DesaMariana KecamatanRambutandan Batu Pengantindi
bahwa
Talang Kelapa.Reruntuhancandi Kunti sintalangdapat membuktikan
- Budha'
daerah ini sudah mendapat pengaruh dari zaman klasik Hindu
pada daerah
bahkan temuan Pragmen-Pragmendari keramik Dinasti China
ini dengan
Delta upang mengindikasikantelah terjadi keterbukaan daerah
jauh sebelumnya'
hubungandari luar, baik pada zaman sriwijaya atau bahkan
baik yanS
Penduduk tGbupaten Banyuasin terdiri dari berbagai etnis
yang membuktikan
merupakan penduduk asli mauPun penduduk pendatang
di kabupatenini adanyakemajemukanmasyarakat'
Tokoh-tokoh masyarakatBanyuasinmenyatakanbahwa penduduk asli
etnis
KabupatenBanyuasinadalah sekelompokmasyarakatyang berasaldari
melayu. Dalam kategorinya, yang dimaksud "penduduk asli" disini adalah
masyarakat yang pertama kali menempati wilayah Kabupaten Banyuasin'
Kedatanganpendudukasli Banyuasindenganmenetapdi tempatnyasekarang
melalui
ini pada umumnya melalui laut di Muara Sungsangkemudianmasuk
tempat
Sungai Musi dan sungai-sungaikecil lainnya yang menghubungkan
kecil itu adalah Sungaiatau Air Banyuasin,Air
merekatinggal. Sungai-sungai
Lalan,Air Upang,Air Tebingdan Air Padang'
Walaupun pernah menjadi satu "wadah" dalam Kabupaten Musi
yang berbeda
Banyuasinsebelumnya,masyarakatBanyuasinmemiliki bahasa
orang-
dengan"saudaranya-sukuMusi Sekayudi KabupatenMusi Banyuasin'
didominasioleh huruf "e"
orang Banyuasindalam gramtikalsehari-harinya
maka
dan karena memiliki kedekatandengan Palembangsecarageografis'
masyarakat Melayu Banyuasinini tidak jauh berbeda dengan masyarakat
Melayu palembang dibandingkan dengan bahasa masyarakatMusi Sekayu-

Hal2 - 2
R€rrcatuPct futn2frPn,We
nt&tAMtffiAW

etnis
penduduk pendatangdi Kabupaten Banyuasinini berasardari berbagai
Batah Lampung, cina, Palembang'
sepertiJawa, Bali, Sunda,BUgis,Padang'
Masyarakat pendatang
Komering, ogan, Lahat, Semendo dan sebagainya.
yang berasaldari Jawa' merekadatang
terbanyakdidominasioleh pendatang
Kemudian pendatang mayoritas
berawal dari program nasionaltransmigrasi.
yanS masuksebagaitransmigran
berikutnyaadalah Sunda,Bali dan etnis Bugis
di lGbupaten Banyuasin
spontan, sedangkanyang lainnya bertempat tinggal
perkebunan' Pegawainegeri
dengan alasanmencari pekerjaansebagaiburuh
Orde Baru' transmigrasi
atau Swasta,pedagangdan sebagainya.Pada zaman
itu datang perantau
pertama kali ditempatkan di daerah Mulia Agung' Selain
perairanSungsangdan orang
dari Bugisdan pasukantentara Bantenmelalui
terutama ketika
Padang yang masuk melalui jatan darat untuk berdagang
zamanOrde Baru.
diawali dengan
Terbentuknya sistem permukiman di Banyuasin
Banyuasinyang mula-
bertempat tinggalnya "etnis asli-, orang-orangMelayu
geneologis' Dalam usaha
mula hidup mengelompok atas dasar hubungan
untuk menciptakan
memenuhi kebutuhan hidupnya, mendorong mereka
dan saling
perekat hubungan dengan bahu membahu, gotong royonS
jika tempat di
melindungidalam suatukerukunan.Perkembanganlebih lanjut'
sebagailapangan
sekelilingnyasudah tidak mungkin lagi memberikan lahan
lahan
pekerjaanatau usahauntuk bekal hidupnya' mereka kemudian mencari
oleh pengantin
baru. pencarianlahanbaru tersebutpada umumnyadilakukan
lainnya,sampai
baru. Merekamenetapdan kemudiandiikuti oleh masyarakat
perkampunganbaru
akhirnya lokasitempat mereka mentap menjadi sebuah
yang tidak bisalepasdari kampunginduk'
yang tidak dapat
Kenyataanhistoris seperti itu, memunculkanfakta
Banyuasinjuga
disangkalbahwa sebelummenjadi kabupaten,orang-orang
ke daerah-
dikenal sebagai"etnis perantau', mereka banyak yang merantau

H a l2 - 3
Retwm fui&ngnnn,targ*,
Pat&qDaanhM

pekerjaan,mengadakan
daerah lainnya,terutama untuk mencarilapangan
lGdangkala
kegiatan bisnis atau menjadi pegawai dan sebagainya'
masyarakatlain
keberhasilanmereka di daerah rantau menyebabkan
mengikutinYa.

2.1.2. Masa Kemerdekaan

mauPr'ln
Perlawanan rakyat Banyuasin dalam usaha merebut
peristiwa
mempertahankankemerdekaan,dapat dirumuskan dari beberapa
memperlihatkan
dan momen Qersejarahyang masih terekam. Bukti sejarah
yang berjalanantara
bagaimanagigihnya perlawanantersebutsertakoordinasi
kesatuanperlawananrakyat
masing-masing
kembali
MenjelangkejatuhanJepangtahun lg45 dan rencanamasuknya
rakyat. Masa
tentara Belanda adalah masa-masakebangkitan perlawanan
pemerintahan
kependudukanJepang pada dasarnyatidak merubah struktur
yang sudah dibuat oleh Belanda, hanya saja karena saat itu masih dalam
yang dibentuk
suasanaperang Asia Timur Raya' maka arah pernerintahan
yang dibentuk saat
Jepang lebih cenderungke suasanaPerang.Pemerintahan
pemerintahan
itupun adalah pemerintahan militer. Nama-nama pemimpin
pun diganti oleh Jepang,sepertiResidenmenjadi Syu-cokan,Kontrleur diganti
banyak
menjadi Bunsyu-co,Demang diganti manjadi Gun-co' Pertempuran
Bulang'
terjadi diberbagaiwilayah, seperti di daerah Gajah Mati' Tebing
wilayah
Kertajaya,Jirak dan Lubuk. Kendatipun ini tidak masuk dalam
pasukanmemasuki
administratifBanyuasin,namun pergerakandan koordinasi
Hizbullah
wilayah tersebut.Di daerahGajahMati dipimpin oleh LetdaKompi
juga di wilayah ini Kompi
Loein (HusainiSiddik)dari Kompi Hizbullah.Ada
di Kertajaya
Sabilillahyang dipimpin oleh K.H. Kopli BabatToman. Sementara
Tebing Bulang' Di
dipirnpin oleh Letda Animan Achyat yanS mundur dari

Hal2 - 4
Rqrcam fuflfutggfiPnJangka
WWMnhzdrffizi

TRl, LaskarGPll dan rakyat


oleh Pasukan
TebingBulangsendiridipertahankan
di bawah komandoLetdaA. KosimDahayat.Untuk wilayah Jirak dipimpin
dan LesungBatu
wilayahLubukKepahyang
oleh LettuSunardiDM. Sedangkan
dipimpinoleh sermaMardikundan SermaMarimin'
pertempuranpalinggigihterjadidi daerahLangkan.Kejadiannyasekitar

bulanMei 1947antaraBelandadan Pasukan TRI - Subkoss.


PeristiwaLangkan
jam l
bertepatandenganBulan SuciRamadhan.Belandamulai menyerang
tengah malam dan berlanjut hingga esok sore harinya. Wlayah Langkan
sendiri merupakanwilayah utama yang strategisbagi perjalananpasukan
BelandamenujuSekayudan Jambi.Jalur ini harusdiamankankarenaakan
menutuppergerakanBelandamelaluidarat. Oleh karenaitu. Front Langkan
nrerupakanfront terdepandalam membatasipergerakanBelandake wilayah
tersebut.

2.1.3. Detikdetik Proklamasidi Banyuasin

Detik-detik proklamasi di Banyuasinternyata dapat diketahui dalam waktu


yang singkat.Proklamasidibacakanjam 10.00 WIB pagi di Jakartalangsung
diketahuisaat itu juga oleh warga di PangkalanBalai. Beritaini didapat dari
sebuahradio seorangwarga PangkalanBalaibernamaKerani.
barulahkemudiansekitar4 atau 5 hari
Setelahproklamasikemerdekaan,
setelah itu terbentuk kelompok pejuang yang disebut Barisan Pelopor'
Anggotanya kebanyakanmantan Gyugun yanS telah dilatih oleh tentara
Jepang. Beberapa tokoh yang membentuk Barisan Pelopor ini adalah
H. JumahatAR, M. Zam Zam, M. ArsyadToha, BasyirudinAziz, Khoirudin
Amid, Rojal Muniri dan lain-lain.BarisanPelopor inilah yang kemudian
banyak berperan dalam perjuangan rakyat Banyuasin, termasuk dalam

H a l2 - 5
RetwmMngtmnJaryb
Par{sgOnnhmffil6

peristiwa Front Langkan.Namun dalam Front Langkan sudah terlibat


beberapakesatuan lain dari SekayumauPunPalembang.

KONDISIUMUM DAERAH
2.2. KONDISIDAN PREDIKSI

pembangunandaerah KabupatenBanyuasinyang telah dilaksanakan

selamaini merupakankelanjutandari keberadaanlGbupaten Musi Banyuasin.


Setelahadanya pemekarandan pembentukan,lGbupaten Banyuasinperlahan-
lahan telah menunjukkankemajuandi berbagaisektor kehidupan masyarakat
yang meliputi aspek-aspekekonomi, sosial budaya, hukum dan politik,
pembangunaninfrastrukturdan pemerintahan.
Namun pelaksanaanpembangunanyang sudah dilakukan selamaini
yang belum
masihmenghadapibanyaktantangan,kendaladan permasalahan
sepenuhnyadapat teratasi dengan baik. Beberapapersoalan yang masih
memerlukan penyelesaianlebih lanjut diantaranya masalah kemiskinan'
:
kesehatan'pendidikandan lain-lain'
pengangguran,
Untuk mengatasi hal tersebut, maka diperlukan uPaya untuk
mengatasinyamelalui perencanaanyang lebih baik, terstruktur, terorganisir
dan lebih terkoordinasi. Dalam konteks ini penyusunan Rencana

PembangunanJangkaPanjang(RPJP)Daerah merupakan bagian yang sangat


setiaptantanganyarig akanterjadi
pentingguna mengatasidan mengantisipasi
dimasamendatang.

Hal2 - 6
Rctwmfunfugtmn,hrgka
Ps&ryDaoahWmH,

DAYAAIAM
DANSUMBER
2.2.1. GEOMORFOLOGI

W
Letak suatu wilayah yang strategis akan memberikan kontribusi
pengaruhterhadap perkembanganwilayah tersebut.Selainletak wilayah, luas
wilayah pun demikian. Banyuasin sebagai kabupaten baru di Propinsi
Sumatera Selatan mempunyai wilayah yang cukup luas dan mempunyai
sumber daya alam yang cukup melimpah. Secara geografis lGbupaten
Banyuasinterletak di sebelahutara Kota Palembangdan secaraastronomis
terletakpada l,3o-4oLintangSelatandan lO4o4O'-lO5o15' BujurTimur. Secara
administratifwilayah KabupatenBanyuasinmemilikibatassebagaiberikut :

SebelahUtara Berbatasandengan KabupatenMuara Jambi


PropinsiJambidan SelatBangka.
SebelahTimur Berbatasandengan Kecamatan Pampangan
dan Air SugihanKabupatenOgan Komering
Ilir.
SebelahSelatan Berbatasandengan Kecamatan Sira Pulau
PadangKabupatenOgan Komering llir' Kota
Palembang dan Kecamatan' Talang Ubi
KabupatenMuara Enim.
SebelahBarat Berbatasandengan KecamatanSei Lilin, Sei
Lais dan Bayung Lincir Kabupaten Musi
Banyuasin.

Hal2 - 7
RqamMryPmn,rar8ka
PatfurytuorthMUH,

Letak geografislGbupaten Banyuasinyang demikian menemPatkan


tgbupaten Banyuasin pada posisiyang potensialdan strategisdalam hal
perdagangandan industri, maupun pertumbuhansektor*ektor lainnya-
denganibukotaPangkalan
Kondisiini terlihatdari posisilGbupatenBanyuasin
Balai yang terletak di Jalur UntasTimur. Selainitu, lGbupatenBnayuasin
merupakandaerahpenyanggapertumbuhanKota Palembang terutamauntuk
sektor industri. Disisi lain bila dikaitkan dengan rencana pembangunan
KawasanIndustri dan PelabuhanTanjung Api-api, lGbupaten Bnayuaisn
sangatbesarperanannyabagi daerahlain disekitarnyasebagaipusatindustri
hilir, jasa distribusiproduk sumberdaya alam baik pertanian,kehutanan'
perikanandan kelautansertapertambangan.
LuaswilayahlGbupatenBanyuasin Km2yangterdiridari
yaitu 11,832,99
15 Kecamatan dimanajumlah
yangterbagimenjadi272 desadan 16kelurahan
lll yaituberjumlah32 desa-
Banyuasin
desaterbanyakdimilikioleh Kecamatan
SedangkanKecamatanterluas yaitu KecamatanBanyuasinll dengan luas
wilayah sebesar2.681,28 Km2 atau sekitar 22,66 Persendari wilayah
KabupatenBanyuasin.Kecamatandengan luas terkecil adalah Kecamatan
RantauBayurdenganluaswilayahsebesar 5,OlpersenluaswilayahlGbupaten
Untuklebihrincinyadapatdilihatpadatabeldi bawahini :
Banyuasin.

H a l2 - B
RencatnPembangunanJlwlo Dlh ?
PaniangDaerah2ubzo2s DfiU L
HfuT*

.$tMff'lr?

Tabel2.1.
LuasWilayah Kecamatandi KabupatenBanyuasin
Luas
Jumlah Jumlah
No. l(ecamatan Wilayah
Desa lGlurahan (Ha)
l. RantauBayur 2"1 593,OO
2. Rambutan 20 624,55
3. BanyuasinI 21 2 701.38
4. Makarti Jaya t2 I 736,34
5. Betung 19 2 794.OO
6. lll
Banyuasin 32 5 874,17
7. PulauRimau 28 94/..O5
8. Muara Telang 20 1.150.06
9. TalangKelapa 5 6 1.175.52
'1.558,64
lo. Muara Padang t5
11. ll
Banyuasin 21 2.68'1,28
12. Tungkalllir * ll t(

13. Tanjung Lago* 15 rt

14. Muara Sugihan* 20 rt

15. Air Salek* 12 -*

Jumlah 272 t6 11.832,99


Sumber: BadanPusatStatistikKabupatenBanyuasin
* : Angkamasihtergabungdengankecamataninduk

lGbupaten Banyuasinberiklim tropis dan basahdengan variasi hujan


antara 1,07 dan 13,32 mm sepanjangtahun. Sedangkankondisi topografi
memperlihatkan8Oo/odataranrendahberupapasirpantai, rawa pasangsurut
dan lebak yang terletak di bagian aliran Sungai Banyuasin(Kecamatan
Banyuasinll, KecamatanMuara Telang,KecamatanMakarti Jaya, Kecamatan
Pulau Rimau dan sebagianBanyuasinl) dan 20 olo lagi merupakandataran
tinggi dan perbukitandenganketinggianrata-rata2O-4Omdiataspermukaan
laut, diantaranyaKecamatanBetung, KecamatanBanyuasinlll, Kecamatan
TalangKelapa,KecamatanBanyuasinI dan KecamatanRambutan.

H a l2 - 9
Renam PenbngtmnJang*a
PanJangDacnh2lXb2O25
Bab
2
to{@
PETAADTIINISTRASI

E
l|@,@6n
1GBUPATEN
BANYUASII
i!0[!b
I
PROUTSJATBI ,

n
a a l
- -

+ | r*
|r.'-'

I
R8 L.gaDda:
a hX.Elbffir
- - Er lDtlt
---8|'r r|!t*

E , -j.'"*{
--- lar X.q'a
. .. .o.*r{L
-.bbn
-J.bn
- Soeri
l.gn
||!{t&n
||u

I 7.,1\" lzrabltiusi t S.hh


I Eatrerh I
ltturh ll
I
a IrF rh il
* Lxle

RF lblti$F
-&ul*rj
*EnnSS-
*n t lal
tildil Filr
Eob6
Fe{ a.ir

E il4l f.tsng LbD.


Tulre Lrt
Tutld lt

36t.r llb :

f; L h Rltr luj lEFh


$bb t :totd
2. RTRS (.bsrnn
3. &rliit 20,C
oDtr.fi
lDp.do

l,0I

"g \a\

*'^-/
.Y

s tdbMru,-.

tos.q) 1(!.:I),
5ffi:*
Gambar2.1.PetalkbupatenBanyuasin

tanahdi Kabupaten
Keadaan terdiridari4jenis,yaitu:
Banyuasin

l) Organosol terdapat di dataran rendah/rawa-rawa.


2) Klei Humus terdapat di dataran rendah/rawa-rawa
3) Alluival terdapatdi sepanjangsungai.
4) Padzoik terdapatdi daerahberbukit-bukit.

Sementara kondisi hidrologi berdasarkan sifat tata air, wilayah


lkbupaten Banyuasindapat dibedakan menjadi daerah dataran kering dan
dataranbasahyang sangatdipengaruhioleh pola aliran sungai.Aliran sungai
di daerah dataran rectangulardan di daerah kering pola alirannya dandritik.

H a l2 - 1 O
Rqtam funfungr'tPn,targlo
Parfit gOssnh2OO6'4AF

,.
il_r. ,. .
.:
sungai calilq
Beberapasungai besar seperti sungai Musi, stingai Banyuasin;
air sepanjang
SungaiTelang dan lainnya berpenansebagaisaranatransportasi
di
garis pantai lebih dari l5o Km. Pola aliran sungaidi wilayah ini, terutama
untuk .
daerah rawa-rawa dan pasangsurut umumnya rectangular,sedan$kan
daerah yang dipengaruhioleh pasangsurut aliran sungainyaadalah subpanli
genangan
dimana daerah bagian tengah di setiap daerah seringdijumpai air
yang cukup luas.
Pada umumnya, karena Banyuasinmerupakan kabupaten yang relatif
pelayanansosial
baru sehinggamasih memPunyaiketerbatasanaksesterhadap
wilayah,
dan ekonomi, terbatasnyatransportasiyang menghubungkanantar
wilayah'
belum optimalnya dukungan sektor terkait untuk pengembangan
Sebagaidaerah otonom yang baru, KabupatenBanyuasinbelum mempunyai
pembangunan
kebijakan khusus dalam rangka pengembanSan dan
wilayahnya. Arahan pengembanganpusat permukiman wilayah Kabupaten
Banyuasindidasarkanatas analisisdan kajian terhadap kondisi eksistingdan
pengembangan
kecenderunganperkembanganyang akan terjadi' Untuk itu
pusatpelayananwilayah di KabupatenBanyuasindiarahkansebagaiberikut:
l) PusatUtama (Orde l)
MenurutUUNomor6/2o02'KotaPangkalanBalaiditetapkansebagai
lbukota KabupatenBanyuasindengan fungsi utama'pusat pemerintahan
dan pendidikan yang ditunjang oleh kegiatan jasa dan perdagangan'
Dengan demikian dalam hirarki pusat pelayanan,Kota PdngkalanBalai
pelayanan
diarahkansebagaiPusatPelayananUtama (Orde l) denganskala
mencakupseluruhwilayah KabupatenBanyuasindan sekitarnya'
2) SubPusat(Orde ll)
Kota
Sukajadi secara geografis letaknya berbatasan langsung dengan
Palembangyang menjadi pusat pertumbuhan utama di PropinsiSumatera
Setatan.Dalam hirarki pusat pelayananKota Sukajadidi KecamatanTalang

H a l2 - l l
Retwm MngwnnJangka
PatfuAtucnhWm6

lklapa dan Mariana di Kecamatan Rambutan diarahkan sebagai Pusat


pelayananOrde KeduasetelahKota PangkalanBalaidan Kota Betung.
Kota Sukajadi diarahkan untuk pengembangankegiatan iasa perd.agangan
dan industfi pengolahan, selain Penyangga Kota Palembang untuk'
pengembangan permukiman. Sedangkan Mariana diarahkan untuk
pengembangankegiatanpermukimanperkotaan-
3) SubSubPusatPelayanan(Orde lll)
Arahan pengembangan pusat pelayanan pada Orde Ketiga mencakup
beberapapusat pelayananyaitu Teluk Betung,Muara Telang,Makarti Jaya
dan SumberMakmur. Pelayananini diarahkanmempunyaiskalapelayanan
yang terbataspada daerah disekitarpusat tersebut.Khususuntuk Sungsang
perlu mendapatperhatiankhususkarena'letaknyaberadadalam kawasan
lindung pantai berupa Hutan Mangrove. Selanjutnyapengembangan
menurut kelompok wilayah, untuk Pusat PelayananUtama dan Kedua
diarahkan bagi pengembanganwilayah perkotaan, sedangkanuntuk pusat
wilayah pedesaan.
pelayananOrde Ketigadiarahkanuntuk pengembangan
kelompok
Arahankegiatanyang akan dikembangkanuntuk masing-masing
wilayah adalah:
a) Wlayah Perkotaan, pengembangannyadiarahkan untuk kegiatan jasa
pelayanandistribusidan koleksi hasil sektor primer maupun industri
pengolahan ditunjang dengan pengembangan fasilitas perkotaan
lainnya;
b) Wilayah Pedesaan(Hinterland, pengembangannyadiarahkan sebagai
kawasanpengembanganproduksi (KPP)atau kawasansentraproduksi
dan daya dukunglahan.
(KSP)sesuaidenganpotensikesesuaian
pusat permukimandi KabupatenBanyuasinselanjutnya
Pengembangan
akan diarahkan untuk : pusat pelayananwilayah, pusat komunikasiantar
witayah (inter-regional communication), pusat kegiatan industri (processing

H a l2 - 1 2
Rcrrarrnfurrfurrg.frPn Jat gka
Pat&wD*nh2OMU,5

dan PusatPermukiman(residential)'Di lain sisi'dengan


and manufacturing)
(hinterland)
kedudukanlGbupaten Banyuasinsebagaiwilayah Penyangga
permukimanwilayah ini
pusat-pusat
Kota Palembang,maka pengembangan
untuk:
jugadiarahkan
baik hasilpertanianmaupun
usahamasyarakat
a) pusatpemararanhasil-hasil
nonpertanianyangdihasilkandariwilayahBanyuasin;
angkutan
b) pusat permukimansebagaiterminal jasa distribusibaik;bidang
maupunPerdagangau
pelayanan
c) Pusat permukimanharus merupakanpusat pelayananiasa,
ekonomitermasukPerbankan'

namun
Peran sektor pertanian ternyata iuga bersifattidak langsung
konteks keterkaitan
tetap signifikan yaitu berupa efek pengganda dalam
masukan-keruaran antar agroindustri,investasidan konsumsi.Selainitu sektor
menggiatkan
pertanian menjadi andalan utama untuk membangun dan
ekonomi produktif
dinamika ekonomi pedesaanmelalui pengembanganusaha
ity, pertumbuhan
bidang pertanian berbasis sumberdaya lokal. Selain
menjaga laju
pertanian yang positif secarakonsistensangat berperan dalam
dengan
pertumbuhan ekonomi daerah mauPun nasional,.bahkan,niampu
moneter' Hal ini
cepat untuk pulih pada masa krisis ekonomi dan
pada ketersediaan
menunjukkan bahwa sektor pertanian yang bertumpu
tangguh bertahan
dan/atau berbasissumberdayadomestik terbukti cukup
sebagaiPenyanSSa Perekonomian'
dan terkait
Selanjutnya,salahsatu isu penting yang seringmengemuka
nasional'
erat dengan sektor pertanian adalah masalahketahananPangan
it

Hal2-13
Rercam PembtguwnJarylea
PantangOaenh 2ilr6'm25

wilayah dan rumah tangga. Kondisi ketahananpangan akan tercipta dengan


terpenuhinyapangandalam jumlah, mutu, keamanan,dan kesesuaian dengan

sosio-kultur, serta dapat diiangkau secara fisik maupun ekonomi' dan


dimanfaatkan sesuaikebutuhan individu setiap waktu untuk sehat, tumbuh
dan produktif. Unsur utama dari ketahanan pangan adalah ketersediaan
pangan yang cukup, distribusinyameniamin setiap individu dapat mengakses
dan mengkonsumsisehinggamereka memperoleh pasokan zat gizi dengan
jumlah dan keseimbanganyang cukup. PentingnyaketahananPangansangat
penting terkait pula dengan masalah kestabilanekonomi, sosial-politikdan
keamananbangsakarena dengan kondisi tersebutkita tidak perlu tergantung
pada negaralain dan terbebasdari ancamanpenjaiahan'
Lebih dari itu pada era- globalisasi ini, peningkatan keunggulan
kompetitif berupa kemampuan yang tinggi dalam pengembangan dan
pemanfaatanteknologi, pengembanganjasa dan iaminan pelayanan oleh
manajemenyang terpercaya,sertapenguasaansistemdan aksesinformasiyang
akurat menjadi semakinpenting. Meskipundiakui masih memerlukanwaktu
untuk mencapai tingkat keunggulan kompetitif yang mantap' upaya-uPaya
yang seriusharusselaludiprogramkandan dilaksanakankarenatantangandan
persainganyang dihadapi akan semakinberat. Keberhasilansektor pertanian
dalam arti' luas melewati masa krisisekonomi dan moneter tidak lepasdari
kebijakan dan pelaksanaanprogram pembangunanpertanian pada periode
sebelumnyayang memfokuskanpada upaya mengatasidampak krisismelalui
implementasi pembangunan sistem dan usaha agribisnis sebagai strategi
utamanya. Sistem agribisnis merupakan kesatuan atau totalitas kinerja
agribisnisyang terdiri dari subsistemhulu berupa kegiatan ekonomi input
(masukan)produksi, informasi dan teknologi; subsistemusahataniberupa
kegiatan produksi pertanian primer tanaman pangan dan hortikultura'
peternakan, perikanan, dan kehutanan; subsistemagribisnis pengolahan,

Hal2 - 14
Rcnann fumhtgr*unJsry*E
PatfiryDaqahffiffi|5

pemararan,dan subsistem
subsistem penuniangberupadukungantaranadan
prasaranaserta lingkunganyang kondusif bagi pengembanganagribisnis.
Namun demikian sirtem agribisnistidak akan berkembanglancar apabila
tidak berjalanatau bekerjaaktif, karenapadadasarnya
agribisnis
usaha-usaha
yang merancang,merekayasa,dan melakukanproses
para pengusahalah
itu sendirimulaidari prosesproduksihinggaProsesPemasaran-
agribisnis
Pembangunan pertanianyang merupakankegiatanutamadi lGbupaten
Banyuasinselamaini diarahkanuntuk meningkatkanproduki per satuan
lahan,bukankenaikanproduksiper keluargaatauper kapita.lGrenaorientasi
ditekankanpadapertambahan produksi,makadiperlukanprogramyanglebih
intensifdemi meningkatkanproduksipertanian.lGbupatenBnayuasinbisa
dikatakansebagaidaerahpertaniankarenasektorpertanianmemberikanandil
yangbesarbagiperekonomian di daerahini.-Halini bisadilihatdari peranan
sektor pertanian terhadap Produk Regional Domestik Bruto (PDRB),
penggunaan lahanuntuk sektorpertaniandan jumlahpendudukatautenaga
datatahun 2006,andil
kerjayangbekerjapadasektorpertanian.Berdasarkan
sektor pertanianterhadap PDRBatas dasar harga berlaku dengan migas
mencapai32,17persenatau termasuksektoryang palingdominan.Total
yang berupapadi sawah
produki padi tahun 2OO6di KabupatenBanyuasin
pasangsurut,sawahsonor,sawahlebak,sawahtadahhujandan padi ladang
mencapai571.187,2ton. Hasilproduksiini sedikitmenurundari tahun2OO5
yangsebelumnya mencapai597.31O,3 ton. Penurunanproduksiini bukanlah
sesuatuberarti,namunjika tidak segeraatasi,makaakanberpengaruh pada
sektor-sektorlainnya. Untuk melihat luaspanen dan produksipadi menurut
jenisnya per Kecamatandi Kabupaten Banyuasindari tahun 2OO2sampai
tahun 2005 dapat dilihat lampiran tabel.
Selaindari padi,Kabupaten
Banyuasinjugamerupakan daerahpenghasil
tanamanpalawijasepertiketelapohon,ubi jalar, kacangtanah,kacanghijau,

H a l2 - 1 5
Retwm htfungPnpn Jarrgra
Pafiirytucnhm&2Qi6

kacangkedelai dan jagung. Pada tahun 2@2 total luas panen tanaman
palawija adalah 19.296ha dengan produksi sebesar155.947,70ton dan
tingkatproduktivitasnya g,O8ton/ha. Kemudiantahun 2OO3produksi
sebesar
jagunglGbupatenBanyuasinmencapai9871,6ton, ubi kayu sebesar21,502
ton, ubi jalar,sebesar2.192,4ton, kacangtanah sebesar1.789,7ton, kacang
kedelaisebesar105,6ton dan kacanghijau sebesar7O,4 ton. Tahun 2OO4
produksitanamanpalawijamengalamipeningkatan,yaitu jagung meningkat
'
dari tahun 2OO3,yaitu mencapaill.80l,5 ton, ubi kayu 29.624 ton, ubi jalar
8.O97,t ton, kacang kedelai 223,7 ton dan kacanShijau 139,1 ton namun
produksi kacangtanah mengalamipenurunandari tahun lalu, yakni hanya
sebesar 588,8 ton. Pada tahun 2006 dari keenam komoditas tanaman
palawija tersebut, hanya komoditas jagung yang mengalami peningkatan
produksi, sedangkan komoditas lainnya cenderung mengalami penurunan
produksi. Untuk melihat luas'panen dan produksi palawiia menurut ienisnya
di tGbupaten Banyuasin dari tahun 2OO2 sampai tahun 2006 dapat dilihat
lampiran tabel.

PREDIKSI

di sektor tanaman pangandan hortikultura diantaranya


Permasalahan
adalah rendahnyaharga produk yang disebabkankarena kualitasproduksi,
aksespasardan persaingandari pihak lain, rendahnyaProduktivitaspertanian
dan tanamanhortikultura,kurangnyasumberdaya manusiayang berkualitas,
permintaanpasarterhadapkomoditi yang belumdapat dipenuhidan sebagian
besarproduk komoditi masihdihasilkandalam bentuk produk primer karena
teknologipengolahanhasilatau usahaagroindustri.
belum berkembangnya
Sektorpertaniandi KabupatenBanyuasindalam kurun waktu 20 tahun
mendatang menghadapi tantangan bagaimana mendorong peningkatan

H a l2 - 1 6
Rcnam funfuryrupnJatu*
Pat*ngOaeahffiffi6

komoditi unggulan dan produktivitas tanaman pokok melalui ketersediaan


serta pemakaian sarana produksi dan teknologi pertanian yang tepat guna
dengan tetap menjaga atau bahkan dapat meningkatkan mutu dan harga
produk agar tetap bersaing di pasaran. Pertambahan penduduk yang
meningkatjuga memberi dampak menjadi semakinsempitnyaareal pertanian
yang pada akhirnya dapat mengakibatkanpenurunan kapasitasjumlah
produksi pertanian.
Selain itu, ketersediaanalat-alat pertanian yang masih sedikit iuga
menjadi penghambat keefektifan petani dalam meningkatkan jumlah dan
mutu dari produksi yang dihasilkan. Persainganharga produk pangan dari
daerah lain (impor) menyebabkan para petani tidak dapat
menjaga/mempertahankanharga produksinya dikarenakan monitoring dan
informasi mengenaiharga kebutuhanpangan masih kurang. Disampingitu
masih banyak produsen, penjual/pedagangdan konsumen yang belum
mempedutikanmasalahkeamananpangan,untuk itu diperlukanpengawasan
yang ketat dan memberikan sanki yang tegas bagi yang melakukan
pelanggaran.
Pola konsumsidan gaya hidup masyarakatyang semakintinggi terhadap
pola pangan/makanan cepat saji dan siap santap dapat menyebabkan
terjadinya rawan pangan. Informasi, pengetahuan dan perkembangan
teknologi sektor pertanian di masa mendatang akan semakin cepat
berkembang,jika hal ini tidak segeradiantisipasibukantidak mungkinproduk
dari luar akan menguasaipasardalam negeri(lokal). Meskipunsudahtersedia
teknologi siap pakai yang dapat diadopsi dalam pelaksanaandisektor
pertanian, namun tetap saja diperlukan program penelitian dan
pengembangan yang relevan. Justru karena ketiadaan ketidakseriusan
pelaksanaannyasaat ini masih menjadi kendala dalam upaya percepatan
pembangunandi sektor pertanian.

Hal2 - 17
Rcnatn Penfu ryrnnn,tary*a
PadaryOaetah 2Wffi15

SEKTORPETERNAKAN

Dengan mendasaripendekatanpembangunanyang akan dilakanakan


dalam pemberdayaan masyarakat dan perkuatan ekonomi rakyat, maka
pembangunansektor peternakanke depan perlu berorientasipada penerapan
konsepagribisnisdan agriindustri.Penerapankonsepagribisnisdan agriindutri
maksudnyaialah sektor peternakanini harusberbasispada ilmu pengetahuan
dan teknologi yang berwawasantingkunganserta pemanfaatansumber daya
lokal secara optimal dan berkesinambungan(sustainable). Oleh karena itu
untuk mempercepat tercapainya tujuan pembangunan dalam sub sektor
peternakan perlu diterapkan pola usaha tani terpadu dan terintegrasi
(intqrated farming syrtem)dengansub sektor lainnya sepertitanaman pangan
dan perkebunan. Hal ini sangat diperlukan sebagai uPaya pemenuhan
penyediaanpakan ternak secaramurah dan berkualitasyang berasaldari
limbah tanaman pangandan perkebunansepertijerami padi, jerami jagung
dan lain-lain. r;Uilayah Kabupaten Banyuasin memiliki potensi untuk
dikembangkanmenjadisentrapeternakan.Potensitersebuttidak hanyadilihat
dari keunggulankomparatif wilayah semata,tetapi juga letaknyayang strategis
terhadap pasar yang membawa keunggulan kompetitif bagi sektor
perternakan.
Tujuan yang ingin dicapaidi sektor peternakanini yaitu terlaksananya
swasernbadadaging, susudan telur di KabupatenBanyuasindalam rangka
mewujudkanmasyarakatyang sehat,cerdasdan sejahtera.Untuk tercapainya
tujuan tersebutpengembangan poputasiternak yang telah diproyeksikanyang
hanya dapat terwujud melalui program penyediaanbibit unggul,penyediaan
potensisumberdaya lokal, peningkatan
pakanternakdenganmemaksimalkan
pelayanankesehatanternak sertaperbaikansaranadan prasaranaPenunjang
di sektor peternakan.Hasil produksiternak sepertidaging, susudan telur.di

H a l2 - 1 8
Rcnam funfuUpnpnJarylo
ht&qOunhM25

lQbupaten Banyuasin terus meningkat. Secara umum peningkatan hasil


produksi peternakan disebabkan oleh keberhasilanusaha intensifikasidan
peningkatanpopulasiternak.
Jenisternak yang ada di lGbupaten Banyuasinterdiri dari sapi, kerbau,
kambing, domba dan babi dan ternak unggasterdiri dari ayam petelur, ayam
pedaging,ayam buras dan itik. Berdasarkandata yang ada diketahui bahwa
populasiternak di lGbupaten Banyuasinpada tahun 2OO2yaitu sapi sebanyak
16.371ekor, .kerbau sebanyak1.416 ekor, kambing sebanyak 29.792 ekor,
domba 4.546 ekor dan babi sebanyak2.494 ekor. Pada tahun 2OO4hanya
populasi ternak sapi dan kerbau yang mengalami peningkatan yaitu ternak
sapi meningkat menjadi 18.375 ekor dan kerbau meningkat menjadi 1.619
ekor, sementarapopulasi ternak lain mengalamipenurunan, seperti kambing
turun menjadi 18.682ekor, domba turun hinggamenjadi 1.896 ekor dan babi
turun menjadi 1.97Oekor. Hinggapada tahun 2006 populasiternak babi dan
domba terus mengalamipenurunan,yaitu babi poputasinyahanya 9O5 ekor
dan domba turun menjadi 1.249 ekor. Sementarapopulasiternak lain pada
tahun 2006 terus mengalami peningkatan seperti sapi meningkat menjadi
19.607 ekor, kerbau menjadi l.Bl2 ekor dan kambing meningkat sampai
19.835ekor.
Sedangkanpopulasiternak unggaspada tahun 2OO3yaitu ayam petelur
sebanyak 1.O42.O15ekor, ayam buras sebanyak 392.443 ekor dan itik
sebanyak1l9.261ekor.Lalupada tahun 2006 semuaternak ungias meningkat
yaitu ayam petelur meningkatmenjadi4.O5I.OOOekor, ayam buras 622.75A
ekor meningkat dari tahun 2OO5yang hanya berproduksisebanyak578.961
ekor, itik meningkat menjadi 84.334 ekor, kecuali ayam pedaging yang
mengalamipenurunanproduksiyaitu sebesarI.536.000 ekor pada tahun
2OO5 lalu menurun menjadi 1.436.000 ekor pada tahun 2006. Untuk
mengetahui lebih jelas populasi jenis ternak besan kecil dan unggasdari tahun

H a l2 - 1 9
Rqwm funfuVrrnnJev[o
Patfinghq?hm&15

2OO2sampaitahun2@6 per kecamatandi lQbupaten Banytasindapat ditihat


pada tabel di bagianlampiran.

PREDIKSI

terkait di sektorpeternakanantaralain masih


Beberapapermasalahan
rendahnya penguasaanteknologi budidaya dan pengolahanoleh para
peternak,relatifmahalnyahargapakanternakbuatanpabrik,infrastrukturdan
ternakyang belummemadai,masihkurangnyatenaga
saranapengembangan
ternakdan masihtingginyaangkakematian
profesionaldalampengembangan
ternak yang disebabkankurangnyaperhatian dan' petayananterhadap
kesehatan_ternakserta masih rendahnyainvestasidi sektor peternakan
terutamadalamskalayangbesar.
diatas merupakantantangan bagi pemerintahdalam
Permasalahan
kurunwaktu 20 tahunke depanbagaimanamenyiapkan diri, menyikapidan
memanfaatkan itu menjadipeluanguntuk meningkatkan
setiappermasalahan
produksidi sektor peternakandengantetap memperhatikankesejahteraan
parapeternakpadakhususnya
dan masyarakat padaumumnya.
Banyuasin

SEKTORPERIKANANDAN KEIAUTAN

Pembangunansektor perikanandidasariatas visi terbentuknyasistem


agribisnisperikananyang mempunyaidaya saingtinggi. Oleh karenaitu, perlu
dikembangkan suatu kawasan sentra agribisnis perikanan yang lengkap
termsuk berbagaisektor penunjangnyasepertijasa pemasaran,permodalan
Dalam hal ini peran perguruan
penyuluhan, riset dan pengembangannya.
tinggi dan lembagaswadayamasyarakatsangatdibutuhkan. Sektor perikanan

Hal2 - 20
Renam fumliaqrrnn,rarrg*a
PatfuVOeetahffihzot 5

dan kelautan terkait erat dengan upaya peningkatanproduki perikanandan


peningkatan keuntungan petani/nelayan serta peningkatan daya saing
agribisnisperikanandi KabupatenBanyuasin.
Peningkatanproduksi diharapkan akan berpengaruhpada peningkatan
keuntungan.Dengan meningkatnyakeuntunganusahaperikanan, maka akan
menjadi insentif dan motivasi bagi petani/nelayanuntuk lebih meningkatkan
kualitasdan jumlah produksinya.Kemampuanuntuk bersaingmenjadi faktor
penentu keberlangsunganusahadi semuasektor, termasuksektor perikanan.
Jika produk perikanandi lGbupaten Banyuasintidak mamPu bersaing,maka
produk dari luar akan masukdan hal itu dapat mematikanusahaperikanan
lokal. Karenaitu, efektifitasdan efisiensiusahaserta kesinergianantar pelaku
usaha sangat perlu untuk dilakukan. Keuntunganbagi petani/nelayandapat
ditingkatkan dengan memangkas rantai pemasaranartinya petani/nelayan
memasarkanproduk perikanannyake konsumenakhir secaralangsungdan
berusaha untuk mencari/membukapasar baru termasuk pasar luar negeri
produk melaluipengolahanjuga akan memperluaspasar
(ekspor).Diversifikasi
selain dari faktor penunjang lainnya seperti jalan, transportasi, listrik,
komunikasidan air bersih.
lGbupaten Banyuasinmerupakandaerah penghasilproduk perikanan,
mengingat wilayahnya yang sebagianmerupakan wilayah perairan. Produk
perikanandi KabupatenBanyuasinmeliputi perikananlaut, perikanandarat,
perikananbudidayakolam dan perikananbudidayakeramba.Sentraproduksi
SungaiMusi dan daerah
perikananadalahdaerahsepanjangSungaiBanyuasin,
perikananbudidayakolam hampir meratadi seluruh
pesisirpantai.Sedangkan
wilayah Kabupaten Banyuasin.Produksi perikanan laut pada tahun 2OO2
sebanyak49.934,60 ton, perikanandarat sebanyak7.668,5 ton, perikanan
budidaya kolam sebanyak 592,9 ton dan perikanan budidaya keramba
sebanyak 56,00 ton. Dari tahun ke tahun produksi ikan di Kabupaten

Hal2 - 21
RancamfunbngmnJary[a
WgD&rehZqrezftzi

terusmeningkathinggapada tahun 2AA6semuaproduksiikan di


Banyuasin
KabupatenBanyuasinmencapai73.874,36ton atau meningkatsebesarll'76
persendari tahun sebelumnya.Dari total produki ikan tahun 2O06tersebut'
sekitar87,13 persenberasaldari produksiperikananlaut dan 12,87 berasal
dari produksi perikanan darat. Secaraumum produksi perikanan laut
mengalamipeningkatansebesar12 persendibandingkantaun sebelumnya,
sedangkanperairandarat pada tahun 2@6 meningkatsebesarl0,l5 persen
dari tahun 2OO5.IJntuk mengetahuitebih jelas produlcsiperikanan menurut
jeninya per kecamatandan jumlah alat penangkap ikan dari tahun 2OO2
sampaitahun 2OOOdi lebupaten Eanyuasindapat dilihat pada tabel di bagian
lampiran.

PREDIKsI

perrnasalahan
yangadadi sektorperikanan yaitu mengenai
diantaranya
kurangnya sarana dan prasaranadalam rangka pembangunansektor
benihdan pakandalamusahapembudidayaan,
perikanan,masihterbatasnya
di sektorperikanan
masihkurangnyasumberdaya manusiayang profesional
dan masihbanyakditemukannya penangkapanikandengancaraterlaranS-
Di sektorperikanantantanganke depan yang perlu di jawab adalah
bagaimana permasalahan
peranpemerintahdalammengatasi yangterjadidi

sektorperikananadalahbagaimanamelengkapi dalam
saranadan Prasarana
upaya melaksanakanpembangunandi sektor perikanan.Perkembangan
tantangan
iuga merupakan
teknologiyangsemakincepatdi masamendatang
dengandaerahlain.
agartidaktertinggal
yangharusdijawabpemerintah

Hal? - 22
RencamWqPnPnrrargfrt
" PatfittgQotahffiO.zftro

SEIffOR KEHUTANAN

Hutan meruPakan kekayaan alam yang serbaguna yang dapat


memanifestasikandirinya dalam berbagai bentuk dengan tepat. Selamaini
sektor kehutanan tumbuh dan berkembang dengan memberikan kontribusi
penting bagi proses pembangunan yang tercermin dari kontribusi bagi
pertumbuhan ekonomi daerah. Sektor kehutanan memberikan kontribusi
terhadap peningkatandevisadan pendapdtandaerahsertapenyeraPantenaga
untuk kemakmuran
kerja. Pemanfaatanhutan dimaksimalkansebesar-besarnya
dan kesejahteraanrakyat tanpa mengabaikankelestarianfungsinya.Manfaat
dari keberadaanhutan tropis lndonesiatidak hanyadirasakanoleh pemerintah
dan rakyat'lndonesia, Hal ini terlihatdari
tetapi juga masyarakatinternasional.
manfaat hutan, terutama hutan tropis secarainternasionalsebagaiparu-paru
bumi, sumber bahan baku dan plasmanutfah. Fungsihutan adalah sebagai
tempat persediaan ptasma nutfah dan perlindungan terhadap ekologi
penyangga kehidupan juga merupakan tempat kehidupan flora dan fauna
hidup biota yang ada
yang beragam.Hutan sangatpentingbagi kelangsungan
di datamnya,oleh karenaitu penebanganhutan secaraliar dapat mengubah
ekosistemyang ada dan mengganggukehidupan satwa lainnya. Sasarandari
pembangunan sektor kehutanan adalah terwujudnya keseimbanganfungsi
hutan sebagaisumberpembangunandan penyanggasistemkehidupansecara
lestari dan efisisen untuk mendukung terselenggaranyapembangunan
berwawasan lingkungan dan berkelanjutan serta meningkatkan sebesar-
besarnyamanfaat hutan bagi kesejahteraandan kemakmuranrakyat melalui
peningkatanpengetahuan,kesadarandan peran aktif masyarakatluas.Oleh
kawasanhutan tetap
karenaitu perlu diiringi dengan mantapnyabatas-batas
usahaperhutananrakyat bertujuan
dan fungsinyadi lapangan.Pengembangan
meningkatkannilai tambah hasilhutan, baik hasilhutan berupakayu mauPun

Hal2 - 23
Rancam MtgzranJangka
hdang Mtth 200effir5

non kayu melalui pengembangankesempatanberusahabagi masyarakat


rendah melalui koperasi,usahamenengah,usahakecil dan
berpenghasilan
tradisional. Untuk meningkatkansumber daya manusia dalam bidang
kehutanan dilakukan pendidikan, pelatihan maupun penyuluhan serta
pembinaanpengrajinkayu.
Menurut fungsinya,hutan dikelompokkanmenjadi: Hutan Konversi,
Hutan Lindung,Hutan Produki dan Hutan ProduksiYangDapatDikonversi.
lqbupaten Banyuasindenganluaswilayah 11.832,99Km2memilikikawasan
hutanseluas465.661ha,yangterdiri dari Hutan Konversiseluas267.932ha,
HutanUndungseluas67.233ha, HutanProduksiseluas75.080ha dan Hutan
ProduksiYang Dapat Dikonversiseluas55.416ha. Dari data yang didapat
peredaranpengirimanhasil hutan kayu bulat di dalam negeri pada tahun
2OO3yaitu gelamsebanyak7OOM3, akasiasebanyak4.897,67M3 dan kayu
karet sebanyak553,09M3. Padatahun tahun 2OO4hanyajenis kayu karet
yangberedar,yaitu sebanyak46.053,48M3. Padatahunberikutnyajeniskayu .
kembaliyaitugelamsebanyak
gelamdanakasiamulaiberproduksi 799,50M3,
akasiasebanyak140,69 M3 dan jenis kayu karet meningkatdari tahun
sebelumnyamenjadi sebanyak87.469,89M3. Sementarapada tahun 2006
jenis kayu gelam berproduksisebanyak883,11M3, kayu akasiasebanyak
275,49 M3 dan kayu karet mengalamipenurunandari tahun sebelumnya,
yaitu hanyaberproduksisebanyak40.144,93M3. Untuk mengetahuilebihielas
volume kayu menurut jenisnya dan peredaranpengiriman hasil hutan kayu
bulat dalam negeri dari tahun 2002 sampai tahun 2006 di tGbupaten
Banyuasindapat dilihat pada tabetdi bagianlampiran.

Hal2-24
Retwnfuahqrnpn,teg[a
tu&WOaqeh2O0HOl6

PREDII(sI

Padamasamendatang,persoalankawasanhutan yang tidak berhutan


lagi, meningkatkankemampuan rehabilitasi,menuntaskanpemantapan
kawasan hutan dan menyelesaikanpenunjukkan kawasan hutan dan
pengairan,menjadi tantanganterberat di sektor kehutanan.Persoalanlain
yang menyertainya adalah pengelolaan hutan juga masih cenderung
berorientasiekonomi, kualitasSDM aparat dan masyarakatyang belurn
ke wilayahhutanyangrelatifmasihsulit,masihadanya
memadai,aksesibititas
konflik sosial didalam dan disekitar hutan serta belum memadai dan
ilmu pengetahuan
meratanyapenguasaan teknologidi sektorkehutananserta
masihbelum didukungoleh sistemdan aturaq pendanaanuntuk investasi
sektorkehutanan.
Tantangan yangantisipatifmeliputimasalah
kehutanan masihlemahnya
penegakkanhukum, makin meningkatnyagangguanalam sepertikekeringan
dan perubahan perambahan
iklim, masihberlangsungnya dan penebangan
liar
dan masihseringterjadinyakebakaranhutan.

SEKTORPERKEBUNAN

Komoditi utama sektor perkebunandi KabupatenBanyuasinadalah


tersebut
komoditaskaret dan kelapasawit.Secaraekonomi,tanaman-tanaman
mampu memberikanandil yang cukup besarterhadap kelangsungan
hidup
masyarakatdan memberikankontribusi yang tinggi terhadap pertumbuhan
ekonomi daerah. Selainitu di sektor perkebunanterdapat juga komoditas
sayur-sayuran dan buah-buahan. Tabel-tabel luas areal dan produksi
komoditas perkebunan dari tahun 2002 sampai dengan 2OO5 dapat dilihat

Hal2 - 25
Renam funhngwunJsrgra
PartangMrmAU5

pada lampiran. Pelaku usaha perkebunan di Kabupaten Banyuasin


yanSusahanya
dikelompokkanmeniadi2 (dua)kategori,yaitu l) perkebunan
sendiriataulebihdikenaldengannamaPerkebunan
dilakukanoleh masyarakat
Rakyat;2) perkebunanyangusahanya dilakukanoleh badanusahaataubadan
hukumyangdikenaldengannamaPerkebunan rincipembahasan
Besar.Secara

dari keduakategoritersebutadalahsebagaiberikut:
t) perkebunanRakyat,pada tahun 2006 komoditasperkebunanrakyatyang
menghasilkanproduksi tertinggi adalah karet dan kelapa sawit, yaitu
masing-masing sebesar91.126ton karet dan 35.549ton untukkelapasawit;
2) perkebunan Besar, komoditas perkebunan besar yang menghasilkan
produksitertinggitahun 2006 di KabupatenBanyuasin adalahkelapasawit
dan karet.Jumlahproduksikelapasawit mencapai68.69l ton sementara
22204 ton.
produksikaretdalam bentukkadarkaret kering(kkk) sebesar
Jika dibandingkanproduksitahun sebelumnya,produki karet rneningkat
sebesar9,46 persendan produksikelapa sawit meningkatsebesarl'95
persen.LJntukmengetahuitebihjelas luasarea dan produlcsiper kecamatan
dari tahun 2OO2sampai tahun 2006 di KabupatenBanyuasindapat dilihat
pada tabel di bagianlamPiran-

PREDIKSI

Di sektor perkebunan tantangan ke depan adalah mencakup


peningkatanproduktivitas komoditi utama perkebunandengan cara
penyediaanbibit unggul yang memenuhi kebutuhandan Penggunaan
memperoleh
teknologiyangmpdern.Untukparapetanipekebun,kemudahan
awal,peremajaan
danauntukinvestasi dan pemeliharaan menjadi
perkebunan
yangperludicarikanjalankeluarnya
sesuatu

Hal2 - 26
Retwne fuahnguunJangto
WryOsahN64O/E

Disisilain, tantanganyang akan dihadapiadalahbagaimanamengatasi


di
seranganhama penggangguyang mengakibatkanterjadinya kerugian
tingkat pascnpanen yang berdampakpada turunnya mutu produk hasil,
nilai jual produk menjadirendah.Demikianpula den$ansaranadan
sehingga
prasaranadalam melakukanpengolahankomoditi perkebunanyang ada di
KabupatenBanyuasinyang tersebarpada sumber-sumber bahan bakunya.

Disampingitu, peningkatankualitassumberdaya manusiadalam mengelola


perkebunansertabagaimanakesejahteraanParapetanipekebundapat selalu
terjagamerupakantantanganyangharusdijawaboleh pemerintah'

SEKTORPERTAMBANGANDAN PEN@ALIAN

Pembangunansebagai upaya dalam mengolah dan memanfaatkan


sumber daya alam bertujuan untuk meningkatkan kesejahteraandan
kemakmuran masyarakatnya.Oleh karena itu, dalam penggunaansumber
daya atam harusdilakukansecaraselaras,serasidan seimbangterhadapfungsi-
fungsi lingkungan.Pembangunandengan menggunakansumber daya alam
secara terus menerus dalam rangka meningkatkan kesejahteraan dan
kemakmuran masyarakat,harus tetap memperhatikan ketersediaansumber
daya alam yang semakinlama semakinmenipis-
Pembangunan sektor pertambangan di Kabupaten Banyuasin

merupakanbagiandari pembangunandaerah yang berkelanjutan(sustainable


developmenf1 dan berwawasan li ngkungan (eco-developmenl).Kegiatanpada
sektor pertambanganlebih dititikberatkan pada kegiatan penelitian dan
bahan-bahangalian.Disarnpingitu dalam usahamengembangkan
inventarisasi
eksplorasidan ekploitasi akan terusdilakukanmelaluikontrak karya maupun
kontrak bagi hasil dengan Para investor asing. Upaya-upaya untuk

Hal2 - 27
RatanWtArnPn,hrda
WAOnnhzOOezW

sumkr minyak bumi


memeperluasjangkauan cekunganhidrokarbon terhadap
dan vital di Kabupaten
akan terus dilakukan. Barangtambang yang strategis
tambang lainnya (barang
Banyuasinmeliputi minyak bumi. Sedangkanbarang
pasirdan koral'
tambanggolongan c) adalahtanah uru8, tanah liat'
Banyuasinadalah
Jenis bahan galian yang mendominasidi lQbupaten
jumlah produksi' tetapi
tanah urug. Walaupun sempat mengalamipenurunan
Banyausinini'
bahan galian berupa tanah urug tetap dihasilkandi Kabupaten
M3' kemudian
Pada tahun 2OO2 produksi tanah urug sebanyak 484'414
Mr' Tahun
mengalami penurunan pasa tahun berikutnya menjadi 137'551
penurunan menjadi
2OO4 produksi tanah urug kembati mengalami
mulai meningkatpada tahun berikutnyayaitu
63.5lZ Mr dan berangsur-angsur
menjadi
tahun 2OO5meningkat menjadi 71-550 M3 dan pada tahun 20ci6
2g3.O2SM3. Jenisbahan galian lain sepertitanah liat, pasirdan koral selalu
mengalamifluktuasijumlah produksi. Tanah liat meningkatdari 8-855 M3
pada tahun ZOO5menjadi 11.590M3 pada tahun berikutnya. Padahalpada
tahun 296.4,tanah liat sempat berproduksi mencapai 31.328 M3. Sedangkan
produki bahangalian berupa pasirgrafik fluktuasinyahampir seruPadengan
produksi jenis tanah liat. Pada tahun 2OOt4pasir berproduksisebesar|2-OOO
M3, falu pada tahun 2OO5mengalamipenurunansampai6.250 M3, dan pada
tahun 2006 kembali meningkat menjadi 7.500 M3. Bahkan yang lebih
memprihatinkanadalah jenis bahan galian berupa koral yang berproduksi
hanya pada tahun 2OO2yaitu sebesar409 M3 dan tidak berproduksi lagi
sampaipadatahun 2@6.
'Banyuasin
Di Kebupaten selain merupakan daerah yang memiliki
potensi pertanianjuga menyimpankandunganenergiyang tak ternilai,yaitu
batubara. Hingga saat ini kandungan batubara di Kabupaten Banyuasin
diperkirakan mencapaimencapai 2,5 miliar ton dengan kalori diantara 4OO0-
5OOOkalori yang terdapat di dua kecamatanyaitu KecamatanRaritau Bayur

Hal2 - 28
RenatpknfuUn*nnrhqro
Par{ergOsrehffi-m2!,

dan KecamatanPulauRimau.Sedangkan ienis bahan tambangyang paling


adalahminyakbumi yangdari tahunke
di lGbupatenBanyuasin
mendominasi
tahun mengalamipeningkatanproduki. Pada tahun 2OO3minyak bumi
1.512.0@barel dan meningkatjumlah produksinyapada
berproduki sebesar
tahun 2W4 menjadi sebesar8.260.620 barel. Pada tahun 2006 kembali
meningkat menjadi 8.317.312 barel setelah tahun sebelumnyahanya
berproduksisebesar7.515.420baret. Untuk mengetahuilebihJumlahProduksi
Jenis Bahan 1atian Colongan C dan gahan Tambangtahun 2OO2sampai
tahun 2@5 di tGbupaten Banyuasindapat dilihat pada tabel di bagian
lampiran.

PREDIKSI

Dengan potensi sumber daya alam yang besar khususnyasektor


pertambangandan penggatian,maka tantangan yang dihadapi oleh
pemerintahdalam kurun waktu 20 tahun mendatangadalah bagaimana
mengoptimalkanpemanfaatansumber daya yang ada mengingatsektor
dan penggalianyang berupaminyakbumi, tanah urug, tanah
pertambangan
liat, pasir dan korat merupakansumber daya alam yang tidak dapat
diperbaharui dengankatalain lamakelamaansumberdayaalamtersebutakan
lain yang harusdicari
semakinmenipis.Setaindari faktor diatas,tantangan'
jalan keluarnyaterletakpada upaya peningkatanproduksidan menjamin
kontinyu,
pasokanbahangaliandan barangtambangsecara
keberlanjutan

Hal2 - 29
Rencatnfunfungwun Janglre
PatfrVDnnhffiffirli

2.2.2. DEMOGRAFI

KEPENDUDU

kualitaspendudukmerupakanlangkahyangsangatpenting
Peningkatan
dalam mencapaipembangunan yang berkelanjtandan berkesinambungan.
lGrakteristikpembangunanantara lain dilaksanakanmelalui pengendalian
pertumbuhanpenduduk dan pengembangankualitas penduduk melalui
Dalamkaitannyadenganhal itu,
perwujudankeluargakecilyang berkualitas.
merupakanhal penting
kependudukan
maka aspekpenataanadministrasi
pembangunan.
perencanaan
dalammendukung
penduduk merupakan sasaranutama pembangunan
Kesejahteraan
BesarHaluan Negara
yang telah tertuangdalam Garis-garis
sebagaimana
(CBHN). Pembangunantersebut dilaksanakandalam rangka pembangunan
manusiaseutuhnya.Untuk itu pemerintahtelah melaksanakanberbagaiupaya
dalam rangka memecahkan masalah kependudukan. Dengan tingkat
penyebaran penduduk yang berbeda di tiap wilayah, maka untuk itu
pemerintah berupaya melakukan pemerataan penduduk melalui Program
transmigrasi,sedangkanupaya pemerintahdalam melaksanakanpengendalian
laju pertumbuhan penduduk dengan mencanangkan program Keluarga
Berencana(KB). Peranan KeluargaBerencanasangat besar artinya dalam
mengendalikanlaju pertumbuhan penduduk. Keberhasilanprogram Keluarga
Berencana sangat tergantung pada tingkat kesadaran dan peran serta
masyarpkatuntuk menjadi akseptor KB. Pengendalianlaju pertumbuhan
penduduk merupakanunsuryang sangatpenting dalam usahameningkatkan
pembangunanperekonomian.Program KeluargaBerencanadapat berhasil
karena ditopang oleh kemajuan sektor pendidikan, peningkatan mobilitas

H a l2 - 3 0
Ratatp fuifuWnnwt,tatg*a
Pat&t gtucnhfrOd4drg

wanita dalam angkatankerjadan lain-lain.Namun


pendudukbertambahnya
demikian masalah internalisasimotivasi dalam melaksanakanProgram
tampaknyamasihbelumoptimal.
KeluargaBerencana
Jumlahpendudukdi KabupatenBanyuasindari tahun ke tahun terus
meningkat.Dilihatdari jumlah penduduknya,lGbupatenBanyuasin
termasuk
kabupaten/kotadenganpendudukterbanyakkeempatdi ProvinsiSumatera
Selatan setelah Kota Palembang,lGbupaten Ogan Komering Ulu dan
lGbupatenOgan Komeringllir. Menurutestimasipendudukakhir tahun 2OO2
jumlah penduduklkbupaten Banyuasinmencapai685.841jiwa, denganrata-
rata kepadatanpenduduk66,18jiwa/Km2.Padatahun 2OO3,menuruthasil
PendaftaranPemitihdan PendataanPenduduk(P4B),jumlah penduduk
meningkat menjadi sebanyak590.422 jiwa dengan rata-rata kepadatan
penduduk66,82 jiwalKm2dan sebaranpendudukterbesarnyaberadadi
16,96 o/o,sedangkan
KecamatanTalangKelapadenganpersentase jumlah
penduduknya palingsedikit beradadi KecamatanRambutan.
Padatahun 2OO4,jumlahpendudukdi KabupatenBanyuasinmeningkat
menjadi 712.813jiwa dengan rata-ratakepadatanpenduduk 69,00 jiwalKm2.
Dan pada tahun 2006 pendudukdi lGbupaten Banyuasinberjumlah 757.397
jiwa, jumlah ini meningkatdari tahun 2OO5yang berjumlah 734.787 jiwa.
Angka pertumbuhanpendudukmerupakanangkarata-ratayang menunjukkan
tingkat pertumbuhan penduduk per tahun dalam iangka waktu tertentu.
dari pendudukdasar.Bbrdasarkan
Angkaini dinyatakansebagaipersentase hal
tersebutmenunjukkanbahwa laju pertumbuhanpenduduktahun 2A06 adalah
sebesar1,69 o/o,sedangkantahun 2OO5mengalamipertumbuhanpenduduk
1,7Oo/o.Untuk lebihjelasdapatdilihatpda tanellampiran.
sebesar
Jika dilihat dari komposisipenduduk KabupatenBanyuasinmenurut
jenis kelaminnya,dapat dilihat bahwa penduduk laki-laki lebih banyak jika
dibandingkandengan penduduk berjenis kelamin perempuan. Sesuaidata

H a l2 - 3 1
Rcetam funfunguunJaeV*a
PadangMrm06.m4,

statistiksampaitahun 20f,lfl diketahuibahwa penduduklaki-laktberjumlah


3BO.Z14 pendudukperempuanhanyaberjumlah377.186iiwa
jiwa, sedangkan
dengansex ratio sebesarlOO,57o/otang artinya penduduklaki-lakilebih
banyak O,S7 o/o dibandingkanpenduduk perempuan.Untuk mengetahui
jumlah pendudukberdasarkanjenis kelamindan sex ratio perkecamatan
dari

tahun 2OOZsampai 2006 juga jumlah akseptor KB aktif di Kabupaten


dapatdilihatpadatabellampiran-
Banyuasin

PREDIKSI

Laju pertumbuhanpendudukyang tinggi di KabupatenBanyuasindari


tahun. ke tahun dapat menjadi faktor yang mempengaruhitingkat
pertumbuhanekonomi.Akan tetapi,jika peningkatanjumlah pendudukjuga
diiringi dengansemakinmemperbesar jumlah tenagakerja dan berdampak
padapeningkatan Pasar,makasebaliknya
jumtahproduksidan perluasan hal
yang akan terjadi justru dapat mendorong perkembanganekonomi dan
pendapatanperkapitamasyarakat-
meningkatkan
Dalam 20 tahun ke depan, pemerintahdihadapkanpada laju
pertumbuhanpendudukyangterusmeningkat.Tingginyaangkakelahirandan
faktor urbanisasimembuat laju pertumbuhanpenduduk semakintidak
terkendali. Untuk itu, peranan program Keluarga Berencanasangat
dibutuhkan.Tantanganke depan bagi pemerintahadalah bagaimana
mengatasi laju pertumbuhan penduduk yang tinggi dengan tetap
masyarakat-
kan kesejahteraan
memperhati

Hal2 - 32
RqwmPeafungnwtrtarrfis
Pat&ngOaetdrZWUF

Dalam rangka Pengembangan Pembangunan yang brekelanjutan,


daya
merupakan hal penting untuk lebih meningkatkan kualitas sumber
pelaksana
manutia, bukan saja sebagai oobjek melainkan sebagai pelaku
pembangunan.Oleh karena itu, pengendaliankualitas dan kuantitas sumber
daya manusiamerupakan langkah penting agar terwujud nya keseimbangan
antara kuantitas dan kualitas sumber daya manusia itu sendiri. Peningkatan
kualitas sumber daya manusiatidak terlepas dari peningkatan mutu, sarana
dan prasarana pendidikan, kesehatan penduduk dan usaha-usaha
pmberdayaan masyarakat.Usaha yang dimakud adalah memperluas dan
membantu masyarakaf dalam memperoleh berbagai akses yang dapat
menunjangdan'memotivasidiri untuk lebih maju, antaralain yaitu aksesuntuk
mendapatkaninformasi, pelatihan peningkatan kualitas diri bahkan akses
jalur
terhadapmodal. Semuaini diperlukanagar masyarakatdapat keluardari
kemiskinan.
Tenaga kerja merupakan salah satu modal pergerakan roda
pembangunan.Jumlahdan komposisitenagakerjaakan selaluberubahseiring
dengan berlangsungnyaprosesdemografi. Dengan bertambahnya penduduk
dalam suatu wilayah, maka akan bertambah pula jumlah angkatan kerja'
sehinggahal ini mengakibatkankebutuhanakan lapanganpekerjaansemakin
meningkat pula. Ketenagakerjaanmeniadi sangat penting tatkala kita
membahasmasalahpendapatandan distribusinyapada masyarakat,karena
sumber dari pendapatan adalah hasil dari aktivitas penduduk dalam
melakukanusahadi suatulapanganpekerjaan.Pendudukdipandangdari sisi
ketenagakerjaanmerupakan suplai bagi pasar tenaga kerja, namun tidak
semua penduduk mamPu melakukannya, karena penduduk yang telah
memasukiusia kerjalahyang dapat menawarkantenaganyadi pasarkerja.

H a l2 - 3 3
Rcncana Pemhngunan Jang*a
PanJang Da era h 2 Ur&2O2 5 2
Bab
Pendudukusia kerja dibagi menjadi2 golongan,yaitu yanS termasuk
angkatan kerja dan yang termasuk bukan angkatan kerja. Kabupaten
Banyuasinyang merupakanwilayahagraris,makasektorpertanianmerupakan
sektoryang paling banyak menyeraptenagakerja yang dijadikanmasyarakat
sebagaimata pencaharianutama oleh sebagianbesarpenduduknya.Berikut
tabel sektor lapangankerja yanS menjadi mata pencahariandi Kabupaten
Banyuasin.

Tabel2.2
SektorLapanganKerjaYangMenjadi Mata Pencaharian
di KabuPatenBanYuasin

No LapanganUnha Utama Persentase'


l. Pertanian 68,27
2. Pertambangan 2,OO

3. lndustriPengolahan 9,37
4. Listrik,Gasdan Air Bersih o,23
5. Bangunan 3,09
6. Perdagangan 10,40
7. Angkutan 3,17
8. Jasa-jasa 3,48
9. Lainnya 0,00

Total loo,oo
s@"n TransmigrasiKabupaten Banyuasin2oo5

Hal2 - 34
Rdrcanafu n M ngnnan Jatg*a
Padanglra*ahM'Mg

Kerja dan TransmiSrasi


Menurui data yang tercatat oleh DinasTenaga
penduduk Kabupaten
Kabupaten Banyuasin tahun 2OO5' dari iumlah
503'378 orang' sedangkan
Banyuasinyang termasukangkatankerja sebanyak
t1.598 orang- SelaniutnyaPengangguranlebih
iumlah pengangguransebanyak
jenis kelamin laki-laki'
banyak yang berjenis kelamin PeremPuandaripada
sebanyak4'670 orang'
yaitu perempuan sebanyak 6.298 orang dan lakiJaki
keria masihdidominasioleh
Komposisipendudukusia kerja dimana angkatan
bekerja' yaitu sekitar
penduduk yang bekerja daripada yang tidavbelum
yang bekerja
g6,250/oberbanding 3,75o/o. Namun demikian persentase
dibandingkan pekerja
penduduk laki-laki (g7,ggw masih lebih tinggi
lebih
perempuan (94,610/o). Tetapi sebaliknyapenduduk bukan angkatankeria
jika dibandingkan dengan
besar penduduk perempuan yaitu sekitar 84,41o/o
Sementarapenduduk laki-
laki-faki yang hanya berkisarsekitar 2A'55o/osaja'
merupakan penduduk yang
laki yang bukan angkatan keria sebagiabesar
dan sekitar37,78o/o yang melakukankegiatan
masihbersekolahyaitu 55'39o/o
laki-laki msih merupakan
lainnya. Hal ini meng8ambarkanbahwa penduduk
Upah Minimum
tulang punggung dalam mencari nafkah. Perkembangan
tahun 2OO3 sebesarRp'
Regional (uMR) mengalami peningkatan dimana
Rp' 503'7oo
Rp.4o3.50o,tahun2oO5sebesar
tahun2oo4sebesar
331.5oo,
Jadi jika dirata-ratakan
dan tahun 2O06 meningkat menjadi Rp. 604'000'
tahun 2A06 meningkat
Upah Minimum Regional dari tahun 2OO2 sampai
Minimum Regionaldan
sekitar 3}o/o.Untuk melihat perkembanganUpah
2006 dapat dilihat pada
upah Minimum Sektoraldari tahun 2OO2sampai
lampirantabel-
Konsepkemiskinanmerupakanisukontroversia|karenadapatbermakna
relatif' merupakan
ganda, yaitu relatif dan absolut. Konsep kemiskinan
itu sendiri merupakan
pendekatanyang sangat bersifat sosial' Kemiskinan
kebutuhan manusia' Sebagai
suatu produk dari persepsi sosial terhadap

Hal2 - 35
Retwm futnbtgtnnn .EW'ca
PadaryOacnhXxb-frz6

miskin atau tidaknya


contoh, adanya persepsimasyarakatpedesaanbahwa
kepemilikantanah peryanian'
seseorangtergantungantara lain dari besarnya
menyekolahkananak
kondisi rumah, pemilikan hewan ternak, kemampuan
indikator tersebut
dan jenis makananyanS dikonsumsi.Menurut mereka,iika
terkadang batasan
semakinbaik, maka mereka akan semakinkaya meskipun
itu, konsep kemiskinan
atau standarnya seringkaritidak terukur. sementara
yang diperlukan untuk membeli
absolut didasarkan atas perkiraan income
kalori bagi setiap
makananyang cukup untuk memenuhi rata-rata kebutuhan
Biayayangdikeluarkan
orang dewasa dan anak-anakdalam suatu keluarga'
cost of subsistance'
untuk membeli makanan ini dianggap sebagai basic
menetapkanstandar
Kemiskinandalam konteksini dapat ditentukandengan
diukur dalam bentuk
tertentu sepertigariskemiskinan(poverty line) baikyang
gizi'' dan sebagainya'
uang maupun dalam bentuk lain seperti beras,
cenderung bersifat
Pertumbuhan ekonomi dan pemerataan pembangunan
negara berkembang'
trade off, Namun demikian dalam banyak kasus di
pertumbuhan
ketidakmerataan pembangunan ternyata berkaitan dengan
berbagai cara akan
ekonomi yang rendah. Pertumbuhan ekonomi dengan
dari prioritas yang
mempengaruhi pemerataan pembangunan tergantung
pendapatan'
ditujukan pada kemiskinan atau ketimpangan distribusi
kemiskinan
Pertumbuhanekonomi yang tinggi cenderung akan mengurangi
tentu diikuti oleh
absolut. Akan tetapi pertumbuhan ekonomi belum
penurunan kemiskinan, maksudnya ialah bahwa ketidakmerataan
mengiringipertumbuhanekonomi'
pembangunanakansenantiasa
belum cukup
Banyaknya penduduk yanS telah bekerja ternyata
tangga miskin'
memberikan korelasi positif terhadap PenSuranganrumah
60.457 rumahtangga
Jumlahrumahtanggamiskinpadatahun 2oo5 sebanyak
Tunai)' Hasil ini
data rumah tanggapenerimaBantuanLangsung
(berdasarkan
penambahanrumah tangga
tentunya tidak menimbulkansikap pesimis,karena

H a l2 - 3 6
RetrcanafumhngwnnJangh
PanhngDonh2Wn2S

saia' tapi hampir'teriadi di


miskin tidak hanya teriadi di KabupatenBanyuasin
oleh kebiiakan ekonomi
seluruh wilayah lndonesia yang diakibatkan
Tunai yang tidak
pemerintah pusat dan kritera penerima Bantuan Langsung
lGbupaten
jelas. Berdasarkan hasil pendataan BKKB dan catatan Sipil
miskin turun meniadi
Banyuasin,pada tahun 2006 iumlah rumah tangga
2oo5'
54.198rumah tanggaatau turun l4o/odibandingkantahun
sejahtera (lihat
Berdasarkandata jumlah keluarga seiahtera dan Pra
Kabupaten Banyuasin
tabel pada bagian lampiran), keluarga pra sejahteradi
(2lo/o),
pada tahun zoo3 terbesar berada di Kecamatan Muara Padang
(ilo/o).sedangkan
KecamatanpurauRimau (r4o/o)danKecamatanBanyuasinilr
Kecamatan
persentasekeluargasejahteraterbesardi tahun 2OO3dimiliki oleh
(l3o/o)'Tahun 2oo7
BanyuasinI (l5olo),Banyuasinlt (14%) dan Muara Telang
Bolo' namun
masih memiliki rumah tangga ketuarga pra sejahterasebanyak
jumlah rumah tangga
relatif turun dari tahun 2003. Tingkat pertumbuhan
Banyuasincukup
keluargapra sejahteradan keluargaseiahteradi Kabupaten
oleh Kecamatan
bervariasi. Pertumbuhan keluarga pra sejahtera dialami
kecamatanyang
Banyuasinl, Banyuasinll dan KecamatanBetung. Tiga
dialami oleh
memiliki tingkat pertumbuhan keluarSapra sejahteramenurun
yang mengalami
KecamatanRambutandan Muara Padangdan kecamatan
Kecamatan
peningkatankeluargasejahteraadalah KecamatanBanyuasinI dan
sejahteranya cukup
Betung,sedangkankecamatanyang pertumbuhankeluarga
umum di lbbupaten
signifikanadalah KecamatanMuara Padang. Secara
sejahtera
Banyuasinselarnatahu 2O03 - 2OO7terjadi penurunankeluargaPra
dan disisitain teriadi peningkatanpertumbuhankeluargasejahtera'
sekaligus
Pemerintahdalam mengatasilaju pertambahanpenduduk
dan untuk
mengatasi jumlah penSanSSurandi Kabupaten Banyuasin
di Kabupaten
mengetahui jumlah dan lokasi penernpatan transmigrasi
padatabel lampiran'
Banyuasindari tahun 2oo2 sampai2006 dapat di lihat

Hal2 - 37
- -'- Penbtgrnan Janglg-
"Renana
Firl"rv oaaannoenzS

PREDIKSI

dihadapkanpada penyiapan
Dalam 2o tahun mendatangpemerintah
akibattingginyalaju pertambahan
dan perluasanlapanganpekerjaansebagai
keriayangmembutuhkan
pendudukyangiuga diiringioleh besarnyaangkatan
kondisisenyatanya yangterjadisebagaiimbasdari krisis
pekerjaan.Sedangkan
sebagaiakibat berkurangnya
ekonomi banyak tenaga kerja yang dilepas
sehinggahal itu dapat mendorong
kapasitaspioduksi dalam masyarakat
tingginyatingkatpensanssuran.UpahMinimumRegional(UMR)yang
tahunnya cenderung mengalami
ditetapkan pemerintah dan setiap
yang
masyarakatnya
be|umdapat memenuhikebutuhanhidup
peningkatan,
juga semakinmeningkat'
kedepan
Pengangguran sangatidentik dengankemiskinan'2O tahun
lapangan
pemerintah dituntut untuk bagaimanamembuka/menyediakan
bagi masyarakatdengantidak hanyaterfokus
pekeriaanyang seluas-luasnya
mencobauntuk
padapenyeraPan tenagakeriadi sektorpertaniansaja'tetapi
menghidupkansektor-sektor|ainsepertisektorindustridanperdaganSany
yang pentingdalammeningkatkan
dimasamendatangiuga merupakansektor
pertumbuhanekonomi daerah'
karenakemiskinan
lsu kemiskinansangat penting untuk diperhatikan
sumberdaya alam' tetapi juga
tidak saja menSancam kelangkaan
sosial'Tingkat penganggurandan
mempengaruhidinamika Politik dan kohesi
mendorong tingkat kriminalitas
kemiskinanyanS tinggi dapat berpeluangdan
pula' Oflfr karena itu' usaha
dan keiahatan menjadi semakin tinggi
dengan melakukanpengamatan
mengurangikemiskinandan penganSSuran
dapat dilakukandengan berbagai
dan pengukurangejalatersebutsenantiasa
dan diimplementasikan
program untuk menguranginyayanS harusdirancang
sedernikianruPa.

H a l2 - 3 8
Rercam PenfutgP*nn rta,,gka
PanhWOrenhNffi2E

2.2.3. EKONOMIDANKEUANGAN

oleh beberapa
Pertumbuhanekonomi suatu daerah dapat dipengaruhi
dapat menimbulkan
faktor yang dapat memberikan manfaat atau sebaliknya
ekonomi Kabupaten
kendala.Faktor-faktoryang mempengaruhipertumbuhan
alam' penduduk'
Banyuasin antara lain adalah potensi kekayaan
sistem sosial dan
ketenagakeriaan,barang modal dan tingkat teknolgi serta
perekonomian suatu daerah
sikap masyarakat.Secaraumum perkembangan
seluruhmasyarakat
dalarn suatuwaktu tertentu tergantungpada pengeluaran
adalah untuk
pada waktu tersebut. Fungsidari pengusaha(pemilik modat)
masyarakat'Oleh
menyediakanproduk barang dan jasa yang diperlukan
pengeluaran
karena itu, tingkat produksi sangat ditentukan oleh tingkat
pengusaha akan
masyarakat. Apabila permintaan bertambah, maka
penurunan' maka
produkinya dan sebaliknyajika permintaan mengalami
produksinyaiuga akan dikurangi.Reaksipara pengusahadalam menghadapi
perubahan permintaan akan menentukantingkat Produk Domestik Regional
permintaan
Bruto (PDRB)dan pertumbuhannyadari waktu ke waktu. Apabila
PDRB
tinggi, maka produksi bertambah yang kemudian akan mempertinggi
dan tingkat kesempatankerja, sehinggaperekonomiandapat menciptakan
tingkat kesempatankerja penuh (full employmenfl'
Sifatdan karakteristikpengeluaranmasyarakatdapat dibedakandalam
beberapa kelompok antara lain : pengeluaranrumah tangga, penanaman
modal oleh perusahaan(investor), pengeluaranpemerintah' ekspor dan
impor. untuk pegeluaranrumah tangga (konsumsi)dan impor bergantung
pada tingkat pendapatan dan bukan merupakan faktor penting dalam

H a l2 - 3 9
Rercana Pembtgwnan Jattglea-
PanJengOaeah 2M-m25

yaitu Penanaman modal'


perubahan PDRB. Sedangkan faktor lainnya
tidak ditentukan oleh tingkat
pengeluaran pemerintah dan tingkat ekspor
oleh tingkat bunga dan
pendapatan.Penanamanmodal terutama ditentukan
oleh pertimbangan
juga iktim investasi,pengeluaranPemerintahditentukan
full employmentyang diikuti oleh
politik dan usahauntuk mencapaitingkat
oleh keadaanPermintaanluar negeri
kestabilanharga dan ekspor ditentukan
perubahan ketiga jeni pengelurantersebut
serta faktor daya saing produk.
lebih besar dalam PDRB' Hal ini
akan menyebabkan perubahan yanS
kombinasiketiganyaakan menciptakan
disebabkanperubahandaram satuatau
serangkaiantambahan pendapatan
suatu proJes yang akan menimbulkan
multiplier effect' Dengan
pengeluaran baru atau lebih dikenai dengan
Banyuasin dlaam rangka melakukan
demikian pemerintah lGbupaten
melalui upaya mempercepat
percepatan pembangunan ekonominya
dapat menciptakanmultiplier
pertumbuhanekonomi secaramakro harusiuga
effect berupa peningkatankesejahteraanmasyarakat'
yang' diindikasikan oleh besaran
lQpasitas perekonomian daerah
perekonomiandalam Kabupaten
produksibarangdan jasa dari seluruhsektor
menunjukkan perkembanganyang
Banyuasinselama empat tahun terakhir
Banyuasin'PDRB yang
positif. Jika pada tahun awal berdirinya Kabupaten
harga berlaku adalah sebesar
dihitung dengan faktor migas berdasarkan
Rp.4.o90tri|yun,makapadatahun2oo4meningkatsebesar160/omenjadi
berdasarkanharga berlaku'Dengan
Rp.4.744 trilyun dihitung dengan migas
periode tahun 2OO5PDRBkembali
memakaiperhitunganyang sama,maka
sebesar Rp' 5'869 trilyun atau
menunjukkan peningkatan akumulatif
meningkatsebesar23,7Oo/o. Demikianjuga dengan periode tahun 20o6 dan
meningkat cukup tajam
tahun 2OO7, PDRB lGbupaten Banyuasin
yaitu masing-masingRp' 7 'O29
dibandingkan dengan tahun sebelumnya'
8'456 trilyun padatahun berikutnya'
trilyun padatahun 2@6dan sebesarRp.

Hal2 - 4Q
RetrcatnPenfungwnn Jat gka
PatStgDaenh nt62025

Peningkatan recara terus menerus sebagaimanatersebut di atai,


mengindikasikanbahwa produksi barang dan jasa dalam perekonomian
Kabupaten Banyuasin terus meningkat seiring dengan bergeraknya roda
perekonomiandaerahdari tahun ke tahun.
Merujuk pada haiil pengukuran statistik tahun 2OOTyang dilakukan
oleh BadanPusatStatistikKabupatenBanyuasin,maka kondisi makro ekonomi
di Kabupaten Banyuasinmenunjukkan perkembanganyang cukup baik dan
sekaligus menjadi modal dasar bagi kelanjutan pembangunan daerah.,
khususnyapembangunandi sektor ekonomi. Dari hasil pengukuran statisti
tahun 2@7 diketahui bahwa perekonomian masyarakat tumbuh dengan
angka yang menggembirakanyaitu sebesar6,56ok jika dihitung tanpa migas
dan sebesar6,530/operhitungandengan migas.Angka pertumbuhanekonomi
Kabupaten Banyuasin pada dasarnya tidak jauh berbeda dengan tingkat
pertumbuhan ekonomi Provinsi Sumatera Selatan pada tahun yang sama.
Pertumbuhan tersebut memberikan gambaran bahwa perekonomian
masyarakatBanyuasinterus bergerak maju. Dengan kata lain bahwa dalam
kehidupan masyarakattelah mengalami peningkatan produksi baik barang
maupunjasayang cukuptinggi.
Pertumbuhan ekonomi masing-masingtahun, telah diikuti pula
peningkatannominal pendapatanrata-rataper kapita maryarakat.Padatahun
2OO7pendapatanrata-rataper kapita penduduk yang dihitung dengan faktor
migas terjadi peningkatan yang cukup berarti, yaitu menjadi sebesarRp.
8.861.874atau sebesarUSD 958,04 dengan memakai kurs Rp. 9.250 per
dollar Amerika. dibandingkan dengan pencapaian tahun 2AO5 sebesar
Rp. 7.573.143atau USD 818,72 dengankurs yamg sama.Angka-angkayang
tersebutdiatassebagaiindikator ekonomi makro pada
diketahuisebagaimana
lingkup perekonomianmasyarakatKabupatenBan'yuasin,
telah meyakinkan
bahwa usaha-usahauntuk memperbaiki kualitas dan kuantitas faktor-faktor

Hal2 - 41
*'ffi;:r*:':t7;l;y;f,
Bab2i
produksi atau infrastruktur perekonomian rakyat seperti jalan, jembatan'
perkebunanrakyatdan lahanpertanianpada
lahan-lahan
irigasi,ekstensifikasi
yang
umumnyaperlu terusditingkatkandan dikembangkanlagi di masa-masa
akandatang.

Tabel2.3
LajuPertumbuhanEkonomiMenurut Sektor
di KabuPatenBanYuasin

No Sektor 2@3 2004 2@5 2@6 2007


1 Pertanian 4,15 3.98 4,36 5,45 5,71
2 Pertambangan 0,81 30.89 4,34 10,72 8,81
3 IndustriPengolahan 4.50 3,42 2,27 2,43 2,75
4 Listrik.Gas,dan Air Bersih 7 , 1 2 16,21 5,33 7,56 12,11
5 Bangunan 9,43 7,18 9,65 12,40 l5,ll
6 Perdagangan 4,24 5,22 5.63 5,63 6,O2
7 Angkutan 4,95 9,63 8,82 8,99 12,93
8 Bank, LKKB dan Jasa 11,47 4,92 4,58 4.77 4,31
Perusahaan
9 Jasa-iasa 5,48 4.82 6,22 8,54 8,86
PDRBdenganMigas 4,29 7,70 4,58 6,28 6,53
PDRBTanpaMigas 5,27 4,84 5,16 6,12 6,56
Sumber : Badan PusatStatistik' PDRBKabupaten Banyuasin

Selainmenghitungkinerjaperekonomian,PDRBdapat digunakanjuga
untuk mengestimasi laju inflasi.Angka yang diperoleh akan berbedadengan
data inflasiyang dihitungh dari Indeks Harga Konsumen(lHK) karenadata
yang digunakanadalahdata hargaprodusen.Estimasilaju inflasiyang dihitung
dengan PDRB Banyuasindisajikan pada tabel tingkat inflasi dengan
memasukkanmigas sebesar12,90 persen tahun 2OO7.Jika dihitung inflasi
tanpa memasukkanmigas,inflasisebesar8,75 persen.

Hal2 - 42
Bab 2:
**;#r::{HY;Xfri;Y;f,
'sgsts:ffiriFitd:'

Tabel 2.4
LajuInflasiSektoraldi KabupatenBanyuasin

No Sektor 2@3 2W 2@5 2006 2@7

I Pertanian 4,57 6,45 7,89 13.21 9,18


2 Pertambangan 11,14 29,94 40,49 7,55 12,33
3 IndustriPengolahan 6,33 5,61 28.57 1 8 , 3 6 17,51
4 Listrik,Gas,dan Air Bersih 21,o9 6,35 6.75 3,32 5,27
5 Bangunan 4.25 9,27 I,ll 7,40 8,25
6 Perdagangan 1,42 l,ll 14,00 1 0 . 3 3 9,48
7 Angkutan 10,02 10,68 6,72 14,46 1o,62
8 Bank, LKKB dan Jasa 6,70 6,77 5,62 8,82 7,O7
Perusahaan
9 Jasa-iasa 13,54 21,35 8,79 14,71 14,95
PDRBdenganMigas 5,96 7,71 18,29 72,70 72,90
PDRBTanpaMigas 4,77 5,86 8,55 11,75 8,75
Sumber : Badan Putat Statistik, PDRB Kabupaten Eanyuasin

SedangkanPertumbuhanpendapatanperkapita masyarakatBanyuasin
menunjukkanangka yang meningkatpada periode 2OO3-2OO7. Pendapatan

perkapitapenduduk Banyuasintahun 2OO7atas dasar harga berlaku sebesar


Rp. 8.861874 (dengan migas) pendapatan perkapita tanpa migas sebesar
Rp. 6.579.163.

Tabel 2.5
PendapatanPerkapitaMasyarakatBanyuasin
Tahun 2OO3- 2OO7

Rupiah
Tahun TanpaMigas
DenganMigas
2003 4.833.607 4.2s5.256
2004 5.431.132 4.574.315
2005 6.525.772 s
5.O76.97
2006 7.573.143 5.833.644
2007 4
8.861.87 6.579.163
Sumber : Badan PusatStatirtik, PDRB Kabupaten Banyuasin

Hal2 - 43
Benam PenfutgunnJa@<a
. PanlaW0unh4fire4t|S

PREDIK'I

Perkembangan ekonomi meskipun telah menuniukkan berbagai

kemajuan, namun masih jauh dari harapan dan cita-cita untuk mer,vujudkan
perekonomian yang tangguh yang dapat mensejahterakansemua lapisan
yang akan
masyarakat Banyuasin. Oleh karena itu, tantangan terbesar
secara
dihadapi adalah bagaimana meningkatkan pertumbuhan ekonorni
dari
berkelanjutan dan berkesinambungandemi mengejar ketertinggalan
lainnya.
daeirrah
pertumbuhan
Disampingitu, tantangan ke depan dalam meningkatkan
20 tahun ke depan
ekonomi di tGbupaten Banyuasindalam kurun waktu
peluang untuk
terletak pada bagaimana pemerintah dapat menciptakan
peran serta besar dalam
berkembangnya sektor-sektor yang memPunyai
',ntuk mendorong sektor-sektorlain terutama sektor
memberikan pengaruh
jasa' Selainitu' perlu
unggulandan sektoryang berkaitandengan pelayanan
juga ditumbuhkan iklim investasiYang kondusif guna menjawab tantangan
yang lebih baik'
yang akan terjadi yang dapat memicu pgrtumbuhanekonomi
di dalam
Kemajuan perekonomian perlu didukung oleh kemampuan
mengembangkan potensi masyarakat untuk mewujdkan kemandirian'
mengembangkan
tantangan utamanya ialah bagaimana Pemerintah dapat
peningkatan produktivitas'
aktivitas perekonomian yanS didukung dengan
ekonomi
sumberdaya manusiayanS berkualitas,penSembangankelembagaan
serta
yang efektifdan efisiensehinggadapat menerapkanpraktekyang terbaik
pula'
diimbangidenganprinsiptata kelolapemerintahanyang baik

Hal2 - 44
:: -#4i,
.<L

Rercem Pembtgunn.ret g*e


PaqPngOaenhZX\HO2S

W
SEKTORPERINDUSTRIANDAN PERDACANGAN

pembangunan industri berupaya untuk meningkatkan nilai tambah,


jasa
memperluaslapangan dan kesempatankerja, menyediakanbarang dan
yang berkualitasdengan harga bersaingdi pasar dalam negeri maupun luar
negeri, meningkatkanekspor, menunjang pembangunandaerah dan sektor-
sektor pembangunan lainnya serta sekaligusmengembangkankemampuan
teknologi. Penyajian statistik industri pada dasarnya dikelompokkan dalam
dua kategori, yaitu industri besardan sedangserta industri kecil dan rumah
tangga. Besarnya nilai produk/nilai tambah sektor industri di Kabupaten
Banyuasinsangatdipengaruhioleh industri minyaVgasbumi, sehinggauntuk
mendapatkangarnbaranyang jelas mengenaisektor industri, maka statistik
industri dibedakanmenjadi sektor migasdan non migas.Pengumpulandata
statistik industri besar dan sedang diperoleh melalui survey tahunan yang
mencakup seluruh perusahaanindustri, sedangkandata industri kecil dan
rumahtanggadiperolehmelaluisurveykhusus-
padatahun 2}O6jumlah perusahaan di Kabupaten
industribesar/sedang
Dibandingkandenganiumlah perusahaan
Banyuasinsebanyak57 perusahaan.
tahun ZOO5yaitu sebanyak 50 perusahaan,jumlah perusahaanindustri
besarAedang pada tahun 2006 tersebut menigkat sebesar l4o/o. Jenis
kelompok industriutama di KabupatenBanyuasinselainmigasadalahindustri
yang terbuat dari kayu (selainfurnitur), industri
kayu dan dan barang-barang
makanandan minuman,industribaranggalian non logam serta karet dan
yang terbuat dari karet. Jumlah perusahaanterbagi dua yaitu
barang-barang
perusahaanyang memperkerjakan5 sampai 15 orang dan perusahaanuang
memperkerjakanditas 2O Orang.untuk mengetahuidata tersebutdapat dilihat
pada lampiran tabel.

Hal2 - 45
Rencam Penhnguan Jangka
PanhryOaenh2Un'2025

Sementaraitu di sektor Perdagangan, wilayah KabuPatenBanyuasin

memilikibanyakpusatproduki yangtersebardi beberapatempat.Pusat'pusat


produki tersebut menghasilkankomoditi berupa produk pertanian dan
perkebunansepertiberas,tanamanpalawija,kelapasawit, karet dan aneka
komoditilainnya.Disamping itu, iugaterdapatprodukbahangaliaMambang
industri.Potensitersebutmenuniangkegiatanperdagangan
dan barang-barang
di KabupatenBanyuasin. Kegiatanperdagangantersebutditakukanmelalui

transaki antaraprodusendan konsumenbaik di pasar'pertokoanmaupun


melaluitransakiindividual-

PREDIKSI

Di sektorperindustriandan perdagangan'tantanganyang akan dihadapi


pemerintah adalah bagaimanameningkatkan neraca pertumbuhan ekonomi
yang meliputi sektor industri dan perdaganganyang ada di lGbupaten
Banyuasin. Maksudnya ialah bagaimana uPaya pemerintah untuk
meningkatkanlaju lalu tintasperdaganganyang ada di dalam negerimaupun
di luar negeri, baik yang berasaldari industri besaratau industri kecil/rumah
tangga agar memiliki nilai jual yang tinggi. Sementaraitu, sektor impor
diupayakanuntuk ditekan demi memaiukansektor industri dan perdaganSan
Banyuasin'
di Krabupaten
lokal khususnya

Hal2 - 46
RencamWtgPmn.bryke
Pat&agOaenh2(n&4Y?5

Sektor Koperasi dan Usaha Kecit Menengah (UKM) memiliki potensi


yang besar dalam meningkatkan taraf hidup rakyat banyak' Hal ini
ditunjukkan oleh keberadaankoperasi dan uKM yang telah mencerminkan
wujud nyata kehidupan sosial dan ekonomi sebagiandari rakyat Indonesia
di lGbupatenBanyuasin.
khususnya
Jumlah Koperasidi KabupatenBanyuasintahun 2OO5mencapail8l unit
terdiri dari 19 KUD dan lO2 Non KUD. Apabila dilihat dari kegiatanKUD
terdapat 7 kegiatan simpan pinjam, 49 kegiatan distribusi, 16 kegiatan
pemasara n, 27 kegiataniasa-jasadan I kgiatan produki. Sedangkankegiatn
non KUD terdapat 49 kegiatan simpan pinjam,-23 kegiatan distribusi' 3
n, 25 kegiatanjasa-jasadan 2 kegiatanproduksi'
kegiatanpemasara

PREDIKSI

Koperasidan UsahaKecil Menengah (UKM) menempati posisistrategis


untuk mempercepatperubahan struktural dalam rangka meningkatkantaraf
hidup rakyat banyak. Sebagaiwadah kegiatan usahabersamabagi produsen
maupun konsumen,koperasidiharapkanberperandalam meningkatkanposisi
tawar dan efisiensiekonomi rakyat, sekaligusturut memperbaiki kondisi
persaingan usaha di pasar melalui dampak eksternalitaspositif yang
ditimbulkannya.Sementaraitu UsahaKecilMenengah(UKM) berperandalam
memperluas penyediaan lapangan kerja. memberikan kontribusi yang
signifikanterhadap pertumbuhan ekonomi dan rnemeratakanpeningkatan
pendapatan.Bersamaan dengan hal itu adalah meningkatnyadaya saingdan
daya tahanekonomi nasional.

Hal2 - 47
Renana Panfutgnnen Jary*a
PaqhngOaanh 2WeN25

(UKM)
Semakinluasnyaakes kbperasidan UsahaKecil Menengah
yang
terhadap sumhr daya produktif dengan sumber daya manusia
di masa
berkualitasiuga meniadi tantanganyang seriusbagi pemerintah
mendatang.Kelembagaan dan brganisasikoperasidi lGbupatenBanyuasin
juga memerlukanpembenahanUalamhal kualitasnya.Agar sektorini dapat
terus berkelanjutan,maka iklim'irsahakoperasidan UsahaKecilMenengah
(UKM) perludikondisikanmeni"diteUit kondusif'

H a l2 - 4 8
Rercam knbryrrnnJang*a
ParfungOaerehnOezOzS

BUDAYADAN POLITIK
2.2.4. SOSIAL

PENINGKATAN KESEHATANMASYARAKAT

peningkatankesehatantidak hanyadipandangsebagaisuatukebutuhan,
kualitas
akan tetapi merupakansuatu bentuk investasidalam meningkatkan
utama selain
rumber daya manusia.Sektorkesehatanjuga merupakanfaktor
masyarakat'
dari pendidikanyang bertuiuan meningkatkankualitaskehidupan
pemenuhan kebutuhan kesehatanmerupakan hak masyarakatdan meniadi
yang terjadi
ketrrajibanbagi pemerintah untuk memnuhinya. Perkembangan
bisnis'
saat ini adalah kecenderunSanlembaga kesehatanmenjadi sarana
sehinggasemakin memperlebariurang bagi masyarakatdalam memperoleh
kesempatan untuk mendapatkan pelayanan kesehatan antara masyarakat
akses
menengah ke bawah dan masyarakatkalangan atas. Sementaraitu'
masyarakat miskin terhadap pelayanan kesehatan menjadi terbatas
dikarenakanadanya motif profrt oriented yang dikembangkandan diterapkan
peran
pada lembaga-lembagakesehatan.Oleh karena itu, sangatdiperlukan
agar
serta pemerintah dalam melakukan pemerataan pelayanan kesehatan
dapat dirasakanoleh semualapisanmasyarakat'
Meskipun tergolong kabupaten baru, namun perkembangan

pembangunan bidang kesehatandi Kabupaten Banyuasinperlahan-lahan


kesehatan
menunjukkan kemajuan yang positif. Saat ini, berbagai fasilitas
sudahtersedia,diantaranyasejumlahpuskesmasyanStersebardi l5 kecamatan
cukup hanya
di KabupatenBanyuasinsudahmemilikifasilitasrawat inap. Tak
Pembantu
itu, diberbagai pelosok desa saat ini sudah tersedia Puskesmas
(Pustu) dan Polindes yanS lengkap dengan tenaga kesehatannya'telah
Asuransi
dibangunnyajamban keluarga,puskesmasterapung, meluncurkan

Hal2 - 49
Renclnnfuafuryumn,rarglca
PatfugOacnhM'n25

Kesehatan (fukeskin) bagi masyarakat yang kurang mamPu' menerapkan


dokter keluargadan memberdayakanRumahSakitKundur.
Untuk meningkatkankesehatanmasyarakat,diperlukan koordinasiyang
seimbang antara pemerintah dan masyarakatitu sendiri. Salah satu upaya
untuk morrrujudkanmaqyarakatsehat adalah dengan pengadaansaranadan
praiarana pelayanan kesehatandan tenaga medis yang memadai' sehingga
menjangkau seluruh lapisan masyarakat. Tenaga medis di Kabupaten
Banyuasinterdiri dari Dokter Umum, Dokter Gigi, Bidan' Perawat,Sanitarian
jumlah Dokter Umum
dan KesehatanMasyarakatLainnya. Pada tahun 2A06
di tgbupaten Banyuasinsebanyak44 orang,iumlah ini bertambahdari tahun
sebelumnyayang hanya berjumlah sebanyak39 orang, Dokter 6igi sebanyak
13 orang, 2lo orang, Perawat 65 orang dimana iumlahnya menurun dari
tahun sebelumnyayang berjumlah 145 orang, SanitariansebanyaklB orang
yang jumlahnyajuga menurundari tahun 2OO5yaitu sebanyak3l orang dan
Tenaga kesehatanmasyarakatlainnya yang berjumlah 42 orang. sedangkan
jumlah saranakesehatandi KabupatenBanyuasinhinggatahun 2006 terdiri
dari puskesmassebanyak26 unit, PKM Pembantusebanyakll7 unit' Rumah
berjumlah178 unit- Sementara
Bersalinsebanyak3 unit dan Poliktinik/Polindes
jenis penyakit yang umum teriadi masyarakatyaitu Pnemonia yang pada
jumlahnya meningkat
tahun 2006 penderitanyasebanyak3.862orang dimana
dari tahun sebetumnyayang hanya sebanyak1.471oran8, lalu penyakitDiare
sebanyak33.181orang, kemudian penyakitTBC yang berjumlah666 orang
jumlah
dan penyakit matariayang penderitamencapai7.146 orang' dimana
ini meningkat dari tahun 2OO5yang penderitanya hanya sebanyak 2-343
orang. untuk data selengkapnya mengenai iumlah tarana kesehatan,ienis
penyakit dan jumlah tenaga medis di Kabupaten Banyuasindapat dilihat pada
tabet di bagian lamPiran-

H a l2 - 5 0
Rerwna funfungPnnn Jarylee
Padary Oaeahm'2025

pembangunandi bidang kesehatandapat ditihat dari Angka Kematian

Bayi dan lbu Melahirkan sertameningkatnyaUsia Harapan Hidup Masyarakat.


perbaikkan derajat kesehatan memberikan korelasi positif terhadap Usia

Harapan Hidup. Angka Kematian Bayi pada tahun 2OO3sebesar48ll-OOO


kelahiran hidup, kemudian pada tahun 2OO4 menjadi 4O||.OOOkelahiran
hidup, lalu pada tahun 2OO5jumlahnya kembali menurun menurun menjadi
2g/l,OOOkelahiran hidup dan tahun 2OO6Angka Kematian Bayi 39/IOOO;
turun menjadi 5/I.OOOditahun 2Co7.Angka kematianibu melahirkansebagai
dampak dari pelaksanaanberbagai program bidang kesehatan,maka angka
kematian ibu melahirkan juga menunjukkan kecendrunganmenurun- Pada
tahun 2003 jumlah nya mencapai4O7/IOO.O0O kelahiranhidup, tahun 2OO4

menjadi 293ll0O.OOOkelahiran -hidup, tahun 2OO5 menjadi 284IIOO.OOO


'hidup, menurun menjadi
kefahiran tahun 2006 sebesar 198/IOO.OOO
137/IOO.OOO tahun 2OO7. Perbaikanderajat kesehatanmemberikan korelasi
positif terhadapUsia Harapan Hidup. Padatahun 2OO3Usia HarapanHidup
masyarakatKabupaten Banyuasinadalah 63 tahun, lalu tahun 2OO4 naik
menjacli 64 tahun, kemudian tahun 2OO5 meningkat lagi menjadi 66
tahun,tahun2O06 66,1tahun dan meningkattahun 2OO7sebesar67,3 tahun-

PREDIK'I

pemerintah Kabupaten Banyuasindalam 20 tahun ke depan untuk

sektor kesehatan ini dihadapkan pada bagaimana meningkatkan angka


harapan hidup, penangananibu hamil dan balita serta pencegahandan
pengobatanterhadappenyakityang sedangberkembangdi masyarakat.Selain
daripada itu, peningkatansaranadan prasaranatidak luput dari perhatian
seperti fasilitaskesehatandan tenaga medis sertaakes pelayanankesehatan-
Untuk itu diperlukan pemerataan, keterjangkauandan akses pelayanan

H a l2 - 5 1
Rencamknfutgunn,rat gra
Patfitg O*ah 2qb1r25

kesehatanmampu meniangkausemua lapisanmasyarakatdisertal dengan


standarpelayananyang baik. upaya ini membutuhkanpeningkatananggaran
terutamapuskesmas
untuk penyediaanfasilitaskesehatan
di sektorkesehatan
dan tenagamedis.

SEKTORPENDIDIIGN

Salah satu faktor pendukung keberhasilanpembangunandi suatu


pemerintahan adalah sumber daya manusia yang berkualitas' Melalui
pendidikan, pemerintah berupaya untuk menghasilkandan meningkatkan
sumber daya manusia agar mempunyai kompetensiyang tinggi. Pentingnya
pendidikan dewasa ini merupakan salah satu refleksitingkat kemjuan hidup
dan kesejahteraansuatu bangsa. Dengan pendidikan diharapkan dapat
meningkatkankualitassumberdaya manusia.Seiakbeberapadekadeyang lalu
pemerintah telah memusatkan perhatiannya untuk pengembangansektor
pendidikanguna meningkatkankualitassumberdaya manusia.Pendidikanitu
sendiri bertujuan untuk mencerdaskankehidupan bangsasebagaimanayang
tercantum dalam pembukaan UUD 1945 dan merupakan hak setiap warga
negaratanpa membedakandaerah, suku,agama,jenis kelamin maupun status
sosial.Oleh sebabitu pemerintahselaluberusahauntuk meningkatkanakses
terhadap pendidikan khususnya pendidikan dasar pada seluruh lapisan
masyarakat.
Pendidikan merupakan pilar yang terpenting dalam mewuiudkan
pertumbuhan pembangunanekonomi, karena secaralangsungpendidikan
mempengaruhi kualitas dan produktivitas tenaga kerja. Pembangunandi
pemerataan
sektor pendidikan tidak hanya diarahkan pada perluasandan
kesempatan untuk memperoleh pendidikan, tetapi juga diarahkan pada

Hal2 - 52
Rencamknhtgwnnlang*a
Padary OrenhZW-2025

peningkatan kualitas pendidikan itu sendiri terta relwansinya terhadap


kebutuhanakan pasarkerja dengan tetap mempertahankannilai-nilai budaya,
kesetaraangender dan keadilan sosial. Dalam orientasi pembangunanyang
mengarahpada peningkatanproduksi, peran sumber daya manusiabiasanya
lebih dianggapsebagaiinstrumenatau salahsatu faktor produksi saja.Dengan
menitikberatkan pada nilai produki dan produktivitas telah mereduksi
manusia sebagai alat untuk memaksimumkankepuasan dan keuntungan
semata.Sebagaikonsekuensinya,peningkatansumber daya manusiaterbatas
pada masalah pendidikan, peningkatan keterampilan, kesehatan dan
sebagainya.Dengan demikian, kualitassumberdaya manusiayang meningkat
merupakanpraryarat utama dalam prosesproduksi demi memenuhituntutan
Untuk mewujudkan
masyarakatindustrialyang lebih cenderungindividualistis.
hal tersebut tentu saja memerlukanfasilitaspendidikan yang berupa gedung
sekolah, tenaga guru dan fasilitaspendidikan lainnya, karena proset belajar
yang diharapkanapabila
mengajartidak akan dapat berjalan sebagaimana
fasilitaspendidikantersebuttidak dapat dipenuhi.
perkembanganpendidikan suatu wilayah dapat ditunjukkan dengan
o/opada tahun 2OO3 menjadi 95'9
meningkatnyaangkamelek huruf dari 93,8
pada tahun 2006. Penurunanangkaputussekolahdisetiapienjangpendidikan'
pada tahun 2006 angkaputussekolahjenjangpendidikan5D menurunsebesar
loo/o, jenjang pendidikan SLTP menurun sebesar l7,8a/o dan jenjang
pendidikanSLTAmenurunsebesar6,60/odibandingkantahun 2OO5-Selainitu,
pengadaansekolahsangatdiperlukankhususnyadaerahdi pelosokpedesaan,
karena untuk menjangkausekolah terdekat sanSatsulit dan memerlukan
waktu yang relatif lama. Jumlah SekolahDasar (5D) Negeri di Kabupaten
Banyuasinsebanyak5.455 sekolah.Sedangkaniumlah SekolahMenengah
pertama(5MP) Negeri sebanyak36 Sekolah.JumlahSMPNegeri lebih sedikit

dibandingkan lMP Swasta sebanyak38 sekolah. Dari jumlah penduduk

H a l2 - 5 3
Rencana Pemfungunan Jangka
PanJangDaenh 2Ut&2O25 2
Bab
lGbupaten Banyuasinyang cenderunglebih besar pada kelompok umur
lO - 14 tahun, maka untuk pendidikandidominasipada tingkat pendidikan
dasar (sD/Ml sederajat). Untuk melihat jumlah penduduk lGbupaten
Bnayuasinmenuruttingkatpendidikandapatdilihatpadatabelberikut:

Tabel2.6.
JumlaPendudukMenurutTingkatPendidikan
Tahun2OOT
di KabupatenBanYuasin

JenisKelamin Jumlah
No TingkatPendidikan Laki-laki Perempuan
I Tidak ada iiazah 78.300 r04.806 183.r06
2 5D / Ml Sederajat 126.716 122.639 249.355
3 SLTP/ MTs 55.823 50.504 106.327
4 SMU/ sMA 49.507 35.826 85.333
5 5M Kejuruan 8.272 6.470 14.742
6 D i p lo mal / l l 385 385
7 Diplomalll 353 869 1.222
8 Sarjana/ Sl 1.283 773 2.056
Jumlah 320.639 321.887 &2.526
Sumfur: RPSKabupatenBanYuasin

Sekolah(APS)terdapatpenurunanpada berbagai
PadaAngkaPartisipasi
jenjangpendidikan,baik pada kelompokumur usiaSD, sMP, mauPunSMA,
hal ini dapat dipahami karena mereka memasukiusia produktif, dituntut
unuk lebih banyak dalam kegiatanekonomi keluarga.Selain
partisipasinya
pemahamanbahwa makintinggijenjangpendidikanmakasemakintinggi pula
biayayang dikeluarkan,akibatnyapendudukhanyamampu memasukijenjang
pendidikansesuaidengankemampuanekonomi keluarganya.
jumlah murid dan guru juga hampir
Tingkatpertumbuhanberdasarkan
tidak berbeda dengan tingkat pertumbuhan jumlah sekolah. Tingkat
pertumbuhan jumlah murid dan Suru sMU lebih tinggi dari tingkat
pertumbuhanmurid dan guru 5D mauPunSMP. Namun hal yang menarik

Hal2 - 54
Renam PenfuArnan,lawke
Par&tUDaenhmffi25

bahwa perkembangan jumlah murid sD Negeri dan Swasta mengalami


penurunan. Terjadi penurunan murid 5D berkaitan dengan terjadinya
penurunan tingkat pertumbuhan iumlah penduduk Kabupaten Banyuasin.
Tahun ZOA3pertumbuhanjumlah penduduk sebesar3,24o/odan tahun 2OO6
menurun menjadi 3,21o/obahkan di tahun 2@7 menurun lagi menjadi 2,80o/o
dibandingkan tahun 2006. Tingkat perturnbuhan jumlah guru sD Swasta
mengalami penurunan sebesar hampir l5o/o seiring dengan teriadinya
penurunan tingkat pertumbuhan. Sekolah Swastadan murid 5D Swastadi
Kabupaten Banyuasin. Secara umum semakin tinggi jenjang pendidikan
jumlah
semakintinggi tingkat pertumbuhanjumlah sekolah,jumlah murid dan
8Uru.
Tingkat perkembanganpositif juga mengalamioleh pendidikan sekolah
Tingkatperkembangan
agamadi KabupatenBanyuasin. jumlah sekolah'murid

dan guru dari tahun 2OO3 sampai 2006 serta persentasepertumbuhannya


untuk berbagaijenjang pendidikansepertisekolahlbtidaiyahjuga Tsanawiyah
dan Aliyah (dapat ditihat pada lampiran tabell. Fenomenayang hampir sama
dengan sekolahnon agama semakintinggi jenjang pendidikan semakintinggi
tingkat pertumbuhanjumlah sekolah,murid dan guru juga dialami sekolah
agama. lJntuk melihat data iumlah sekolah, gedung, ruang kelas, guru dan
murid sekolah di Kabupaten Banyuasin dapat melihat tabel pada bagian
lampiran.
Sebagaigambaran, pencapaianangka mutu rata-rata kelulusansiswa
diukur denganmemakaihasilUjian Nasional(UN), maka pencapaianangka
mutu kelulusanpada tahun 2OO5untuk siswa SD. SMP dan 5MA masing-
masingadalah5,96 untuk 5D, 4,77 untuk SMPdan 5,02 untuk SMA. Angka
mutu rata-rata kelulusansiswa tersebut meningkat di bandingkandengan
5,17
pencapaianangka mutu rata-ratapada tahun 2OO4,yaitu masing-masing
pencapaianangka
untuk sD,4,43 untuk SMPdan 4,57 untuk sMA. Sedangkan

H a l2 - 5 5
Rencana Pemfungwnan Jang*a
Panjarg Daenh 2fir&m25 2
Bab
mutu rata-ratatahun 2OO3yaitu 5,38 untuk SD, 4,36 untuk SMP dan 4,4O
untuk sMA. Selanjutnyauntuk partisipasipendidikananak usia sekolahjuga
menjadi indikator penting guna mengetahuiapakah pelayananpendidikan
yang telah dilakukan pemerintah telah dilaksanakandengan baik dan
Kasar(APK)semua
menyeluruh.Oleh karenaitu pengukuranAngka Partisipasi
tingkat pendidikanakan dilakukansetiaptahun, dimana posisipencapaiannya
pada tahun 2OO5 masing-masinguntuk SD sebesar11,37o/o,SMP sebesar
dan untuk SMA sebesar36,230/o.PerbaikanAPK pendidikantelah
66,100/o
memperolehbanyakkemajuanjika dibandingkandengantahun 2OO4dimana
untuk 5D sebesar10,55, sMP 39,71olodan sMA 26,740/o.Sedangkanpada
tahun 2OO3 untuk SD sebesarl1,2Oo/o,SMP 36,400/o,dan sMA sebesar
pendidikandi KabupatenBanyuasin.
Berikuttabel perkembangan
17,630/o.

Tabel2.7
Pendidikandi KabupatenBanyuasin
Perkembangan

TahunKegiatan
No Jenls
2003 2004l 2005
t. Angka PartisipasilGsar (o/o)
-5D l'.|,20 10,55 11,37
- SMP 36,40 39,71 66,10
. sMA/sMK '17,63 26,74 36,23
2. Rata-RataKelulusanSinpa
-sD 5,38 5,''|7 5,96
- sMP 4,36 4,43 4,77
- SMA/sMK 4,40 4,57 5,O2
Sumber: Dinas Pendidikan Kabupaten Banyuasin

Hal2 - 56
Rercam PenfutgamnJaryka
Padar DaenhM'z(ng

PREDIKSI

Agar dapat menghasilkanmasyarakattermasuktenaga kerja yang


makatantanganke depanyangakandihadapipemerintahadalah
berkualitas,
bagaimanamemperbaikimutu pendidikan,kualitasdan kualifikasitenaga
proseJbelajarmengajaryangbaik,meningkatkan
pendidik,menyelenggarakan
sarana dan prasaranapenunjang,kurikulum yang tepat dan berbasis
tenagapendidikitu sendiri.Bagipemerintah,
kompetensisertakesejahteraan
kinerjadi sektorpendidikanterutamadi ukur dari indikatorangkapartisipasi
sekotahdan angkamelekhuruf. Untukitu menjaditantanganke depandalam
kesempatan
meningkatkandan memperbaikiindikator tersebut.Pemerataan
dalammemperoleh terhadappelayanan
pendidikandan akses juga
pendidikan
perlumenjadiperhatianyangserius.

SEKTORPARIWISATADAN KEBUDAYAAN

Sektor pariwisata,seni dan budaya merupakan bidan pembangunan


yang memiliki potensiyang begitu besaruntuk dikembangkan.Kualitassumber
daya tarik wisata di Kabupaten Banyuasin cukup beragam, baik
keunikan/kelangkaan, keragaman daya tarik mauPun jangkauan

bagi wisatawan.Misalnyasumberdaya wisata.CalonTaman


pemanfaatannya
Nasional (CTN) Sembilang yang dengan luas sekitar 253.OO0 hektar
mempunyaikeunikandaya tarik yang jarangditemukandi tempat lain yaitu
merupakansalahsatudari dua situsramsarlahanbasahyang ada di lndonesia.
Keistimewaan kawasan Sembilang terutama karena keberadaan Hutan
Mangrove paling tebal di dunia (sekitar35 km) yang merupakanhabitat
berbagaijenis tanaman dan hetrranlangka, sebagaitempat berkumpulnya

Hal2 - 57
Rarcam furnfugwan Jerrgtw
PatSng Daerahzffigns

Hawk
kelompok burung migran ienis rtorkserta jenis burung langka Wallace
pantai yang sangat
Eagte. Kawasan hutan bakau yang sangat tebal' pesisir
yang unik
panjang serta keberadaanpermukiman nelayan di perairan Pantai
dan
dengan pusatnya yang berada di Desa Sungsangcukup menunjang
Potensieco-
menambahkeragamandaya tarik wisata di kawasanSembilang.
ini cuckup
tourism yang sangat unik serta daya tarik yang sangat beragam
layak untuk dimanfaatkan dan dipasarkan bagi masyarakat internasional.
kawasan
Seperti banyak dijumpai di tempat lain, sumber daya wisata
perkebunan di Kabupaten Banyuasincukup mempunyai daya tarik untuk
terbatas
dikunjungi. Namun demikian, ragam daya tarik di area perkebunan
pada panorama/nuansahijau perkebunan dan kegiatan pengolahan hasil
yanSada di
perkebunanyang ada di lokasi.Padasaatini kawasanperkebunan
KabupatenBanyuasinterutama Melania dan.Sembawasudah dimanfaatkan
masyarakatdisekitarnyasebagaitempat berwisata'
Kualitasdan kuantitas(ragam) unsur penunjang pada masing-masing
potensi objek wisata meliputi saranadan prasaranatransportasidan fasilitas
penunjangwisata yang lain. Dalam skala kabupaten,saranadan prasarana
penunjang pariwisata di Kota PangkalanBalai sebagaiibukota kabupaten'
kegiatan
masih sangat terbatas dan belum bisa menunjang pengembangan
pariwisatadi daerahini. Sumberdaya wisatayang ada di wilayah Kabupaten
jalan raya' sehingga
Banyuasinpada umumnyasudahdijangkauoleh prasarana
yang beradadi
mudah dicapaidengantransportasidarat' kecualiobjek wisata
wilayah pantai timur sepertiCTN Sembilang,Air Sugihandan Permukiman
NelayanSungsang hanya dapat dicapaimelaluitransportasiair/sungai'karena
adanyasarana
tidak ada jalan raya yang menuju ke lokasiini. Dengantidak
ini disebabkan
dan prasaranapenunjangyang dibangundi kawasanSembilang
yang sangatluas
karenakondisidaya dukung tanah yang rendahdan wilayah
yang sangat
ini termasukdalam kategori kawasanlindung dengan penduduk

H a l2 - 5 8
Retwm PenfuWrnwt.ht gkt
Pa$ang hanh2ffi'm25

jarang. Seperti pada umumnya perkebunan besar di daerah lain' kawasan


perkebunanMelania maupun Sembawasudahtersediaprasaranadasarseperti
listrik,telekomunikasidan drainasesertafasilitaslainnya. Saranayang ada di
lokasi ini diantaranya tempat pertemuan, guest house dan sitting place
Keberadaansaranadan prasaranatersebut sangat menunjang kemungkinan
pengembangannyasebagaisuatuobjek wisata agro. Disisilain' beberaPaarea
perkebunansawit yang relatif baru dibuka sertabeberapasumberdaya wisata
kehutanan(hutan wisata) pada saat ini belum dilengkapi dengan saranadan
prasaranapenunjangyang dimanfaatkanuntuk kegiatanwisata.
Sementaraini pemanfaatanobjek dan daya tarik wisata di Kabupaten
Banyuasinmasihterbatasuntuk masyarakatsetempatdan lokasiyang sering
dikunjungi untuk kegiatanrekreasiterutama di kawasanperkebunanMelania
dan Sembawa.SuakaMargasatwadi pantai timur, terutama CTN Sembilang
pada saatini sudahdimanfaatkanmeskipunhanyauntuk kalanganyang sangat
terbatasterutama untuk kegiatanpenelitian.Demikianjuga untuk beberapa
objek wisata budayasepertiMakam Demang LebarDaun sertalokasijatuhnya
pesawat Silk Air, pemanfaatannyamasih sangatterbatas. Upaya pemasaran
objek danrdaya tarik wisata di wilayah KabupatenBanyuasinyang sudah
dilakukan sampaisaatini masih berupa penerbitan leaflet/brosuroleh instansi
pemerintahsetempat,sedangkanupaya pemasaranbagi kunjunganwisatawan
melalui biro perjalanan masih belum dilakukan. Khusus untuk kawasan
Sembitang, penetapannya sebagai Calon Taman Nasional sangat

menguntungkankarena secaratidak langsungikut memasarkankawasanini


sebagaisuatuobjek wisata.
Kondisifisik lingkungandi sebagianbesarobjek dan daya tarik r,visata
yang ada di KabupatenBanyuasin,terutama sumber daya agro wisata dan
hutan wisata pada umumnya masihmerupakanlahan yang belum terbangun.
potensi lahan di sekitar objek masih cukupu luat, sehinggamasih sangat

H a l2 - 5 9
RenamWngfrf,nn,tatgkE
Pat&ryAaenhm'2oi6

memungkinkanuntuk pengembangantarana dan prasarana.Disisilain' khusus


yaitu
untuk sumber daya ekowisata yang berlokasidi wilayah pantai timur'
CTN Sembilangdan Habitat Gajah di Air Sugihan,kondisi lingkunganperlu
menjadi isu utama. Berdasarkanarahan RencanaTata RuangWilayah (RTRUU)
provinsi maupun Kabupaten, lokasi sumber daya wisata tersebut berada di

kawasan yang dikategorikan sebagai Kawasan Lindung (Kawasan Non


Budidaya). Hal ini berarti bahwa pengembanganlahan untuk penyediaan
saranadan prasaranasumberdaya wisata ini perlu dilakukan Jecaraterbatas.
Kondisi lingkungandi sekitar sumber daya wisata minat khususpermukiman
nelayan di pantai/muara, baik yang berada di Desa Sungsangmaupun di
tempat-tempatlain, mempunyaikarakteristikyang khususkarenapermukiman
ini berada di atas perairan pasang surut. Kondisi lingkunganditandai oleh
bangunanrumah penduduk yang dengan kepadatancukup tinggi' Dengan
area dan lingkungan yang mempunyai banyak keterbatasanini diperlukan
pemikiran yang matang dalam pengembangan sarana dan Prasarana
penunjang wisata. Nilai kualitas Obiek dan Daya Tarik Wsata (ODIW)
lGbupaten Banyuasindapat dilihat pada bagian lampiran.
Aksesibititaswilayah lGbupaten Banyuatin dituniang oleh keberadaan
sebagaiialur
ialan raya lintas timur (Bandar Lampung-Palembang-Jambi)
transportaji utama wilayah ini. Pola prasaranatransportasi tersebut sangat
berpotensi dalam peningkatan aksesibilitassumber daya objek wisata'
terutamayang dilewati jalur jalan raya utama, diantaranyabeberapasumber
daya agrowisataperkebunanserta sumber daya hutan wisata- Disisi lain
perairan
sumberdaya objek wisatayang terletakdi wilayah dataranrawa dan
pantai timur, sepertiSembilang,Air Sugihan,PermukimanNelayan Sungsang
yang rendahdimana satu-satunya
memepunyaitingkat aksesibilitas cara untuk

mencapaisumber daya obiek wisata tersebut hanya bisa dilakukan melalui


sungai dan perairan laut. Lokasi beberapa objek wisata di Kabupaten

H a l2 - 6 O
Rancam Penfungwnn Jarylea
Paflang Daenh ZXr6-2A25

Banyuasinmempunyai kedekatanjarak maupun kesamaanarah pencapaian


dengan lokasi objek wisata lainnya, sehinggabeberapaobjek wisata tersebut
bisa dikembangkanatau dihimpun dalam kawasan pengembanganwisatA,
yaitu :
Pantai Panjang- PermukimanNelayan Sungsang-
D CTN Sembilang-Pesisir
Hutan HabitatGajahAir Sugihan.
Sembawa.
>> PerkebunanPTPNVll Melania-Perkebunan
Satuhal yang perlu diperhatikanadalah lokasiobjek wisata di wilayah
pantai timur, mempunyai kedekatankarakter maupun jarak objek dan daya
tarik wisata yang ada di wilayah provinsi lain seperti Provinsi Jambi dan
Provinsi Bangka Belitung. Hal ini berpotensi menunjang keterpaduan
CTN Sembilangdan sumberdaya wisata lain di pantai timur
pengembangan
dengan objek wisata di wilayah Provinsi Jambi maupun provinsi Bangka
Belitung. PangkalanBalai sebagaiibukota lGbupaten Banyuasinmempunyai
jarak yang relatif dekat dengan Palembangsebagaiibukota provinsi. Dalam
hal ini, sumberdaya agrowisataperkebunanMelania dan Sembawacukup
diuntungkankarena beradadiantara kedua kota tersebutdenganjarak yang
relatif dekat. Disisi lain beberapa sumber daya wisata yang berlokasi di
wilayah pantaitimur tidak mempunyaiakseslangsungdenganPangkalanBalai
dan dari sisi aksesibilitasjustru lebih mudah berhubungan dengan Kota
Patembang dengan menggunakan sarana transportasi air, meskipun
membutuhkanwaktu sekitar7-B jam denganspeedboat melaluiSungaiMusi
lain. Kota-kota lain yang relatif dekat jaraknya dengan
dan sungai-sungai
sumberdayawisatadi pantaitimur adalahKota Mentok dan Jambidi wilayah
provinsitetangga.ApabilarencanapembangunanPelabuhanSamudraTanjung
Api-api telah dilaksanakan,diharapkanobjek wisata di wilayah ini semakin
berkembangkarenasaranatransportasiakan semakinlancar.Berikutbeberapa
potensipariwisatadi tGbupatenBanyuasin.

H a l2 - 6 1
*'";::;:!3x";tfrl;y;tr
Bab 2
l'abel 2.8
di KabupatenBanyuasin
PotensiPariwisata

No PotensiWisata ObjekWsaty'LokasiMsata
I WisataBahari Pantaikawasanpesisir
SunsaiBanyuasin
Sungai Upang
PerkampunganNelayanSungsang
- Tugu SilkAir di dekatSunssans
2. Ekowisata - HutanWisataSembilang
- Hutan LindungLebungHitam
3. Agrowisata PerkebunanKaretaPTPNVll
- PerkebunanSawitPT. SawitMas Sejahtera
4. KarvaWisata PenelitianKaretSembawa
- PenelitianTernakSembawa
PenelitianTanamanHutan Kemampo
- PensolahanKaretPTPNVllTebenan
5. WisataAlam - PelestarianGajahdi Air Sugihan
6. WisataLainnya - Kolam Pancinqdi air batu
Sumber: lnventasrisasiPotensi Banyuasindan Peluang KeriasamaPembangunan

PREDIKSI

Dengan besarnyapotensi pariwisatadi lGbupaten Banyuasin,maka


tantangan yang akan dihadapi adalah bagaimana pemerintah dapat
menjadikan sektor pariwisata ini sebagai salah satu roda penggerak
pertumbuhanperekekonomiandaerah khususnyadi lGbupaten Banyuasin.
saranadasarpada objek wisata,kegiatanpromosiyang
Untuk itu ketersediaan
efektil ketersediaansumberdaya manusiapada industri pariwisatamenjadi
hal yang utama mengingatsumberdaya manusiamerupakanfaktor penentu
dlaam pengembanganpariwisata.lGrena apabila sumber daya manusiadi
sektorini tidak mendukung,maka akan sulit diharapkansektorini menjadi
motor pertumbuhanekonomi daerah.

Hal2 - 62
*""F:fr!ff!X':[7;l;y#,
Bab2
SEKTORKEAGAMAAN

Untuk mewujudkandan meningkatkankualitaskehidupanberagama


serta untuk memperkokoh persatuandan kesatuan bangsa, kehidupan
beragamajuga perlu diperhatikan.Walaupunterdiri dari berbagaietnis dan
selamaini
budaya,kehidupanantar umat beragamadi KabupatenBanyuasin
berlangsungharmonisdan kondusif.Kondisiini disebabkankarenaadanya
rasatoleransiyang tinggi antar para pemelukagama.Keharmonisan
tersebut
dapat dilihat dari tersedianyatempat-tempatibadah yang ada di sekitar
masyarakat yang majemuk, seperti masjid, 6ereja, Vihara, Kuil dan
Dari segijumlah pendudukmenurutagama,makapendudukyang
sebagainya.
beragamalslam merupakanpendudukmayoritas,sedangkansisanyaadalah
Katolik,Budhadan Hindu.
parapemelukagamaKristenProtestan,
Dalam melaksanakandan meningkatkankegiatan ibadah menurut
agama dan KepercayaanTerhadap Tuhan Yang Maha Esa tentunya
disbutuhkanfasilitassaranatempat peribadatan,sepertiyang terlihat pada
gambarberikut:

o00
s0
&0
700
s0
s0
400
OO
no
o0
0
Muthola

Hal2 - 63
Rencam Pantbtgunn,tarda
Paqlary OonhzlNbmg

di lGbupatenBanyuasin
2-2.JumlahTempatPeribadatan
Crambar
PREDIKSI

Disektorkeagamaan,yang akan dihadapi pemerintahke depan adalah


bagaimana terus menjaga dan memelihara serta meningkatkan kehidupan
beragamadi KabupatenBanyuasinagar tetap harmonisdan lebih kondusif.
Selainitu, perlu diupayakanterdatanya secaralebih lengkap iemua hal yang
terakit dengan potensi, fasilitassaranadan prasaranaserta berbagaimacam
kegiatan keagamaan.Pendidikan agama juga merupakan salah satu bagian
o
penting dalam upaya pembentukanmanusiaseutuhnya.Sedangkankerukunan
hidup antar umat beragamamerupakanbagianlain yang tak kalah pentingnya
untuk menjaminkeutuhanmasyarakatsebagaiinsanTuhanyang majemukdan
suku,budayadan agama.
terdiri dari bermacam-macam

POLITIK HUKUM DAN HAM

sektor politik, hukum dan HAM memiliki perananyang


Pembangunan
sangat penting dalam penyelenggaraanpemerintahan. Adanya kepastian
hukum dan iklik politik yang kondusif akan mendorong pemerintahuntuk
mengoptimalkansegalapotensisumberdaya yang dimiliki demi meningkatkan
kesejahteraanmasyarakatnya.Perkembangandemokrasiselamaini ditandai
dengan terumuskannyaformat hubungan pusat dan daerah yang baru
berdasarkanUndang-undangnomor 32 tahun 2OO4tentang Pemerintahan
Daerah dan Undang-undangnomor 33 tahun 2OO4 tentang Perimbangan
Keuanganantara PemerintahPusatdan PemerintahDaerahyang pada intinya
lebih mendorongkepadakemandiriandaerah untuk mengaturdan mengurus
sendiri urusan pembrintahan serta mengatur mengenai hubungan dan

Hal2 - 64
RencamknfutgupnJary*a
Penlatvaaenh M&r!,

we\rrenangantara PemerintahPusatdan PemerintahDaerah. Perkembangan


demokrasiterlihat pula dengantelah berkembangkesadaranterhadap hak-hak
sah masyarakat dalam kehidupan berpolitik yang dalam jangka panjang
diharapkanmampu menstimulasimasyarakatlebih jauh untuk semakinaktif
berpartisipasidalam mengambil inisiatif bagi pengelolaan urusan-urusan
publik.
Sebagaibentuk implementasidari rumusan Undang-undangtersebut
salah satunya dapat dilihat dari pesatnyapertumbuhan partai politik dan
sistempemilihan Kepala Daerahdan Wakil Kepala Daerah secarademokratis
berdasarkanasaslangsung,umum, bebasrahasia,jujur dan adil. Namun dalam
kenyataan masih banyak ditemukan ketidakpuasan dari berbagai pihak,
sebagaiakibat belum dewasanyakehidupan demokrasipada masyarakat.Hal
tersebutmembutuhkanpembinaankepada masyarakatdan pengamananyang
baik dari Pemerintah Daerah pada saat pelaksanaan sehingga tidak
menimbulkangejolakpolitik dan sosial.

PREDIK'I

Pembangunandi bidang hukum dewasa ini masih terletak pada


bagaimanamengatasimasalahkrusial, seperti belum adanya kesungguhan
untuk menegakkansupremasihukum serta semakinberkurangnyakesadaran
Kondisitersebutmenyebabkantimbulnya
hukum bagi aparatdan rnasyarakat.
tumpang tindih peraturan perundanganyang sederajatantara satu dengan
lainnya,antaraperaturantingkatpusatdan daerahsertaantaraperaturanyang
lebih tinggi denganperaturanyang ada dibawahnya,sepertiPeraturanDaerah
(Perda). Permasalahandari Perda-perdayang dikeluarkan oleh daerah
kabupaten/kota terutama yang berkaitan dengan kejelasanprosedur ssperti
standar,waktu, biaya,birokrasi,tarif dan lainnya.

H a l2 - 6 5
Rercam Perfutgunn .targra
Patfing Oaenh me2025

ffi
Belum berpihaknya penegakan hukum dan kepastian hukum pada
sebagianmasyarakatdalam bentuk rasakeadilan,kesetaraandan perlindungan
terhadap hak asasimanusiakhususnyaterhadap masyarakatkecil dan kurang
rnamapu. Hal itu diakibatkan karena keterbatasan pemahaman dan
pengetahuanmasyarakatdi bidang hukum, sehinggadalam penyelesaiansuatu
perkara masyarakatmasih belum mengerti bagaimanaprosedur yang tepat
untuk mendapatkan keadilan. Demikian pula upaya untuk meningkatkan
kesadaranhukum dan pemahamanterhadap perlindunganHak fuasi Manusia
(HAM) masih belum memberikan dampak yang menggembirakandalam
masyarakat.Merupakan suatu kenyataanbahwa kegiatanpenyuluhan hukum
dan pemahamanterhadap nilai-nilai HAM belum mempengaruhiperilaku
setiap anggota masyarakatdalam kehidupan bermasyarakat,berbangsadan
bernegara. Beragamnya budaya, kondisi sosial, kesenjangankeseiahteraan,
tingkat pengangguran,kemiskinandan kepadatanpenduduk merupakansalah
satu penyebab timbulnya kriminalitasdi masyarakatyang mengakibatkan
terjadinyagangguankeamanandan ketertibanmasyarakat.

Hal2 - 66
Retwm fumhngrnnn .tarrgra
Patfug Oaerahm0&zdrs

SARANADAN PRASARANA
2.2.5. PENINGKATAN

PENYEDIAANPERUMAHANDAN PERMUKIIVIAN

Pertumbuhan penduduk yang semakin meningkat menyebabkan


kebutuhanakan perumahansemakintinggi. Upaya peningkatansektor ini lebih
ditujukan untuk rirenyediakankawasanpermukimandalam bentuk penyediaan
kawasandan lingkungansiap bangun baik di dalam kota maupun di wilayah
pengembangankota. Usaha yang dilakukan untuk sektor perumahan dan
permukiman, diantaranya penyediaan perumahan dan permukiman yang
bertujuan untuk meningkatkankualitas kehidupan rnasyarakat,meningkatkan
kemandirian dan kesetiakawanansosial masyarakat dalam pemenuhan
kebutuhan akan perumahan dan permukiman dengan cara pengembangan
kerjasamapemerintahuntuk penyediaanperumahandan permukimandalam
skalabesar,pengadaanRumahSangatSederhana(R55)dan RumahSederhana
(RS), pemantapan pola pembiayaan khususnya bagi masyarakat yang
rendah.
berpenghasilan
Sedangkanuntuk pembangunanperumahandan permukimandidaerah
pedesaanditujukan demi membantu dan mendorong masyarakatdesa untuk
memperbaiki rumah serta lingkungannyamenjadi lebih sehatdan layak huni
yang memenuhistandarkesehatan.Untuk memenuhikebutuhanmasyarakat
akan perumahandan permukimanyang sehatdan layak huni, khususnyabagi
masyarakatyang berpenghasilanrendah, pembangunan perumahan dan
permukiman lebih diarahkan pada dukungan dan kebijakan dalam upaya
penyediaandan pengembangansumber pembiayaanjangka panjang yang
berkaitan dengan pembangunan perumahan dan kepemilikan rumah,
pembangunanperumahansederhanayangt sehat,pemberdayaankomunitas

Hal2 - 67
Rercana kmbnganan Jatglea
PanJatgOaetahgxn m25

perumahanswadaya,perbaikan
permukimanyang mendorongpembangunan
dan rehabilitasi rumah tidak layak huni, penataan kawasan kumuh,
dan peremajaan
kawasandan daerahtertinggalsertarevitalisasi
pembangunan
kawasantertentu.

PREDI|(sI

Dalam kur:unwaktu 2O tahun mendatangtantangan yang dihadapi


pemerintahdi bidang perumahandan permukimanterkair dengan bagaimana
menyediakan kebutuhan akan rumah bagi masyarakatyang berpenghasilan
rendah. Tantangan lainnya adalah menata dan mengendalikan kawasan
kumuh yang tumbuh dan tidak sesuaidenganstrukturdan infrastrukturkota
serta mengoptimalkan kinerja lembaga penyelenggaraan pembangunan
perurnahan.Penyediaansaranadan prasaranadasaroleh pemerintahterhadap
kawasan rumah sederhana dan rumah sangat sederhana yang dihuni
masyarakatberpendapatanrendah bertujuan untuk menurunkanharga jual
rumah di kawasan tersebut. Diharapkan kedepannya, masyarakat yang
rendah mempunyaikemampuanuntuk memiliki rumah yang
berpenghasilan
layak huni dalam kawasanpermukimanyang sehat.
Sementara itu, kelembagaan penyelenggaraan pembangunan
perumahan belum berada pada tingkat kinerja yang optimal untuk
menjafankanfungsinya.baik sebagaipembangun(provider) maupun sebagai
pemberdaya (enabler). Walaupun peraturan Perundang-undanganyang
berlakumenyatakanbahwa masalahperumahandan permukimanmerupakan
tanggungiawabpemerintah,namun belum mantapnyakapasitaskelembagaan
pembangunanperumahan dan permukiman pada semua
penyelenSgaraan
tingkatanpemerintahanmenyebabkapemenuhankebutuhanakan perumahan
dan permukimanyang terjangkaudan layak huni belum dapat dipenuhi dan
menjadi persoalanyang kritis.

H a l2 - 6 8
Rercam Penfutgtttwt Jang&a
Paflatg Oaanh m6-m:25

suatu
Dalam ruang lingkup saranaair bersih dan tarana lingkungan
permukiman Perlu dilakukan peningkatan dan Percepatan pembangunan'
pencapaian
sehingga diharapkan dapat menjadi pemicu dan Pendorong
yang merupakan
kualitas lingkungan yang tebih baik. Kabupaten Banyuasin
l'8OO mm
daerah beriklim tropis basahdengan variasi curah huian antara
air' Hal
sampaidengan 2.7OAmm merupakandaerahyang kaya akan sumber
Musi'
ini dikarenakandaerah ini dialiri oleh banyak sungaidiantaranyaSungai
SungaiLalansungaiBanyuasindan sungai-sungai kecil lainnya.Jika dilihat dari
yaitu sekitar53o/odan
keadaandaerahini, luasdaerah rawa-rawacukup besar,
pertanian sawah
sebagianbesar pantai timur yang sangat potensial untuk
pasangsurut. Pemanfaatansumberdaya air untuk menunjangpembangunan
yaitu sistem
pertaniandalam arti luasdi kemasdalam bentuksistempengairan'
pengairanirigasi
irigasidi lahan sawahirigasi,lebak dan pasangsurut.Bentuk
baik
yang berupa saluranprimer, sekunderdan tersiersertabahan bangunan
untuk
berupa permanen tembok atau hanya tanah hasil galian. Sedangkan
dengan
daerahlebakdan pasangsurut,salurannyahanyaberupagaliantanah
di
kedalamansesuaidengan kelasatau tingkatan salurannya.Pembangunan
pembuatan
sektor irigasi tidak hanya meliputi pembuatan saluran dan
rangka
banguan pintu air saja, tetapi merupakan uPaya terpadu dalam
sungai serta
melakukan pemeliharaanwilayah resapandan daerah aliran
pengusahaan sumberdayaair'
kualitas,kuantitasdan availabilitas
yang
Daerahaliran sungaidi KabupatenBanyuasinmempunyaifungsi
yang memadaidan
salahsatunyauntuk mengairisawahmelaluijaringanirigasi
jumlah produksi di sektor
merupakanfaktor penting datam meningkatkan
yang
pertanian. Pembangunannyaselama ini telah memberikan kontrbusi
padi. Dalam
nyata pada peningkatan produksi PanSan, kehususnya

Hal2 - 69
Rercam PenbryuPnJa&a
Pat{atg OaeahW*lrl5

penerapannyaternyata sebagiansumberdaya air yang melalui salurantersebut


juga dimanfaatkansebagaimedia pemeliharaanikan. Sedangkanuntuk daerah
pasang surut juga dapat dimanfaatkan untuk keperluan transportasi u!*
yang
Mengingat terdapatnya multifungsidan multiguna dari sistempengairan
perbaikan
ada tersebut, maka revitalisasipembanSunannyadifokuskan pada
yang ada'
dan peningkatanpengelolaansertapendayagunaansumberdaya air
Jaringan irigasi pada kawasan pasang surut, seiak lama meniadi salah satu
prasarana yang sangat penting bagi masyarakat petani di lGbupaten
Banyuasin.Jaringanirigasibaik yang bersifatprimer, sekunderdan tersierserta
pintu-pintu kendatiair berperansebagaipenopangaktivitasmasyarakatsehari-
hari, baik sebagai faktor produksi (padi) mauPun sebagai Prasarana
transportasi(saluranprimer) datam berhubungandari satuwilayah ke wilayah
lainnya.
Sementaraitu di sektor penyediaansaranaair bersih bagi masyarakat
perlujuga dilakukanpeningkatandan percepatanpembanSunan, sebabhal ini

terkait dengan kebutuhan pokok masyarakat.Peran serta pemerintah dalam


meningkatkan kualitas hidup mayarakat umumnya melalui program
penyehatan lingkungan termasuk syarat-syaratkesehatanyaitu pemenuhan
kebutuhanmasyarakatakan air bersih.Untuk memenuhihal tersebut'maka
pemerintah melakukan pengembanSanPDAM. Upaya lain yang dilakukan
adalahdenganmembuatsumurgali percontohanyang lengkapdengan MCK
yang diperuntukkan bagi penduduk dan diharapkan dapat ditiru oleh
penduduk lainnya. Karena kebutuhanair sangat penting, maka diperlukan
intervensipihak lain dalam hal ini pihak swastauntuk membangunsaranadan
prasaranatermasukdalam pengelolaannya. Padatahun 2006 iumlah air yang

didistribusikanmelalui PDAM cabang PangkalanBalai, Betung' Air Batu'


jumlah pelanggan
SungaiPinangdan Marianamencapai1.352.163M3, dengan
sebanyak3.507 rumah tangga.Jumlah ini meningkatdari tahun sebelumnya

Hal2 - 7O
Rerca m hmbtgrnn n Jatg lca
PatSngloaatahWm2S

dimana air yang didistribusikansebanyak l.116.913 M3 untuk melayani


pelanggan sebanyak 3.133 rumah tangga. untuk data selengkapnyadapat
dilihat pada tabel di bagian lampiran.
Namun sekarang,pelayananair bersihdi KabupatenBanyuasindapat
diperoleh setelahpemerintahmembangun7 unti saranaair bersihPDAM Tirta
Betuah yang siap dioperasikan. Sarana air bersih yang dapat menjangkau
sekitar 21.OOOrumah tangga di berbagaiwilayah Banyuasintersebuttersebar
di Kecamatan Betung, Pangkalan Balai, Sembawa, Sukajadi' Rambutan,
Mariana dan Makarti Jaya. Sedangkankecamatan yang belum dibangun
pDAM, masihmenggunakanfasilitasair bersihdengansistemReverseOsmosis
(Ro).

PREDIKSI

Tantanganke depan yang dihadapi adalah bagaimanamenata sistem


drainaseagar tidak menimbulkangenanganair dan untuk mencegahsampah
dan sedimentasitidak menghambatdan mengganggufungsisalurandrainase
adalah hal penting untuk dicari jalan keluarnya.Selainitu upaya revitalisasi
sistem pengairan juga dihadapkan pada masalahseperti adanya kerusakan
pada daerah aliran sungai yang terkait dengan kegiatan ekonomi dan non
ekonomi masyarakatsertaterjadinya banjir di beberapadaerahsebagaiakibat
dari pembangunan yang tidak memprhatikan kelestarian lingkungan.
Disampingitu, persoalanpengairanlainnyayaitu masihkurangnyaoperasidan
pemeliharaanjaringa rawa pasangsurut dan rawa lebak karena terbatasnya
dana dan rendahnya partisipasimasyarakatserta belurn berkembangnya
kelembagaanpengelolaanoperasi dan pemeliharaanjaringan irigasi dan
drainasedi daerahtadah huian.

Hal2 - 71
RelzraraWngrysn,tarrgla
Padang AaenhmremzS

perlu menjadi
Masalah lain terkait dengan penyediaanair bersih
bagi
perhatian pemerintah karena air merupakan kebutuhan pokok
masyarakat.Masih banyaknyamasyarakat yang belum menikmatisaranaair

bersihmerupakan tantanganyangmestidiiawabkedepannya.

Transportasi Darat

pendukung
Transportasidarat memPunyai peran yang penting sebagai
dalam melayani
pembangunandaerah serta memPunyai kontribusi terbesar
perdagangan.dan industri'
mobilitasrnanusiamauPunpendistribusiandi sektor
kesenjangandan
Transportasidarat makin diperlukan untuk meniembatani
wilayah serta untuk
mendorong pemerataanhasil-hasilpembangunanantar
dan mempererat
mempercepat pengembanganwilayah dari keterisolasian
prasaranajalan yang
hubunganantar daerah. Oleh sebab itu, ketersediaan
yang harusdipenuhi'
dapat menjangkauseturuhwilayah merupakantuntutan
yang sangatpenting
Pembangunantranportasidarat merupakanbagian
prasarana ialan
dalam pembangunan nasional mauPun daerah' sehingga
dan strategis'Fungsi
sebagaiprasaranapublik memiliki nilai ekonomi, sosial
sudah
jarinagn ialan sebagaisalah satu komponen prasaranatransportasi
secaraglobal'
saatnyadiletakkanpada posisidalam perencanaantransportasi
sebagaiperekat keutuhan bangsadan negara
terutama di era desentralisasi
politik, ekonomi dan
dalam segalaaspek, baik itu aspek sosial, budaya,
prasaranaperekonomian
kearnanan.Jalan dan iembatan sebagaisalah satu
memisahkandiri
yang sangatpenting di KabupatenBanyuasin,terlebih sejak
memiliki panjang
dari lGbupaten Musi Banyuasinyang pada tahun 2OO3

Hal2 - 72
**iWBab2
aill&tr:''i ) ll

seluruhnyayaitu 562,60 Km, yang terdiri dari jalan aspalsepanjang284,50


Km, jalan perkerasansepanjang58,40 Km dan jalan tanah sepanjang219,70
Km. Sepertiyang terlihat pada tabel berikut :

Tabel2.9
KondisiPrasarana
Jalandi lGbupatenBanyuasin

Prasrnna Tahun2003 Tahun2W Tahun2@5


No
Jalan Panjang Runk PanJang Runk Panfang Rusak
l. Aspal 284,50 2U.50 289.8 236 253,OO 220.20
2. Perkerasan 58.40 58.40 140,6 '115,2 179,10 40,00
3 . Tanah 219.70 219.70 497,6 347,3 548.90 200.40

Jumlah 562,ffi 542,60 927.2 698,5 980,00 m,6


Sumfur: Dinas Pekerjaan Umum Bina Marga lGbupaten Banytasin

Selanjutnyamengenaikondisijembatan sebagaibagian dari prasarana


perhubungandarat dalam lGbupatenBanyuasin
adalahsebagaiberikut:

Tabel2.lO
KondisiJembatan
di lGbupatenBanyuasin

No TlpeJembatan Tahun2003 Tahun2W Tahun2005


I Beton 2.897.5 2.941.5 2.981.O5
2. RangkaBesi/Baja 350.0 350,0 1.263,OO
3. lGyu 2.324,0 2.324,0 l.3u,oo
Jumlah 5.571,5 5.605,5 5.708,5
fumber: Dinas Pekerlaan Umum Bina Marga Kabupaten Banyuasin

Hal2 - 73
Rencam Pemhng,nan Jatglo
PanJangDaenh 2006-m6

PREDIKSI

jumlahkendaraanyangsemakinmeningkatmenyebabkan
Pertumbuhan
permintaan para penggunajalan juga meningkat.Sementaradisisi lain
ketersediaansaranajalan relatif mengalamiperkembanganyang lambat
sehinggaterjadi ketidakeimbanganantara kapasitasialan denganjumlah
tersebutmenimbulkanmasalahkemacetandi
kendaraan.Ketidakseimbangan
beberaparuasjalan. Hal ini berlakupula pada prasaranajembatan.Daya
dukungjembatanjuga tidak mampu mengimbangijumlah kendaraanyang
ada.
di beberaparuasjalan
Masih banyaknyaterdapat kerusakan-kerusakan
yang disebabkanoleh pelanggarankelebihanmuatan di jalan mengakibatkan
tingginya jumlah dan fatalitaskecelakaan.Disampingitu masih terbatasnya
daerahsatudengan lainnya juga menjadi
saranajalan yang menghubungkan
perhatianutama. Untuk memacupertumbuhanekonomi di kawasantertentu,
perlu ditingkatkan sarana dan prasaranakhususnyaprasaranajalan dan
jembatan.Hal inilahyang menjaditantanganpemerintahdi masamendatang.

TransportasiAi r/Sungai

Transportasi airAungai merupakan bagian dari kelanjutan sistem


transportasi darat yang mempunyai tujuan untuk mewujudkan sistem
transportasiyang handal,unggulterpadusertamampu menjangkausampaike
pelosok-pelosokwilayah. Pembangunantransportasiairlsungai,danau dan
penyeberangan
diperlukansebagaisaranauntuk meningkatkankesejahteraan
masyarakat, memberikan aksesibilitasyang lebih baik sehingga dapat
peningkatankebutuhanmobilitasmasyarakatmelaluijaringan
mengakomodasi
transportasiyang menjangkauwilayah-wilayahperairan.

Hal2 - 74
Renann Penhngwpn .raryila
" PartangOaenh 2OO6-2(E5

Di kabupaten Banyuasin sendiri terdapat beberapa jenis angkutan


airlsungaidiantaranyayaitu angkutan penumpangspeedboat kecil dan speed
boat besar,angkutanbarangjukung, tug boat, ketek dan tongkang sertakapal
nefayan/pompong.Pada tahun 2006 jumlah speed boat kecil sebanyak267
unti, speedboat besarberjumlah23 unit, jukung berjumlah 27O unit, tug boat
berjumlah 3 unit, ketek sebanyakl.2OO unit, tongkang sebanyak65 unit dan
yang paling dominan jumlahnya adalah kapal nelayan/pompong yaitu
sebanyak2.887 unit.

PREDIKSI

Mengingat Kabupaten Banyuasin sebagian wilayahnya merupakan


wilayah perairan, maka transportasi airAungai mempunyai peranan yang
sangat penting bagi masyarakat terutama di wilayah perairan dalam
melakukan kegiatannya sehari-hari.Selama ini karena masih kurangnya
keterpaduan pembangunan antar sektor dengan rencana pengembangan
wilayahserta lemahnya koordinasi antara Pemerintah Provinsi dengan
PemerintahKabupatendalam sistem pengembangansarana dan prasarana
transportasiairAungaiini. Dalam 2O tahun kedepanpemerintahdihadapkan
pada bagaimanameningkatkanpembangunansaranatransportasikhususnya
di
wilayah perairan agar dapat ditingkatkan. Hal ini berkaitan dengan program
pemerintahdalam upaya melakukanpemerataanpembangunansampai ke
pelosok-pelosok
wilayahtermasukwitayah perairan.

Hal2-75
Retwm Penfuagupn,tat gke
Pat&ng O&nhZqr&Znli

SARANA KELISTRIKAN

Energi listrik merupakan energi yang telah menjadi kebutuhan pokok


sehari-harimasyarakat.Kebutuhan akan energi listrik terus meningkat dari
tahun ke tahun sesuaidengan pertumbuhan penduduk dan pertumbuhan
ekonomi wilayah. Jaringan transmisi dan distribusi yang menghubungkan
pembangkit tenaga listrik dengan konsumen juga perlu ditingkatkan sesuai
dengan pertumbuhan kebutuhan masyarakatakan listrik. Dalam memenuhi
kebutuhan akan listrik di Kabupaten Banyuasinperlu dilakukan peningkatan
kemampuan kapasitasterpasang pada instalasi pembangkit tenaga listrik
denganpeningkatanjumlah pemakailistrik.
Kelompok pemakai jasa listrik di Kabupaten Banyuasinpada tahun
2006 adalahSosialsebanyak376 pelanggan,RumahTanggasebanyak35.560
pleanggan,bisnissebanyak684 pelanggan,industri 3 pelanggan,Pemerintah
sebanyak116pelanggandan yang lainnyadigunakanuntuk peneranganjalan
yaitu sebanyak 29 unit .lampu jalan. Untuk data selengkapnyamengenai
Jumlah pemakai, KVA tercambung dan jumlah pemakaian energi tistrik di
lGbupaten Banyuasin dari tahun 2OO2 sampai 2006 dapat dilihat pada tabel
dibagian lampiran.

PREDIKSI

Datam memenuhi kebutuhan listrik di Kabupaten Banyuasinke


depannyaperlu dilakukanpeningkatankemampuankapasitasterpasangpada
instalasipembangkittenagalistrik untuk mengimbangijumlah pemakailistrik.
Masih terbatasnyapenyediaantenaga profesionaldi bidang kelistrikandan
yang belum bisa terjangkausaranatenagalistrik
masih banyaknyadesa-desa
merupakanmasatahyang harusdiselesaikan
di masamendatang.Dalamupaya

Hal2 - 76
Rercam Penfu ngwnn,talg*a
Paqhtv Daaah 2W2U25

optimalisasisistempenyediaantenagalistrik, maka Pengusaha tenagalistrik


yang ditetapkandalam
harusterintegrasisecarapenuh. Kebijakan-kebijakan
rnendirikanpembangkittenaga listrik perlu dilakukan diversifikasisumber
dengansumberdayayangtersedia'
energisesuai
jaringanjuga merupakanmasalahyang mengakibatkan
Keterbatasan
listrikyangdihasilkanke daerahlain. Hal ini erat
kesulitandalammenyalurkan
pembangkit
kaitannyadengankapasitas listrikyangmampudisalurkan. Tanpa

adanyajaringan listrik yang sesuai,maka penambahanpembangkittenaga


listriktidakakanadaartinYa.

PENINGIGTAN SARANATELEKOMUNII(ASI

Sektor ini menanganimasalahsaranadan prasaranajasa komunikasi


yang ada di lqbupaten Banyuasin.Untuk lebih menunjang kelangsungan
pertumbuhanekonomi agar lebih efektif dan efisien,sektor ini harus lebih
ditingkatkan.Peranjasa tetekomunikasipada saat ini merupakanhal yang
mutlak dan vital dalam pergerakanroda perekonomianmasyarakat'
Di lGbupaten Banyuasinpada tahun 2006 jumlah instalasitelepon
untuk pelangganbisnismencapai1.139pelanggan,dimana jumlah pelanggan
bisnisterbanyakadalah di KecamatanTalang Kelapa. Kemudian pelanggan
perumahansebanyakll.67l pelanggan,dan pemakaiterbanyakjuga beradadi
KecamatanTalang Kelapa. Lalu pelanggan sebanyak 23 pelanggan,dan
semuanyapelanggannyaberadadi KecamatanTalang Kelapa.Untuk melihat
data kapasitassentraldan jumlah sambungantelepon menurut kecamatandi
KabupatenBanyuasindari tahun 2OO2 sampai dengan 2006 dapat dilihat
tabel pada bagianlamPiran.

Hal2 - 77
Renam katbqrnnn,tat g*E
PathngOrenh 2Nrem25

PREDIK:'I

Tantanganyang akan dihadapi ke depan adalah bagaimanaupaya


pemerintahdalam memenuhijaringan utilitastelekomunikasi
di Kabupaten
Banyuasinterkait dengan peningkatandaerah yang trelayani iaringan
telekomunikasi.Meskipun penggunaantelepon seluler semakinmarak di
masyarakat, namunpenyediaanjaringantetap (fix line) harusselalumenjadi
pusatpertumbuhanSunamenjamin
prioritasterutamauntuk daerah-daerah
kelancaranaktivitas industri, perdagangandan iasa, perkantoran dan
perumahandi lGbupatenBanYuasin
Seiring dengan cepatnya perkembanganteknologi, maka iasa
telekomunikasi memegang Peranan penting dalam pertumbuhan
perekonomianmasyarakat.Untuk itu pemerintah dituntut untuk lebih
memeratakan tidak hanyadi pusatkota, akan
pelayananjasatelekomunikasi
tetapisampaike pelosokpedesaan.

H a l2 - 7 8
Rercam knfungnnnJangln
PanJangDaenh m-206

PEMERINTAHAN
APARATUR
2.2.6. PENINGKATAN

Kebijakan desentralisaridan otonomi daerah sesuaidengan Undang-


undang No.22 tahun 1999tentang PemerintahanDaerahdan Undang-undang
No.25 tahun 1999 tentang Perimbangan Keuangan Pusat dan Daerah
merupakanpelakanaan dari tuntutan reformasi pada tahun 1998. Kebijakan
ini merubah penyelenggaraanpemerintahan yang tadinya terpusat menjadi
namun seiring dengan perkembanganpolitik dan ekonomi
terdesentralisasi,
dalam kurun waktu pelakanaan lima tahun pertama, maka perlu adanya
penyempurnaandan revisi atas undang-undangtersebutdan diubah meniadi
Undang-undang No.32 tahun 2AO4 tentang Pemerintahan Daerah dan

Undang-undangNo.33 tahun 2OO4tentang PerimbanganKeuanganantara


Pusatdan Daerah.
dan otonomi daerah maka pengambilan
Melalui kebijakandesentralisasi
pemerintahandan penyediaanpelayanan
keputusandalam penyelenggaraan
publik diharapkan akan menjadi lebih sederhanadan cepat karena dapat
dilakukan oleh pemerintah daerah sesuai dengan kewenangan yang ada,
namun menjadikantanggungjawab daerah menjadi semakinbesar.Salahsatu
agendaadalah peningkatankualitasaparatur pemerintahdaerah Kabupaten
Banyuasin yang bersih dan berwibawa. yang merupakan upaya untuk
mewujudkan tata pemerintahanyang baik antara lain adanya keterbukaan,
akuntabilitas,efektifitasdan efisisensi,membuka partisipasimasyarakatyang
dapat menjamin kelancaran dan keterpaduan tugas dan fungsi
pemerintahandan pembangunan.PemerintahanlGbupaten
penyelenggaraan
Banyuasinterdiri dari peangkatdaerah SekretariatDaerah.SekretariatDPRD
dan LembagaTeknisyang terdiri dari DinasDaerah,Badan,Kantordan Satuan
KerjaFungsionalPolisiPamongPraja.

Hal2 - 79
RencamPenfungman Janglca
Pat&w Oaenh mQ6'm25

SekretariatDaerah
Daerahdikepalaioleh seorangSekretaris
Sekretariat Daerahyangdibantuoleh
DaerahBidangPemerintahan
Daerah,yaitu AsistenSekretaris
AsistenSekretaris
DaerahBidangEkonomi,Keuangan
dan AsistenSekretaris dan Pemabngunan'

sertag (delapan)Bagian.KedelapanBagianitu adalahBagianPemerintahan'


BagianHukum dan Ortala, BagianKeuangan,BagianPeilengkapan'Bagian
Umum, Bagian Ekonomi dan Keseiahteraan Sosial, Bagian Humas dan
Pembangunan'
ProtokotsertaBagianAdministrasi

Sekretariat DPRD
Sekretariat DpRD dikepalai oleh reorang SekretarisDPRD dibantu oleh
Bagian lGuangan dan Bagian
3 (tiga) Bagian, yaitu Bagian Persid.angan,.
Umum.

Dinas Daerah
adalah
Dinas Daerahterdiri dari 13 (tiga belas)satuankerja, masing-masing
Dinas Pendidikan,Dinas Kesehatan,Dinas Tenaga Kerja dan Transmigrasi'
Dinaspertambangan,DinasPendapatanDaerah,DinasPekerjaanUmum Cipta
Karya,DinasPekerjaanUmum Bina Marga, DinasPekerjaanUmum Pengairan'
Dinas pertanian dan Peternakan,Dinas Kehutanandan Perkebunan,Dinas
perikanandan Kelautan,Dinas KoperasiPerindustrianPerdagangan,Usaha

KecitMenengahdan PenanamanModal sertaDinasPerhubungan.

BadanDaerah
yaitu Badan
Badan Daerah berjumlah 5 (lima) satuankerja, masing-masing
PerencanaanPembangunanDaerah (Bappeda), Badan PengawasDaerah
(Banwasda),Badan Kependudukan,KeluargaBerencanadan Catatan Sipil,
Sosial-
BadanKepegawaianDaerah(BKD)dan BadanPMD dan Kesejahteraan

H a l2 - 8 0
RencatnPenbrgunnhnc*a ^
Dah
_-- fusryYlM DOUL

lGntor Daerah
lGntor Daerahberjumlah3 (tiga)satuankerja,terdiridari lGntor Kesbangpol-
Linmas,
lGntor Pengelolaan
Pasar,
KantorArsipdan Perpustakaan
Daerah.

PerangkatDaerahKecamatan
Wilayah adiministratiflGbupaten Banyuasinterdiri dari l5 (limabelas)
PerangkatDaerahKecamatan.
Nama-namakecamatantersebutsepertiyang
terlihatpadatabeldibawahini :

Iabel 2.ll
JumlahKecamatandi lGbupatenBanyuasin

No. lGcamatan lbtrkota JumlahDesa Jumlah


Kelurahan
l. RantauBavur TebingAbans 21
2. Rambutan Rambutan 20
3. BanyuasinI Mariana 21 2
4. MakartiJava MakartiJava 12 I
5. Betung Betung t9 2
6. Banyuasinlll PanekalanBalai 32 5
7. PulauRimau TelukBetuns 28
8. Muara Telang TelansJava 20
9. Talans Kelapa Sukaiadi 5 6
t0. Muara Padang Sumber
Makmur l5
ll. Banvuasin ll Sungsang 2l
12. Tunskalllir Sidomulvo ll
13. Taniung Laso Sukadamai l5
14. MuaraSusihan Tirta Haria 20
15. Air Salek SalekMukti 12
J umlah 272 t6

H a l2 - 8 1
Renam knbngurwrJatgka
, Pat{ang0aenhMemzS

PREDIKSI

BirokrasipemerintahdaerahBanyuasinmenghadapitantangandengan
makin meningkat kompleksitas permasalahanyang dihadapi dengan
desentralisasiotonomi daerah, demokratisasi,globalisasidan teknologi
informasi.Proses yangdijalankantelahmembuatrakyatsemakin
demokratisasi
menjaditema
masyarakat
sadarakanhak dan tanggungjawabnya.Partisipasi
dalam penyelenggaraan KesiaPan
pemerintahan. aparaturpemerintahdaerah
ini perludieermatiagarmampu
proserdemokratisasi
ini dalam mengantisipasi
memberikan pelayanan yang dapat memenuhi aspek transparansi'
yangprima'
dan kualitas
akuntabilitas

Hal2 - 82
RencanaPembangunan
JangkaPanjangDaerah
Tahun2006 - 2025

Visi,
Misi Arah
dan
nan
Daerah

Babini berisi tentanglangkah


strategisyang dilakukan
PemerintahKabupaten
Banyuasinyang dirumuskan
ke dalam visi, misi dan
kemudian menentukan arah
sertasasaranyang menjadi
prioritas pembangunan dalam
kurun waktu 2O tahun
mendatang
Visi, Misi dan Arah
Pembangunan Daerah

3.I. VISIKABUPATEN
BANYUASIN

isi merupakanrefleksidari semua harapan dan keinginan


bersamadari seluruh pemangku kepentingandi daerah.
Denganadanyavisi, maka semuakemampuandan potensi
yang dimiliki akan dioptimalkandalam upaya pencapaiantujuan. Bahkan
semua aktivitas dan pelaksanaan
lebih dari itu, sebagaikonsekuensinya
pembangunanyang akan diselenggarakan
dalam 20 tahun mendatang,baik
oleh pemerintah,pihak swastamaupun masyarakatharusdisinergikan
untuk
pencapaianvisi daerah Kabupaten Banyuasin.Perumusanvisi daerah
merupakan kristalisasidari keinginan masyarakatdan seluruh pemangku
menjadiamanatyang harusdirealisasikan
kepentingandaerahdan sekaligus
oleh pemerintahmelaluisejumlahkebijakan,program dan kegiatandaerah.
Visi daerahselainmemberikanarahdan fokusstrategiyangjelas,juga mampu
menjadiperekatseluruhkomponenpembangunan, memilikiorientasi
sehingga
pada masadepan, mampu menumbuhkankomitmendan mampu menjamin
kesinambungan
kepemimpinan
daerah.
yang semakinmaju, menuntutkita sebagai
Pola kehidupanmasyarakat
pelakupembangunan
di KabupatenBanyuasin
ini agardapat senantiasa
sigap
segalaperubahandan tantanganyang akan terjadi di
dalam mengantisipasi
masamendatang.Untuk itu diperlukanberbagailangkahnyatadan kebijakan
Rurcana fumbngunan Jatg*a
Panpng Daenh2drffiUrS
Bab
3i
wm**a.toeli'

pokok yang dapat menampilkanwajah baru KabupatenBanyuasindalam


kurun waktu 20 tahun ke depan. Denganmemanfaatkansemuapeluangyang
ada dan potensi yang dimiliki, maka dirumuskanlahVisi dan Misi
DaerahlGbupatenBanyuasinyang menjadiarah dan pedoman
Pembangunan
bagi pemerintahdalam menjawabtantangandan perubahanitu. Adapun visi
Tahun 2006 - 2025 adalah:
pembangunandaerahlGbupatenBanyuasin

cl.anmelestarikan
Banyuasinuntuk kesejahterainrakyat

Visi tersebut mempunyai makna dan filosofi yang mendalam yang


yang semakincerdas,
berkaitandenganperubahanpola kehidupanmasyarakat
kritis dan bersahaja.Visi PembangunanDaerahlGbupaten BanyuasinTahun
2006 - 2025 mengarahpada pencapaiantujuan pembangunandaerahyaitu
daerahyang maju dan masyarakatyang sejahtera.Visi pembangunanini harus
dapat diukur dengankinerjayang ditetapkansebagaitolak ukur keberhasilan
pemerintahdalam memajukandan mensejahterakan
masyarakatlGbupaten
Banyuasin.

Hal3 - 2
RencanaPembngunn Jary*a
PanlangOaenhW-n2i

VISI
PENJETASAN

MAJU
BANYUASIN

pada tahun mendatang


Mengandungarti bahwa lkbupaten Banyuasin
lestari dan dapat
diharapkanmenjadi lkbupaten maiu yang layak huni'
saranadan
memberikanpelayananyang baik serta mampu menyediakan
menghasilkan
prasaranabagi semualapisanmaryarakatnyasehinggadapat
kita tahu'
sumber daya manusia yanS berkualitasdan unggul, karena
itu sendirimerupakanlangkahyang penting
peningkatankualitatmasyarakat
daerahyanSberkelanjutan.
pembangunan
dalammencapai

BANYUASINSEAHTERA

angka
Tingkat kesejahteraanmasyarakatdapat dilihat dari menurunnya
perkapita dan
kemiskinan dan penganSSuran,meningkatnya pendapatan
kebutuhan
terpenuhinya hak-hak dasar masyarakat, baik itu dari sektor
perumahai'
sandang dan pangan, pendidikan, pelayanan kesehatan,
pendapatan
tersedianya lapangan pekerjaan, dan tain-lain- Tingginya
yang
perkapitamasyarakatsaat ini, yaitu mencapailebih dari 900 US Dollar
jika dibandingkan dengan Tahun 2AA3 rata-rata pendapatan perkapita
yang
masyarakathanya sebesar467,60 US Dollar saja,merupakanindikator
peningkatanyang
menunjukkanbahwa pendapatanmasyarakatmengalami
ini' diperlukan
signifikan dari tahun-tahun sebelumnya.Seiring dengan
dukungan yang besar dari semua lapisan untuk mewujudkan Program
pemerintah dalam menciptakan Banyuasinyang lebih sejahtera dimasa
mendatang.

H a l3 - 3
RencamPamMtgwmn Janglca
PadangOaenh MA(EF

BANYUASIN
3.2. MISIKABUPATEN

DaerahlGbupatenBanyuasin,
Untuk mewuiudkanVisi Pembangunan
maka perlu ditetapkanpula misi utama yang akan dilaksanakan
Pemerintah
JangkaPaniangTahun2006'
Pembangunan
Daerahdalam merealisasikan
2025. Misitersebutantaralain,yaitu :

D MEWUJUDIGN KAPASITAS PEMERINTAHAN YANG ADIL JUJUR"


BERSIHDAN BERWIBAWA
.

Pemerintahansebagaisalahsatu pelakupembangunandalam 2O tahun


mendatang masih akan memitiki peranan penting dalam mendukung
pencapaian kemajuan dan pemerataan pembangunan yang dicita-citakan
masyarakat.Dengan demikian, penciptaantata kelola.pemerintahanyang
baik, melalui perwujudan dan sistempemerintahanyang adil, jujut', bersih,
berwibawa dan bertanggungjawab dengandidukung oleh penegakkanhukum
yang kuat harus menjadi komitmen bersama. Dalam konsep penguatan
kapasitas manajemen, pemerintahan ini juga harus diimbangi dengan
penguatanpartisipasipublik, melalui pendidikanpolitik lokal yang baik dan
penyediaan ruang bagi partisipasipublik dalam seluruhtatanan pengelolaan
pemerintahan.
Misi'ini dimaksudkanuntuk mencapaikondisitata pemerintahanyang
baik yang dilakanakan dengantransparan,akuntabel,profesional,efektifdan
efisien serta berkeadilan. Misi tersebut terkait dengan kontekseksistensi
Kabupaten Banyuasinitu sendiri yang masih relatif baru dan merupakan
pemekarandari KabupatenMusi Banyuasin.Dengantercapainyahal tersebut,
diharapkanakan tercipta kondisi yang kondusifbagi pelaksanaan
tugas-tugas
pemerintahan daerah dalam melayani dan mendorong kemampuan
masyarakat.Melestarikandan memberdayakankapasitaspemerintahandaerah

H a l3 - 4
Rerrcaia funbngman,brrgl@
Patfitry Dacnh4ffi6'4r29

yang kuat serta semakin memantapkan ikatan hubungan maryarakat dan


pemerintahdaerahdalam kerangkaNegaraKesatuanRepubliklndonesia.

D MEWUJUDKAN SUMBERDAYA MANUSIAYANG BERKUALITAS

pelaksanaanmisi ini dilandasi oleh kesadaran bahwa keberhasilan

pembangunan rangat ditentukan oleh kualitas sumber daya manusia dan


pembangunanyang berorientasipada peningkatansumberdaya manusiademi
tersujudnyamasyarakatlfubupaten Banyusainyang sehat,cerdas,kompeten'
produktif, partisipatif,berpendidikan,berkarakterdan berakhlakmulia-
Dengan mengedepankanpeningkatansumberdaya manusiayang berkualitas
dan berdaya saing; meningkatkan Penguasaandan pemanfaatan serta
'Teknologi, akselerasiperwujudan visi
penciptaan llmu Pengetahuandan
pembangunandaerah KabupatenBanyuasinakan dapat tercapaidan cepat
terealisasi.

D MEIUUJUDKAN MASYARAIGT BANYUASIN YANG DAMAI DAN


DEMOKRATIS

Misi ini dimaksudkan untuk meningkatkan dukungan Pemerintah


Kabupaten Banyuasin dalam menciptakan keamanan dan ketertiban
masyarakat nelalui penegakkan hukum yang seadil-adilnyadan tidak
memandanglatar belakangmaupun statussosialmasyarakat.Usahatersebut
ditopang oleh aparat penegak hukum yang bersih serta berperan aktif
terhadap terciptanya keamanan dan kenyamanan seluruh masyarakat
KabupatenBanYuasin.
Tercapainyamisi ini diharapkanakan memberikanrasa damai dan tentram,
sehinggaaktivitas masyarakatdi semuasektor dapat tumbuh dan berkembang
dengan lebih baik lagi.

H a l3 - 5
Rercam furfuVuPn,rarglo
PadangDaanh mr-4t25

D MEU,UJUDKAN PEREKONOMIAN DAERAH YANG MAJU DAN


MANDIRI

Misi ini adalah memperkuat perekonomian domestik berbasis


keunggulandaerah menuju keunggulankompetitif dengan membangunsistem
produksi, distribusi dan pelayanan dalam negeri. Pembangunandengan
mengoptimalkanseluruh potensi ekonomi yang ada di KabupatenBanyuasin
dalam rangkamemberikanpeluangyang seluas-luasnya bagi masyarakatuntuk

meningkatkankesejahteraandan kualitashidupnya.
Melalui misi ini, diharapkan dapat mensinergikansemua potensi yang
mendorong mobilitas dan aktivitas perekonomian , baik dari sumber daya
yang ada, para pelaku ekonomi, dunia usaha mauPun institusi-institusi
ekonomi formal dan informal lainnya demi mendorong terwujudnya
perekonomianyang tangguhdan berdayasaingtinggi.

>TMEMANTAPIGN SEKTOR PERTANIAN YANG BERORIENTASI


AGRIBISNIS

Misi ini dimaksudkanuntuk mengoptimalkanpengelolaansumberdaya


alam yang berbasispada pertanian yang sebenarnyamerupakan basisdasar
pertumbuhan ekonomi Kabupaten Banyuasin. Potensi pertanian tersebut
menjadi prioritas utama pembangunandaerahyang selnjutnyadidukung oleh
sektor industri,jasa serta sektor migasyang masih perlu di eksplorasilebih
lanjut, namundengantetap memperhatikanaspeklingkungan.
Tercapainyamisi ini akan sangatbergantungpada komitmenpolitik dan
peran serta seluruh masyarakatlGbupaten Banyuasin.Oleh karena itu.
terbentuknya komitmen yang kuat atas prioritas dan kunci rencanastrategis
pembangunandaerahtersebutsangatpenting untuk disadarioleh masyarakat

H a l3 - 6
Renana Penbngamn,tetg[a
PatfuVOaenhM'n25

gunamengeliminasi
Banyuasin sektoraldalam
munculnyaego kecenderungan
lainnya.
pembangunan
rencanastrategis

IGBUPATENBANYUASIN
3.3. ARAHPEMBANGUNAN

pembangunan daerah sebagai bagian integral dari pembangunan

nasional harus dilaksanakansecaraterpadu dan serasiserta diarahkan untuk


mengembangkandaerah sesuaidengan prioritas dan potensi wilayah itu-
Dalam pelaksanaanpembangunandaerah, perlu didukung adanya prakarsa
dan peran aktif masyarakat termasuk pendayagunaan,Pengawasanserta
koordinasipembangunan.Kemampuandaerah dalam manajemendapat lebih
mendayagunakan potensidan kemampuanyang dimilki daerahdalam rangka
mendukung sumber-sumberpenerimaan daerah. Kerjasama antar daerah
dalam meningkatkanpembangunandan pengembanganwilayah perlu terus
dirtingkatkan agar daerah-daerahdalam satu wilayah pembangunandapat
tumbuh dengan serasidan mampu memecahkanmasalah-masalah wilayah

secarabersama-sama.Dalam rangkameningkatkanpemerataanpembangunan,
tebih diutamakan bagi kecamatan,kelurahan serta desa yang tertinggal dan
kurang berkembang,sehinggaketimpanganekonomi dan keseniangansosial
dapat segerateratasi.
Oleh karenaitu, RencanaPembangunan Tahun
JangkaPanjang'(RPJP)
2006 - 2025 disusununtuk mencapaitujuan pembangunanyna8 menSacrr
pada arah pembangunandengandilandasistrategipertumbuhan,pemerataan'
keserasian,keseimbangan,interkoneksitasdan dinamis. Berdasarkanfungsi
yang menjadi kewenangan Pemerintah Kabupaten Banyuasin, maka
pencapaiansasaranpembangunandilakukanmelaluipenetapanarah kebijakan
pembangunansepertiyang tertuang berikut ini :

H a l3 - 7
RetwmWqwwtlatdca
Padary Drenh 2qr6-206

D PENINGKATANTANAMAN PANGAN DAN HORTIKULTUM

PotensilGbupaten Banyuasindi sektor pertanian tanaman pangan'dan


hortikultura dalam arti luas masih sangat terbuka untuk ditingkatkan yaitu
dengan melakukan revitalisasi pembangunan pertanian. Dalam rangka
meningkatkan produktivitas lahan pertanian, cara yang dapat dilakukan
adalah dengan memberikanarahan-arahanteknis dan non teknis. Hal ini
lahantanpa adanyapengaruh
dimaksudkanagardapat lebih mendayagunakan
yang dapat merusak lingkungan. lGbupaten Banyuasinsebagai salah satu
witayah produsen utama produk-produk pertanian memiliki peran strategis
yang harus terus dijalankan dan dikembangkan Jecara harmonis dan
berkelanjutan. Hal itu tidak lain bertujuan untuk mengembangkansektor
pertanian tanaman pangan dan hortikultura dalam rangka peningkatan
petani dan pelakuekonomi terkait lainnya.
kesejahteraan
Tolak ukur pengembanganwilayah dengan potensi pertanian yang
paling sering digunakan adalah konsep pengembangan agropolitan.
agropolitan merupakansalahsatu upaya untuk memanfaatkan
Pengembangan
potensi sumberdaya pertanian dengan membentuk masyarakatyang tangguh
dalam mengelola pertanian untuk menghasilkanproduksi pertanian yang
optimal. Pengembanganagropolitan juga pada dasarnya merupakan uPaya
untuk menggali potensi kegiatan sektor pertanian terutama sub sektor
unggulan yang telah ditentukan berdasarkankriteria tertentu antara lain
produk tersebutharusmempunyaidaya saingyang cukuptinggi.
iklim usahadan
Peranpemerintahdalam hal ini adalahmengkondisikan
prasaranausahayang menunjangpengembanganunit-unit usahadi bidang
pangan,termasukmelakukanintervensipasaragar tercipta pasar komoditas
pangan yang berkeadilan dengan pelaku pasar yang bertanggungiawab.
Pemerintahjuga bertugasmemberdayakanmasyarakatagar mampu mengatasi

H a l3 - 8
Renam futtfuUwan.tada
Pat{ary AdeOh4xrem25

ketahananpangannyasecaramandiri. Peran pemerintah yang cukup luas ini


diaktualisasikandalam kebijakan dan program pada berbagai unit kerja
sektoral, antara lain pertanian, perikanan, perkebunan, peternakan'
perkebunan, industri, perdagangandan sektor-sektor lainnya yang ada di
lingkup Pemerintahlkbupaten Banyuasin.
Demi memantapkansektor pertaniantanaman pangandan hortikultura,
maka beberapakebijakanke depan yang dapat ditempuh diantaranyaadalah :
e Meningkatkan kualitas sumber daya manusia dalam pelaksanaan

pengembangan pertanian tanaman pangan dan hortikultura yang

berorientasi agribisnis dan agriindustri dengan memanfaatkan semua


peluangyang ada;
q Memantapkankelembagaanuntuk mewujudkan petani yang kuat, dinamis,

mandiri dan berdayasaingtinggi;


pada lahan yang masih
e. Memacu peningkatanintensifikasidan ekstensifikasi
potensialsertapenerapanusahatani terpadu melaluiteknologiyang ramah
lingkungan;
e Memperbaiki penyediaan kesejahteraan tenaga penyuluh dan

meningkatkansertamelengkapiketerampilan mereka;
e Menerapkan sistem perencanaan program/kegiatan secara terpadu dan

terkoordinasiantar sektor;
e- Mengembangkankomoditas unggulan dan diversisikasiproduk dengan

menggalipotensiwilayah secaraoptimal sesuaidenganpeluangpasarSuna


meningkatkanpendaPatanPetani;
c- Meningkatkanproduktivitas,kualitas dan produksi komoditi pertanian
yang dapat dipasarkansebagaibahan baku industri pengolahanmaupun
ekspor;

H a l3 - 9
Retww funtbngqan Jaflglce
PaqpqOnnhWZU2S

Meningkatkanpembangunan pertaniantanamanpangandan hortikultura


yang berkelanjutanmelalui peningkatanpengenalandan penerapan
teknologidalambudi dayapertanianmaupunpengelolaan
PascaPanen.

PETERNAIGN
D REVITALISASI

Padadasarnyapembangunanyang dilakukanoleh pemerintahbertujuan


untuk memperbaiki dan meningkatkan kesejahteraanmasyarakat dengan
mengikutsertakansemua pihak yang terkait di dalamnya. Sejalan dengan
filosofi tersebut, maka pembangunan ketahanan Pangan secara umum
menggunakankonsep pembangunan sistem agribisnisdan agriindustri yang
diimplementasikan kedalam program pengembangan agribisnis dan
agriindustri,ketahananpangandan pemberdayaanmasyarakatsertaperkuatan
ekonomi rakyat. Dengankata lain, atasdasarpendekatandan pembangunan
yang akan dilaksanakandalam pemberdayaanmasyarakatdan perkuatan
ekonomi rakyat, maka pembangunanpeternakandalam kurun waktu 2A
tahun mendatangharustetap berorientasipada penerapankonsepagribisnis
dan agriindustriyang berwawasanlingkungandan berbasisitmu pengetahuan
dan teknologi sertadenganmemanfaatkansumberdaya lokal secaraoptimal.
Berpedornanpada konseptersebut,maka arah kebijakanpembangunan
sektorpeternakandi KabupatenBanyuasinantaralain :
'-. lr4eningkatkarr para peternak'rnelaluikontribusiterhadap
kesejahteraan
pendapatannya;
\- Meningkatkanpembangunantarana dasar untuk peningkatanjumlah
ilmu pengetahuan
produksidan kualitasternakyang berbasis dan'teknologi
sertaberwawasanlingkungan;

H a l3 - 1 0
*ffiffi
,* Melakukanpembinaan,pelatihandan pemantapankelembagaan
pertanian
dan peternakan;
,.' Menjalin kerjasamayang terintegrasidenganinstansiterkait sepertiDinas
Perkebunan, DinasPertaniandan Dinas Perikanandalam memanfaatkan
pakanternak;
hasilikutannyasebagai
,- Menyederhanakan
jalur birokrasisehinggaakan mempermudahinvestor
asing menanamkanmodalnya dan membuat kebijakanyang dapat
di lapangan;
pelaksanaannya
mendukung
,* Menjalin kemitraandengan sektor Swasta/BUMN/BUMDdalam usaha
menumbuhkan minat wirausaha dan sekaligus dapat mengurangi
padapemerintah;
ketergantungan
.r-r Mengupayakandiversifikasiusahapada setiapperusahaanagribisnisdan
peluangusahapenyediaaninput
agriindustrisehinggaakan memperbesarl
bagicaloninvestor.
pengolahan

D RN,,ffALISA5IPERIKANANDAN KETAUTAN

Kabupaten Banyuasinsebagai salah satu wilayah produsen produk-


produk perikanan diharapkan terus meningkatkan kualitas dan kuantitas
produksinya tanpa mengesampingan kesejahteraan petani/nelayan. Ada
beberapaarah kebijakanyang ditempuhantaralain :
L' Meningkatkanproduksiperikananmelalui usahaintensifikasi,ekstensifikasi

budidaYa;
dan diversifikasi
q Meningkatkan pembangunan perikanan yang diarahkan pada usaha

agribisnis perikanan meliputi benih ikan, ikan konsumsi, ikan hias,


penangananpascapanendan diversifikasiproduk olahanperikanan;

H a l3 - l l
Retwm Magnnnn.tatvla
Parfugtusnhzilbnt$

MelaksanakanWasdal SumberdayaPerikanan tecara terpadu dan


fungsilingkunganpesisirpantai;
dalamupayamelestarikan
berkelanjutan
Mengembangkan ekonomi daerahberbasisisumberdaya perikanandan
kelautan metelui pengembanganusaha, investasidan pemasaranhasil
perikanau
dan budiaya
penyediaansaranadan prasaranapenangkapan
Memfasilitasi
ikan:
Menyediakantenaga handal di sektor kelautandan perikananmelalui
pendidikanformal;
industri
Melakukanpenataankawasanperikananuntuk pengembangan
lingkungan.
yangberwawasan
perikanan

D RWffALISASIKEHUTANAN

Pembangunansektor kehutananyang berkeadilandan berkelanjutan


dapat tercapai apabila ada perubahan paradigma. Paradigma baru
pembangunankehutanantersebutadalahpergeseranorientasidari pengolahan
hutan menjadi pengelotaan sumberdaya (resources based managemenfl,
sertapengelolaansumberdaya
pengelolaanyang sentralistikdan desentralistik
yang lebih berkeadilan. Upaya memakmurkan masyarakat dengan
mempertahankanhutan agar tetap lestari telah menjadi perhatian semua
pihak. PemerintahDaerahdimana dalam Undang-undangNo. 4l tahun 1999
tentang kehutanan dinyatakan sebagaipengelola. diamanatkan menyusun
rencanayang berkaitandenganpembentukanunit dan pengelolaunit.
Dari prediksitantanganyang akan dihadapi pemerintahdalam kurun
waktu 20 tahun ke depan, maka PemerintahKabupaten Banyuasintelah
menyiapkanbeberapaarah kebijakan'antaralain :

H a l3 - 1 2
RencamWtgunnJergla
Patfrtg Oaenhzdten25

s Meningkatkan pembangunan kehutanan yang diarahkan untuk


masyarakatdengantetap menjaga
manfaatbagi kesejahteraan
membenikan
hiduP;
sumberdayaalamdan lingkungan
kelestarian
Meningkatkanfungsi hutan sebagaisalahsatu faktor penentuekosistem
lingkungan, melindungi plasma nutfah dan mengembangkan
hayati dengan memberdayakanmasyarakatdi sekitar
keanekaragaman
hutan;
kawasan
s Melestarikanhutandenganprioritasdi daerahaliransungai,kawasanhutan
lindungdan hutanrakyat;
hutanpendidikanyangberfungsisebagaihutanpenelitian
I Mengembangkan
ilmu pengetahuan
dan pengembangan danteknologi;
b Meningkatkanpengelolaanlahankritis untuk mempertahankan
kesuburan
surnberair;
dan mempertahankan
tanah,memelihara
di sektorkehutanan;
I Memacuinvestoruntukberinvestasi
partisipasi
b Meningkatkan dalampengelolaan
masyarakat hutan.

PERKEBUNAN
D REVITALISASI

Upaya perbaikanantar sub sistemusahaperkebunansangatdiperlukan


untuk mangatasipenurunan kualitas dan kuantitas komoditi perkebunan,
karena jika tidak segera dicarikan solusinya, maka dikhawatirkan dalam
beberapapuluh tahun ke depan produksi di sektor perkebunanakan mati.
Denagndemikian diperlukansuatuprogramdan arahan untuk meningkatkan
nilai produk primer agar diperoleh nilai tambah yang dapat dinikmati tidak
hanyaoleh pedagangmaupun pengolahmelainkanjuga dapat dinikmati oleh
para petani pekebun. Upaya peningkatan pendapatan masyarakatpekebun
sebagaisalah satu tujuan utama revitalisasiperkebunan dapat ditakukan

H a l3 - 1 3
Retrcamfunfutgnnwt,tang*t
' Pathng Orctah m(bZE8

melalui perluasanuntuk mengataripenganggurandan mencaPaipentumbuhan


ekonomi yang tinggi.
Pengembangankomoditas unggulan perkebunan seperti karet dan
kelapa sawit yang memiliki keunggulankomparatif dan kompetitif baik secara
nasiona, regional maupun global dapat memberikan efek ganda (multiplier
effec| dalam menggerakkanperekonomianmasyarakatKabupatenBanyuasin
serta diyakini mampu meningkatkan pendapatan dan kesejahteraan
masyarakat, memperluas lapangan pekerjaan, meningkatkan penerimaan
devisa serta untuk pelestarianlingkungan hidup dalam rangka meurujudkan
pembanguhanyang berkelanjutan.
Terkait masalah yang telah dinyatakan sebelumnya, maka arah
kebijakan yang dilakukan pemerintah dalam ..upaya merevitalisasisektor
perkebunanadalahsebagaiberikut :
fl Mengoptimalkan penggunaansumberdaya lahan yang berkelanjutandan
berwawasanlingkungan;
I Mengembangkan sektor perkebunan menjadi usaha agribisnis dan
agriindustri;
I Perbaikansaranadan prasaranapenunjanguntuk meningkatkankualitas
dan kuantitasproduksi perkebunan;
fl Menciptakaniklim yang kondusif untuk menambahperan dan minat para
investor;
I Meningkatkan pemanfaatan komoditi perkebunan sebagai bahan baku
industri;
fl Memperluasarealperkebunanmelaluiinvestasimurni dan kemitraan
I peremajaandan sertifikasilahan;
Melakukandiversifikasi,
fl Memberikanperlindungantanaman perkebunandari seranganorganisme
penSganSSu;

fl Peningkatanketersediaanbibit ungguldan saranaproduksi lainnya;

H a l3 - 1 4
Rencam Mnbngptwt,tet glce
PadaVOasnhM62t ir6

penerapanteknologitepat
fasilitasidan implementasi
I Melakukansosialisasi,
gunadan tepatsasaran.

D RN,|ffALISASIPERTAMBANGANDAN PENGGALIAN

Potensisumber daya alam berupa bahan galian dan bahan tambang


yang dirniliki KabupatenBanyuasincukup besar.Upaya yang dilakukanperlu
diarahkan pada optimalisasipendayagunaanpotensi berbagaisumber daya
yang berkelanjutan dan berwawasan lingkungan guna rneningkatkandaya
saing Kabupaten Banyuasindi pasar lokal, regional maupun global. Upaya
tersebut dijalankan untuk mencapai kondisi ideal lingkungan di Kabupaten
dan keserasianantara
Banyuasinyaitu dengan terpeliharanyakeseimbangan
upaya untuk memacu pertumbuhan perekonomian dan upaya pelestarian
fungsi lingkungan,sehinggapembangunandapat berlangsungsecaraproduktif
dan berkelanjutan.
Konsep pengembangansektor penggalian dan pertambangan secara
praktis akan mencakup bidang perencanaan,pengeloaandan pengawasan.
dasar dalam pengembangan
Dengan demikian akan ada satu kebijaksanaan
sumber daya alam khususnyasektor penggalian dan pertambangan.yaitu
sebagaiberikut:
O Meningkatkan pembangunan pertambangan dan penggalian untuk
mendorong kegiatan ekonomi masyarakat,melalui penganekaragaman
pengolahanhasilpertambanganyang efektifdan efisienuntuk memperluas
dan menciptakanlapangankeria;
O Meningkatkan pengeloaan sektor pertambangandan penggalian yang
dengan melibatkanperan serta masyarakatdan terpadu
diselenggarakan
dalam lintasdaerah;

H a l3 - 1 5
Rercam Penfu ngnpn Janglca
Pat&tg OaenhzdreQs

(l Menciptakan iklim usaha yang kondusif, adil dan transparan dalam

pengembangansumber daya alam melalui pengelolaanyang efektif dan


efisien dan sesuai dengan standar etika yang tinggi serta berorintasi
meningkatkannilai tambah dalam rangka pengembanganmasyarakatdan
wilayah serta berbagai sumber kemakmurari masyarakat yang pada
gilirannyadapat mencapaipembangunanyang berkelanjutan;
o Mendorong upayaeksplorasidan eksploitasicadanganbahantambangdan
galian yang menggunakan teknologi tepat guna, efektif, efisien dan
berkelanjutan serta berwawasan lingkungan dengan menyusun profil
potensisumberdaya alam yang prospektif;
(t Meningkatkankemampuankelembagaanyang menanganikebijakansektor
penggalian dan pertarnbangandi daerah. Hal ini dimaksudkan agar
pengelolaannyadapat dilakukansecaralebih profesional;
(, Meningkatkansumberdaya manusiamelaluipendidikandan pelatihan.Hal
ini dimaksudkan untuk meningkatkan sumber daya manusia dalam
pengelolaansumberdaya alam yang lebih efisien.

D PEMBANGUNANKEPENDUDUKANDAN KELUARGABERENCANA

l-aju pertumbuhan penduduk merupakan permasalahanyang sangat


kompleksdan vital, karenafaktor ini dapat mempengaruhisektor-sektorlain,
misalnya pengangguran,kemiskinandan pendapatanperkapita penduduk.
Jika masalahpeningkatanlaju pertumbuhanpenduduktidak segeradiatasidan
ditanganidengantepat. bukantidak mungkinpeningkatanpembangunanakan
menjadi terhambat. Untuk mengatasi masalah kependudukan, maka
pemerintah tetah menyusun beberapaarah kebijakandalam 2O tahun ke
depan,antaralain :

H a l3 - 1 6
Retnam Penhrynman'tergla
PanJargDaenh Ne2U?5

s tingkat kelahiranpendudukmelaluiupayamemakimalkan
Mengendalikan
aksesdan kualitas pelayananKR terutama bagi keluargamiskin dan
didaerah terpencil, meningkatkanpengetahuanmayarakat khususnya
reproduksiagantercipta
usiasuburtentangkesehatan
remajadan pasangan
yanglebihbaik;
kehidupankeluarga
s yang bertujuanmemperbaikisistem
Penataanadministrasikependudukan
dan sisteminformasikependudukan
administrasi dalamupayamendorong
terakomodasinyahak-hak penduduk,tertib administrasipenduduk dan
informasipendudukyangakuratdan terpadu;
tersedianya
I Penataankelembagaanadministrasikependudukanyang berkelanjutandi
kualitassumberdayamanusia;
daerahtermasukmeningkatkan
s Menumbuhkankesadarandengan metakukansosialisasidan promosi
(KB).
akanperltingnyaprogramKeluargaBerencana
kepada'masyarakat

D PERBAIKAN IKLIM KETENAGAKER'AAN,PENGANGCURANDAN


PENGENTASAN KEMISKINAN

Pembangunan sektor ketenagakerjaan diarahkan dalam konteks


keseirnbanganantara hubungan tenaga kerja, pengusahadan pemerintah.
Perlindunganhak-hak buruh baik yang berada di sektor formal maupun
informal serta keseimbangandaya tarik investasiwilayah yang berterkaitan
dengan ketenagakerjaaakan bermuarapada kelembagaandiantara pemangku
Masalahkependudukan
kepentingan(stakeholdei di sektor ketenagakerjaan.
berhubuganerat dengantingkat kemiskinandan pengangguran.
Pertumbuhan
penduduk yang tinggi dengan tidak diiringi perluasan dan penyediaan
lapanganpekerjaanyang cukup, maka akan mempengaruhistabilitasekonomi.

H a l3 - 1 7
Rercam funfuryumn.tatg&a
Pat#ry DaqahZX\62U?5

Oleh karena itu, arah kebijakan yang diusung pemerintah dalam waktu 20
tahun ke depan adalah :
S Meningkatkan kualitas sumber daya manusiaagar menjadi manusiayang
unggul dan terampil yang siap pakai terutama bagi masyarakatyang telah
memasuki usia angkatan kerja dengan memantapkan sektor lain yang
menjadi penunjangsepertisektor pendidikandan kesehatan;
+ Peningkatanperan bursa tenaga kerja bagi aksestenaga kerja masyarakat
dalam menjangkaupasarkerjabaik di dalam maupunluar negeri;
S Memantapkan perlindungan tenaga kerja yang meliputi hak untuk
berserikat,hak untuk mendapatkanpelayanankesehatdndan keselamatan
kerja sertajaminan sosialtenagakerja;
f Meningkatkanpendayagunaandan penyalurantenagakerja yang didukung
informasi ketenagakerjaanbaik dari dalam maupun luar negeri serta
melakukan perencanaan tenaga kerja yang komprehensif dengan
memperhatikankemampuandan kualitastenagakerjaitu sendiri;
S PerbaikanUpah Minimum Regional (UMR) bagi pekeria di lGbupaten
Banyuasiu
S Meningkatkanpendapatanperkapitapendudukmiskin;
# Memberdayakan masyarakat miskin di sekitar areal pertambangan,
kehutanan,perkebunandan industri;
S Meningkatkankesempatankerja dan kesempatanberusahayang luas bagi
pendudukmiskin.

H a l3 - 1 8
RetrcamPemhngtnn,ter&,
Pa$atq Duahgxb20t26

D PERTUMBUHANEKONOMI MASYARAIGT

Pembangunanekonomi di Kabupaten Banyuasin merupakan proses


yang berkelanjutan untuk mencapai kemakmuran dan kesejahteraan

masyarakat.Tujuan utamanyaadalah meningkatkankegiatanekonomi daerah


sehinggadapat memperbaiki kualitashidup yang bisa dinikmati secaranyata
dan merata oleh seluruh masyarakatdi Kabupaten Banyuasin.Salah satu
penyebabutama lambatnyapemulihanekonomi adalah keterpurukansektor
riil yang belum sepenuhnyabangkit. Terdapat banyak faktor yang menjadi
penyebab sulitnya sektor riil untuk bisa bangkit dan kembali bergairah'
diantaranyayaitu produktivitassektor produksi yang masih rendah akibat
lemahnya dinamika inovasi dan kewirausahaan,belum berkembangnyaiklim
usaha yang dapat menciptakan dorongan untuk meningkatkan persaingan
yang sehatdan rendahnyakemampuantenagakerja yang ada-
Disampingketerbatasankemampuan pendanaan,banyaknya segmen
penduduk yang masih berada di bawah garis kemiskinanmenjadi faktor
kendalautama. Lalufungsiintermediasiperbankanbelum sepenuhnyaberjalan
sesuaidenganyang diharapkansehinggapada gilirannyamengakibatkanruang
gerak sektor riil menjadi semakinterbatas.Dan kemudian berbagaiperubahan
kebijakan mengenai otonomi daerah dalam penerapannya telah

mengakibatkan terjadinYa tumpang tindih peraturan dan


sehinggapada gilirannyaiustru menga(ibatkanbiaya
pengaturan/penataannya
ekonomi yang tinggi (high cost economy). Adapun kebijakanyang diambil
pemerintahuntuk mengatasihal ini antaralain :
g Meningkatkan sektor-sektorunggulan dan semua potensi sumber daya

alam yang ada di KabupatenBanyuasin;

H a l3 - 1 9
ReneamP*futgunnJat g*a
PanhngOaenhn e2O25

Meningkatkanperan serta.swastadan masyarakatdalam Pembiayaan


pembangunandaerahagartercapainyakesinambunganPembangunandan
daerah;
kemandirian
MengembangkanPusat-Pusatkajian teknologi dengan melibatkan
teknologi yang tepat guna dan
perguruantinggi dalam pengembangan
unggulandaerah.
sektor-sektor
dibutuhkanuntukmeningkatkan

DAN PERDAGANGAN
D PENGEMBANGANPERINDUSTRIAN

Melihat potensi yang begitu besar yang dimiliki sektor ini, maka
pemerintah berusahauntuk terus mengembangkankedua sektor ini sehingga
nantinya dapat inenjadi motor pertumbuhanekonomi dan mamPu menyeraP
tenaga kerja yang tebih besarlagi. Hal demikian sangatpenting karenaekspor
migas tidak dapat lagi diandalkan sebagai sumber penerimaan. Dengan
demikian ekspor non migas, terutama hasil industri akan sangat berperan
dlaam pertumbuhanekonomi
Arah kebijakan yang ditempuk pemerintah dalam kurun waktu 20
tahun mendatangadalahsebagaiberikut :
* Meningkatkanpembangunanindustri, terutama pengembangankelompok
kecil yang terdapat di sentra/kantong-kantongindustri, industri rumah
tangga,dan pedesaan;
4 Meningkatkan pembangunan industri yang diarahkan dengan

mengutamakanpemanfaatanbahan baku lokal dan teknologi tepat guna


sertaindustriteknologitinggiyang ramahlingkungan;
* Meningkatkanpembangunanindustri yang diarahkan dengan sebanyak
mungkin untuk memanfaatkandan mengolah bahan lokal dari hasil
pertanian dan industri yang menghasilkaninput bagi ProJesproduki
pertaniansertarekayasamesin/alattepat guna dalam rangka menghasilkan

H a l3 - 2 0
RencamPerfutgunan Jarvrta
PanJangOaenhZdr&2U?5

produk unggulan baik untuk memenuhi kebutuhan dalam negeri maupun


ekspor;
o Meningkatkanpembangunandan pengembanganindustri menengahdan
besar pada kawasanindustri sesuaidengan perencanaantata ruang dan
dapat menyerap tenaga lokat sebanyak-banyaknyadan meminimalkan
pencemaranlingkunganyang ditimbulkan;
perdagangandan jasayang
Mendorong pertumbuhandan pengembangan
bertumpu kepada hasil dan produksi daerah yang berorientasiekpor dan
pasardomestik;
Mendorong dan memfasilitasipengembangandan perdaganganekspordan
pengendalianimpor;
S Mendorong dan meningkatkan upaya perlindungan produsen- dan
konsumen;
Mewujudkan sistem perdaganganyang berkeadilan, efisien dan efektif
dengan memanfaatkanketersediaanbarang dan jasa, kelancaranarus
perlindungankonsumen;
distribusidan pemanfaatanpelaksanaan
Meningkatkan perdagangan barang dan jasa yang diarahkan pada
jenis, jumtah dan mutu komoditasdalam negeri dan
penganekaragaman
eksporsesuaidenganpermintaanpasar;
Memelihara dan menciptakan peluang Pasar dengan peningkatan daya
saing,penyempurnaansaranadan prasaranaperdagangan,
sisteminformasi
pasarsertakegiatanpromosiyang lebih terstrukturdan terarah.

H a l3 - 2 1
Renann fu mfungnpn Jengtca
Pat{angOaenhZXrWtE

KOPERASIDAN USAHA KECILMENENGAH


D PEMBERDAYAAN

Dalam rangkamevuujudkanpembangunandan pemberdayaankoperasi


dan UsahaKecil Menengah (UKM) akan dilaksanakandengan beberapaarah
kebijakan,yaitu sebagaiberikut :
e Mengembangkankoperasidan UKM dengan menitikberatkanpada aspek
permodalan, sumber daya manusia, kelembagaandan Pemasaranyang
berbasiskerakyataan,meningkatkanpertumbuhan ekonomi, menciptakan
lapanganpekerjaandan meningkatkandaya saing;
e Mengembangkankoperasidan Ul(ful agar lebih mamPu berperan sebagai
penyediabarangdan jasa pada pasardomestikkhususnyauntuk memenuhi
kebutuhanmasyarakatbanYak;
e- Mengembangkan BusinessDevelopment Seruices(BDS) sebagai lembaga
yang memeberikan pelayanan dan pendampingan kepada sentra-sentra
produksidan koperasi;
c- Meningkatkanperan sertakoperasi,pemilik modal dan lembagakeuangan
melalui sistem kemitraan guna meningkatkan produksi, Pemagarandan
perlindunganUsahaKecilMenengah(UKM):
e Meningkatkanprofesionalisme
pengusahakecildan menengahuntuk dapat
bersaingdi pasardalam negerimaupunluar negeri;
e Mengembangkanusaha informasi dan tradisional untuk lebih diarahkan
agar tumbuh menjadi unsur ekonomi rakyat yang tangguh, mandiri dan
berdaya saing serta mampu berperan dalam penciptaan usaha dan
lapangankerja.

Hal3 - 22
Rencamfunbngamnlatwka
Patthq Oaeah ZXnAeS

MASYARAKAT
D PENINGIqTANKUALITASKESEHATAN

Untuk mendukung pembangunan kesehatandi Kabupaten Banyuasin


melalui pemberdayaanmasyarakatdan peningkatan sumber daya manusia,
maka telah disusunRencanaStrategissebagaiberikut :
a) Pembangunan Banyuasin berwawasan kesehatan. Dimana rencana ini
dilakukan dalam upaya menjamin masyarakatBanyuasinterhindar dari
dampak negatif akibat pembangunandari sektor industri, pertambangan,
perkebunan,pertaniandan lain-lain, maka diperlukan wawasan dan kajian
dengan memperhitungkan dampak terhadap kesehatan yang dapat
diakibatkan oleh adanya polusi udara, air dan tanah serta perubahan
lingkunganyang ditimbulkanoleh pembangunanitu sendiri-
b) Profesionalisme.Sumber daya manusia yang handal, terampil dan sesuai
dengan profesionalisme diikuti dengan meningkatnya kemampuan
manajemendaerah dan intensifikasiprogram kesehatanyang didukung
dengan perbaikan sistem surueilansyang mantap. Untuk memberikan
petayanan kesehatanyang prima, maka setiap tenaga kesehatanharus
profesional dan memahami bidang tugasnya secarateknis sesuaidengan
keahlianmasing-masing.
c) Otonomi daerah. Penerapan otonomi daerah membuka peluang
pembangunankesehatanmenjadi wewenang dan tanggungiawabdaerah,
sehinggamanajemenkesehatandapat disukungoleh pendanaanyang lebih
besarsesuaidengankemampuandaerah.
kepadabadan legislatifdan advokasikepada
Sosialisasi
d) Sosialisasi/Advokasi.
pemerintah daerah diperlukan untuk mensosialisasikanprogram
bidangkesehatan.
desentralisasi
masyarakatmelalui Upaya KesehatanBersamaMasyarakat
e) Pemberdayaan
(UKBM), setiap kegiatan bila bersumber dari masyarakatdan untuk

H a l3 - 2 3
Rercanafunfungtun rrarrgka
P a t f i r yO a q a h f f i l 0 2 8

masyarakatakan berjalan dengan baik dan berkesinambunganjika ada


kerjasamajuga dengan matyarakat. Hal ini dapat dilihat melalui kegiatan
RevitalisasiPosyandudan PHBSsertapembiayaankesehatansecaramandiri
melaluiJaminanPemeliharaanKesehatanMasyarakat.
0 Koordinasi lintas program dan meningkatkanmeningkatkankemitraan di
segalasektor. Untuk meningkatkanefektivitas dan efisiensi,maka sangat
diperlukan koordinasilintas program yang didukung oleh lintas sektoratau
pihak swastasecaraberkesinambungan.
g) Standarimsi pelayanan kesehatan. Guna meniamin mutu pelayanan
kesehatan,maka diperlukan standarisasipelayanan kesehatan,sehingga
petugasmempunyai pedoman dalam menialankankegiatannyayang dapat
secaraprofesional-
dipertanggungiawabkan
h) Dukungandari PemerintahDaerah dan DPRD merupakan modal dasar
dalam pembangunanbidang kesehatan.
i) Perkembanganteknologi informasi memudahkan petugas dalam sistem
pencatatandan pelaporandalam waktu yang cepatdan tingkat keakuratan
yang tinggi.
BerdasarkanRencanaStrategisdiatas, maka pembangunan kesehatan
masyarakatdiarahkan pada dukungan kebijakan dan bantuan dalam uPaya
peningkatanpemerataan,keterjangkauandan mutu pelayanankesehatanserta
pemenuhangizi masyarakatterutama bagi masyarakatmiskin dan masyarakat
rentan lainnya termasukibu hamildan menyusui,bayi/balitaserta penduduk
pedesaan. Untuk itu prioritas sektor ini diarahkan pada peningkatan
lingkungansehat, upaya kesehatanmasyarakat/perorangan,pencegahandan

pemberantasanpenyakit dan perbaikangizi masyarakat.Upaya tersebutjuga


perlu didukung dengan peningkatanpromosi kesehatandan pemberdayaan
kesehatan disertai dengan peningkatan mutu dan pemerataan tenaga
kesehatan serta manajemen pembangunan kesehatan termasuk sistem

Hal3 - 24
Rercam MngwPnlarrgka
Patfing Oa€nh 2O6-n25

pengembangan informasi kesehatan dan perintisan/Penguatanbidang


penelitiandan pengembangan
kesehatan
Dalammewujudkanpeningkatanmaryarakatagar menjadilebih baik,
maka arah kebijakanyang diambil pemerintahuntuk meniawabtantangan
dalamkurunwaktu 2Otahunke depanadalah:
pelayanankesehatan
I Meningkatkan yangbermutu,meratadan terjangkau;
$ Komitmenbersamaaparaturnegaradan masyarakatuntuk mewujudkan
Sehat;
Banyuasin
I Membukapeluangbagi tenagakesehatanuntuk melanjutkanpendidikan
berjenjang;
I Pengadaanobat dan melengkanialat-alat kesehatandi tetiap fasilitas
secarabertahap;
kesehatan
$ Pembangunan RumahSakitDaerah,LaboratoriumDaerah,pengembangan
saranadan prasarana
dan rehabilitasi kesehatan;
I yangberwawasan
pembangunan
Komitmenuntukmewujudkan kesehatan;
I Pencegahan penyakityangterjadidi masyarakat;
dan pemberantasan
kualitaslingkungan;
b Meningkatkan
ibu, anakdan paralanjutusia;
upayakesehatan
I Meningkatkan
statusgizi masyarakat;
$ Meningkatkan
$ Membudayakan perilakuhidupbersihdan sehat;
S Kemitraandenganberbagaipihakdi bidangkesehatan.

D PENINGKATANKUALITASPENDIDIIGNDAN SUMBERDAYAMANU'IA

Pembangunansektor pendidikandi masa mendatangdiarahkanpada


dukungan kebijakan untuk peningkatankualitas dan relevansipendidikan
dengan tetap memberikanperhatianterhadap pemerataanpendidikanpada

H a l3 - 2 5
RercaW fuofuquwtJarvlo
Patfttg OaenhmeZr2s

remuajenis,jalur dan jenjang pendidikandenganmemPerhatikanpemerataan,


keadilan dan kesetaraangender rerta kemudahanaksespendidikan terutama
kelompok masyarakat miskin dan berpenghasilan rendah. Upaya yang
dilakukan melalui dukungan penyediaan rarana dan prasaranapendidikan,
tenaga kependidikan yang lebih merata dan berkualitas, pengembangan
kurikulum dan bahan pelajaran, serta model pembelanjaran yang lebig
mengacu pada standar nasional dan internasional sesuai dengan

perkembanganilmu pengetahuandan teknologi, budaya dan seni. Selainitu'


peningkatan kualitas, kompetensi dan profesionalisme pendidik'

pengembanganbudaya baca dan pembinaan perPustakaandidukung oleh


kegiatan penelitian dan pengembangan pendidikan serta pengembangan
manajemenpelayananPendidikan-
Adapun arah kebijakanyang dapat ditempuhpemerintahantaralain :
Ci Meningkatkan angka partisipasi sekolah bagi penduduk usia sekolah
khususnyapadajeniangSMPmaupunSMA sederaiat;
O Menurunkanangka putus sekolahbagi penduduk usia sekolahkhususnya
bagi anak usiasekolahdasar;
6l Meningkatkandan melakukanperluasanpendidikananak usia dini dalam
rangkamengembangkan dan daya kreasi;
sikap,nilai-nilai,pengetahuan
.O Meningkatkankualitassumberdaya manusiayang memiliki jati diri dan

kemampuanpenguasaanilmu pengetahuandan teknologi sesuaidengan


tuntutan pasarpadasemuajenjangpendidikan;
4, penyediaansarana dan prasaranapendidikan agar protes belajar dan
mengajardapat berjalandenganbaik;
dr Meningkatkan kualitas tenaga pendidik yang memiliki kompetensidan
inovasi dalam pengembanSanpembelajaranyang berstandarnasional
maupuninternasional;
tenagapendidik itu sendiri;
o Peningkatankesejahteraan

Hal3 - 26
Rencanafuttfuttgmaa Jangln
Patfitg Qacahffi2025

yang lebih
o Bahan pelajarandan kurikulum serta model pembelaiaran
efektifdan efisien;
budayabacadan pembinaanperpustakaan sertadidukung
o Pengembangan
yang diikuti
oleh kegiatan penelitian dan pengembanganpendidikan
denganpengembangan manajemenpelayananpendidikan;

D PENINGIGTAN DAN PENGEMBANGANPARIWISATA

yang diambil
Untuk mengatasitantangantersebut' maka arah kebijakan
pariwisata ini
pemerintah dalam mengembangkansektor kebudayaan dan
adalahsebagaiberikut
,* Mengernbangkansektor pariwisata dengan pendekatansistemyang utuh

dan terpadu untuk meningkatkandaya tarik objek wisata ;


,* Mengembangkan objek wisata dan meningkatkan promosi serta
pemasaran,baik di dalam maupun di luar negeridengan memanfaatkan
kerjasamakepariwisataanregionalsecaraoptimal
.r Meningkatkan kualitas sumber daya manusia di bidang kepariwisataan

untuk mendukungProgramSaptaPesona;
yang berwawasanlingkungan berdasarkan
.g Mewujudkan pariwisata sehat
global untuk
pada budaya dan kearifan lokal agar memiliki daya saing
meningkatkankeseiahteraanmasyarakatKabupatenBanyuasin;.
* Mengembangkan kebudayaandaerahmelaluipelestariandan perlindungan
harkat dan
nilai-nilailuhur untuk memperkuatjati diri, meningkatkan
martabatsertakepribadianbangsa;
b Meningkatkan kemampuan masyarakatdalam menggali nilai-nilai luhur
yang berasaldari luar
budaya daerah dan menerima nilai-nilai positif

Hal3 - 27
Rercamhtfutvtumn,taryfrs
PadaryOacnhZlXrffi2S

karya, cipta, rasadan karsauntuk memperkaya


melalui pengembangan
budayabangsa;
Melestarikannilai-nilaibudaya serta peninggalanteiarah dan purbakala
termasukkawasancagar budaya, sistemnilai dan norma-normayang
sertarnengembangkan
berlakudalam masyarakat keseniantradisionaldan
kreasibaruubtukmenunjangsektorpariwisata;
Mengembangkan industri pariwisata yang diintegrasikan dengan
sektorpendukungnya;
pengembangan
Mengembangkansektor kepariwisataan yang lebih diprioritaskanpada
objek wisata yang potensialseperti wisata sungai,agrowisata,wisata
budayadan wisataalamlainnyayangadadi KabupatenBanyuasiq
Mengembangkan industri kepariwisataan dengan mengacu pada
ekonomi masyarakatmelaluipengembangan
pemberdayaan industrikecit
kerajinantangan(handycraft)dan cinderamata.
yangmenghasilkan

D PENINGKATANSEKTORKEAGAMAAN

Pembangunansektor keagamaandiarahkan pada upaya peningkatan


saranadan prasaranakeagamaanyang diharapkannantinyadapat mendorong
masyarakatuntuk semakin giat dan bergairah dalam menjalankan serta
dlam uPayapemerintahuntuk
mengamalkanaiaranagamanyamasing-masing
membentuk masyarakatyang lebih bermoral dan berakhlak mulia, maka
pemerintahmengambilkebijakandi sektorkeagamaanini antara lain sebagai
berikut :
$ Peningkatanwawasan saling menghargaiantar pemeluk agama,sehingga
tetap tercipta hubungan yang sinergis antar umat beragama dalam
memperkuatkerukunanhidup beragamdi KabupatenBanyuasin;

Hal3-28
RercatP PenMtrgman Jary*a
Pat&ry Oaenh2OOegX?5

s Meningkatkankualitassaranadan prasaranaPeribadatan;
pelayanandan mutu pendidikanagama;
I Peningkatan
s Memantapkanfungsidan peranagamasebagailandasanmoral' spiritual
dan bernegara;
dan etikadalamkehidupanindividu'bermasyarakat
Meningkatkankerukunanhidup beragamadan mengembangkan sikap

toleransidalamkehidupanberagama;
untuk kesejahteraan
s Meningkatkanperan dan fungsilembagakeagamaan
umat beragama.

D PEMBANGUNANPOLITIK HUKUM DAN HAM

Demi memantapkanstabilitaskeamanandan ketertiban di masyarakat,


yang diambil
maka untuk sektor politik, hukum dan HAM kebijakan
pemerintahke depan adalah sebagaiberikut :
# Mempertahankankeberadaandan kelangsungan NegaraKesatuanRepublik

lndonesiaberdasarkanPancasila dan UUD 1945yang bertumpu pada ke-

BhinekaTunggat lka-an serta membangunwatak dan perilaku masyarakat


yang dinamisdan demokratis;
prinsip demokrasi
$ Meningkatkanetika dan morat berpolitik sesuaidengan
Pancasilaserta menjunjung tinggi nilai-nilai hak asasi manusia dalam
kehidupanbermasyarakat,berbangsadan bernegara;
menyerap'
$ Meningkatkan kemandirian dan fungsi partai politik dalam
menyampaikan dan memperjuangkan aspirasi rakyat dengan
sikapbijaksanadan menjunjungtinggietika demokrasi;
mengembangkan
s Meniarnin adanyakepastianhukum bagi mayarakat;

H a l3 - 2 9
Rercam hnbrynnnnJary*a
PadangOaenh 2O6'm4,

.$ Mevuujudkan kebebasan media massa, benkumput, berserikat dan


dan
menyatakan PendaPatsetiap warSa masyarakatsecaraterbuka
bertanggungiawab;
dengan
s Memberikanperlindungandan penghormatanterhadap HAM
tidak bersikaPdiskriminatif;
peransertaaktif
s MelakukanupayaterpaduyanSlebih banyakmelibatkan
masyarakatdalam memeliharadan menjagakeamanandan ketertiban
yangbenar-benar
masyarakat kebutuhanmasyarakat'
dapatmencerminkan

DPEMBANGUNANPERUMAHANDANPERMUKIMAN

diatas
Arah kebijakanyang akan dilakukanterkait dengan permasalahan
adalahsebagaiberikut :
* Meningkatkan penyediaan rumah bagi masyarakatyang berpenghasilan
rendah;
di
* Meningkatkan kualitas pelayanan sarana dan Prasaranalingkungan
kawasanpermukimanPenduduk;
* Menciptakanpota subsidibaru yanS lebih tepat sasaran;
* Melakukan revitalisasi kawasan permukiman yang mengalami

nan kualitas;
degradasi/Penuru
pembangunan
* Memantapkan fungsi kelembagaanyanS menyelenggarakan
perumahan.

H a l3 - 3 0
RencanaknfuWuPn,tat&t
Pat*ng Oaenh 2U6'2UE

D PENYEDIMN SARANAAIR BERSIH'IRIGASIDAN DRAINASE

Di sektor penyediaanair bersih, saluranirigasi dan penataandrainase,


kebijakanyang diambil pemerintahadalah :
air
4> Melakukan penataansistemdrainaseagar tidak menimbulkangenangan
aktivitasmasyarakat;
yang dapat menSSanggu
c) Meningkatkanpenataandan normalisasisalurandrainase;
4) optimalisasisaranadan prasaranayan8 ada denganmenyediakananSSaran
biaya operasionaldan pemeliharaanyang memadai;
4, Meningkatkan pelayanan dan penyediaan kapasitasair bersih ke semua
wilayah agardapat dinikmatioleh semualapisanmasyarakat;
O Meningkatk3n pelayananair minum melalui pembangunansarana dan
pipa
prararana air minum seperti water intakq water threatmenf dan
distribusi:
4' Menggalangkemitraanantara pemerintahdan swastauntuk membangun
saranadan prasaranayang berkaitandengan penyediaanair bersih'saluran
irigasidan drainase;
4' optimalisasi pemanfaatanbantuan baik dari pemerintah pusat mauPun
asing.

D PENINGIGTAN TMNSPORTASIDARAT

Untuk mengatasimasalahinfrastrukturjalan dan jembatan,pemerintah


beberapaarah kebijakan,antaralain :
telah mempersiapkan
||) Mendukung pengembangansaranatransportasijalan dan jembatan yang
transportasiumum massal'
efisiendan berkelanjutanterhadappenSSunaan
Selain itu mendukung pengembangan teansportasi terutama untuk
pembangunankawasanTanjungApi-api;

Hal3-31
Rercqp PanfutgpttPtt rtsrgkt
Pat&WDsahM25

Meningkatkankondisipelayananjalan dan iembatanmelaluipenanganan


kelebihanmuatansecarakomprehensifdenganmelibatkaninstansiterkait;
jembatan melalui
Meningkatkan keselamatanlalu lintas jalan dan
pencegahan, pembinaan,penegakanhukum' sisteminformasilalu lintas'
kelaikanJaranadan prasarana,peningkatandisiplin para penSSunaialan
dan jembatandan lain-lain;
jalan terhadap
Meningkatkan dukungan pelayanan transportasi
wilaYah;
pengembangan
jaringanjalan dan iembatandalammenunjang
Meningkatkanpenanganan
unggulan:
sektor-sektor
dalampelaksanaan
Meningkatkanprofesionalisme pembangunan di bidang
padakualitaspekeriaan;
jalan danjembatanyangberorientasi
dalammelakukan
duniausahamauPunmasyarakat
Mendorongpartisipasi
danPembinaan
pemeliharaan ialan;

AIR/SUNGAI
t PENINGKATANTRANSPORTASI

Terkait dengan luasnya wilayah perairan di Kabupaten Banyuasin


mobilitas orang dan barang sangat dipengaruhi oleh kelancaran sarana
transportasiperairan.Untuk menghubungkan
transportasikhususnya beberapa

witayah di KabupatenBanyuasinyanS tidak dapat dilayani oleh transportasi


fisik dasaryang memerlukaninvestasicukup besar
darat, dikarenakan.kondisi
yang
dan belum sebandingdengan manfaatyang diperoleh.Arah kebijakan
ditempuhpemerintahterkait hal ini adalah:
* Menciptakan keterpaduan daklam penyediaan transportasi airlsungai
terhadapwilayah-wilayahyang akandikembangkan;

H a l3 - 3 2
RetrcamMnhngumn,tangrn
Pat&ryDaenhn em2i

saranadan prasarana
Meningkatkanefektivitasdan efisiensipemeliharaan
airAungai;
transportasi
Meningkatkanperan serta swasta dan masyarakatdalam penyediaan
infrastrukturyang didukung dengan kemudahandalam perizinanserta
advicepembangunannya;

D PENINGIGTAN SARANAKEUSTRII(AN

Arah kebijakan yang ditempuh pemerintah dalam usaha penyediaan


raranakelistrikanadalah:
o Meningkatkankehandalansistemketenagalistrikan;
O Meningkatkanjaringantransmisidan distribusiketenagalistrikan;
g Memperhatikankelestarianlingkunganterutama dampak fisik-kimiadan

sosiatdalam setiap tahap kegiatan operasi tenaga listrik, karena hal ini
berpotensi untuk memberikan dampak negatif terhadap lingkungan bila
tidak dikeloladenganbaik;
O Meningkatkan program Dernand Side Management melalui perbaikan
faktor beban untuk mendistribusikanbeban tenagalistrik agar lebih merata
dan dapat meniangkausemuawilayah;
g Meningkatkan Supply Side Management terutama dengan memperbaiki

kinerjapembangkitandan transmisisertadistribusitenagalistrik;

>r PENINGIGTANSAMNA TELEKOMUNIKASI

Mengingatsaranatelekomunikasijuga merupakanhal yang sangatvital


dalam meningkatkan pertumbuhan perekonomian masyarakat, maka
juga tidak luput dari perhatianpemerintah.
peningkatansaranatelekomunikasi

rF H a l3 - 3 3
RercaM Pembngr*lcrt rtstgrQ
' Pat{angfuenhmffi!,

Oleh karena itu, kebijakan yang ditempuh ke depannya adalah


berikut:
sebagai
saranatelekomunikasi
* Tersedianya seluruhwilayah
yangdapat menjangkau
Banyuasin;
Kabupaten
r) Tercapainyasaranatelekomunikasiyang efektif.efisiendan terjangkaudari
segibiayaoleh semualapisanmasyarakat;

D PEMANTAPANDAN PENINGIGTAN APARATURPEMERINTAHAN

sei.akdilaksanakanatas kedua undang-undangotonomi daerah yang


berlaku efektif mulai Januari 2OOt dan terbentuknya lkbupaten Banyuasin
hasil pemekaran dari Kabupaten Musi Banyuasin maka masih banyak
ditemukan permasalahanyang dihadapi oleh aparatur PemerintahDaerah
Banyuasin.Hal tersebutterkait dengan tingginya kompleksitaspermasalahan
dalam mencarisolusiperbaikandan masih lemahnyatata pemerintahandan
pengawasanterhadapkinerja aparatur pemerintahdaerah-
Banyaknya permasalahan birokrasi pernerintah daerah belum
sepenuhnyateratasi baik secarainternal maupun eksternal.Dari sisi internal
telah membawa dampak pada proses
faktor demokratisasidan desentralisasi
pengambilankeputusankebijakanpublik dan tuntutan penerapanprinsiptata
pemerintahanyang baik yaitu transparansi,akuntabilitasdan kualitaskineria
publik serta taat kepada hukum. Selain itu juga masih rendahnya kinerja
sumberdaya manusia dan kelembagaan aparatur sistem organisasidan
masih rendahnya efisiensidan efektifitaskerja, rendahnya
ketatalaksanaan,
kualitaspelayananumum.
Dari sisieksternalfaktor perubahantata pemerintahandan pelaksanaan
demokrasi, perubahan paradigma pembangunanserta perubahanteknologi

H a l3 - 3 4
Rercam Penfungu*anJarlca
PadangDaenh meZA$

informasi recara cepat meruPakan tantangan tersendiri dalam uPaya


menciptakan pemerintahan yang bersih' baik dan benpibawa' Tujuan
reformasi birokrasi di lGbupaten Banyuasinyang menyangkut perubahan-
perubahanpentingyang harusdilaksanakandan dipersiapkanagar masyarakat
dapat menangkaprancanganbirokrasi macam aPa yang ingin dibangun untuk
menciptakan layanan pemerintah kepada ma5yarakatnyadengan baik agar
mampu menciptakan ruang gerak interaksi.antar individu dalam aspek
ekonomi, sosial,kebudayaandan politik.
Dalam upaya meuruiudkan dan mencapai sasaran pembangunan
penyelenggaraanpemerintah daerah dalam mewujudkan tata pemerintahan
yang be.rsihdan berwibawa, kebijakanyang ditempuh antara lain :
l) Mengembangkan fungsi dan peran serta tanggung iawab aparatur
pemerintah dalam peningkatan mutu jasa pelayanan publik melalui
kerangka tata kelola pemerintahan yang baik berdasarkankevvenangan
yangdimiliki;
2) Menstimulasiberkembangnyadinamika politik lokal dan transformasisosial
untuk mendorong proses demokratisasiyang beradap dan bertanggung
jawab;
3) Mendorong penegakkanhukum secarakonsistendan berkeadilankepada
masyarakat,aparatur pemerintah dan penegak hukum' untuk menjamin
hukum dan
kepastian hukum, rasa keadilan masyarakat,supremasi
menghargaiHAM melalui pengembanSanbudayahukum di semualapisan

masyarakat;
4) Memantapkan pelakasanaan otonomi daerah dengan rnelakukan
sinkronisasi perencanaan dan koordinasi pelaksanaan program
pembangunan antar witayah dan keserasian dan pemerataan

pembangunan.

H a l3 - 3 5
RetwmMttgwwt,tqvrQ
PatfiryDnahNOA2S

3.4. TAHAPAN DAN SIa\IA PRIORITASPEMBANGUNAN KABUPATEN


BANYUASIN
Untukmen@pai pokoksebagaimana
sasaran dimaksud di atas,pembangunan
iangka
tahapandanskalaprioritasyangakanmeniadiagenda
panjangmembutuhkan dalam
yang
rencana pembangunan jangka menengah. Tahapan dan skala prioritas
ditetapkan mencerminkanurgensi permasalahanyang hendak diselesaikan,tanpa
mengabaikanpermasalahanlainnya. Oleh karena itu, tekanan skala prioritas dalam
periode
setiap tahapan berbeda-beda,tetapi semuaitu harus berkesinambungandari
ke periode berikutnya dalam rangka merrujudkan sasaran pokok pembangunan
misi pembangunanjangka panjang
fangka paniang.Setiapsasaranpokok dalam lima
dapat ditetapkanprioritasnyadalam masing-masingtahapan. Prioritasmasing-masing

misi dapat diperaskembatimenjadi prioritas utama. Prioritasutama menggambarkan


skala
makna strategisdan urgensipermasalahan.Atas dasar tersebut,tahapan dan
prioritasutama dapat disusunsebagaiberikut'

3.4.|.RPJM ke-l (2o05 - 2oo8)

melalui
Tahapanpembangunantahap pertamadi KabupatenBanyuasindilaksanakan
No I tahun
RPJMlGbupaten Banyuasin(2005-2008) yang ditetapkanmelalui Perda
I dan
2go5.RenstraKabupatenBanyuasinyang dapat dikatakansebagaiRPJMtahap
pemantapan
diarahkan kepada Penyiapan infrastruktur dasar bagi masyarakat,
pemerintahan'sertamempertahankanswasembadapangan'
penyelenggaraan

3.4.2 RPJMke-2 (20O9- 2Ol3)


Berlandaskanpelaksanaan,pencapaian,dan sebagaikebertanjutanRPJM ke-l' RPJM
ke-2 ditujukanuntuk peningkatankualitaspelayanandatar, peningkatantata kelola
pemerintahanyang akuntabel serta pemberdayaanmasyarakatdan melanjutkan
pembangunani nfrastruktur pembukaketerisolasian wi layah.

H a l3 - 3 6
Renam Penfugrnnn rtsrrgra
Pat&tAOaenhWm25

3.4.3RPJMke-3(2014- 2018)
Berlandaskan pencapaian,dan sebagaikeberlaniutanRPJMke-2' RPJM
pelaksanaan,
pembangunan
ke-3ditujukanuntuk Percepatan ekonomiberbasis sumberdaya lokal,
memacupembangunandan pengembangan industri , perdagangandan iasa serta
pelayanandasaryangmakinluasdan berkualitas.
peningkatan
.rertamelakukan
3.4.4 RPJMke-4 (2019-2023)
pelaksanaan,
Berlandaskan pencapaian, RPJMke-3,RPJM
dan sebagaikeberlanjutan
ke-4 ditujukan uniuk Penguatanpembangunanperekonomianyang maju dan
berdaya saing berdasarkankeunggulankoparatif, serta membangunkeriasama
sertalebih memantapkanpembangunan
regionalyang salingmenguntungkan tecara
menyeluruhdi berbagai bidang dengan menekankanpencapaiandaya saing
kompetitifperekonomianberlandaskankeunggulansumberdaya alam dan sumber
daya manusia berkualitas serta kemampuan ilmu dan teknologi yang terus
meningkat.'$t.uktur"perekonomianmakin maju dan kokoh dengan daya saing
perekonomian yang kompetitif dan berkembangnya keterpaduan antar
perekonomiansudahtersusun,tertat serta berfungsidenganbaik.
sektor.Lembaga
Pertumbuhanekonomi yang semakinberkualitasdan berkesinambungan dapat
dicapaisehinggapendapatanperkapitapada tahun 2023 mencapaikesejahteraan,
dan pendudukmiskinsemakinrendah-
tingkatpengangguran

H a l3 - 3 7
RencanaPembangunan
JangkaPaniangDaerah
Tahun2OO5- 2025

Babini berisi tentangharapan-


harapan terhadappembangunan
di KabupatenBanyuasinagar
tetap beradadalam koridor
yang ditentukan dalam RPJP
DaerahKabupatenBanyuasin
Tahun2006-2O25ini
t:

Penutu
'r:i
iii
i
lx
jj
i'l

$i.
l iliti',-;rii..!ir - :i :+':.

JangkaPanjangKabupatenBanyuasin
encanaPembangunan
merupakan arah dan pedoman bagi penyelenSSaraan
Daerah dan seluruh
PemerintahDaerah, Lembaga-lembaga
masyarakat Kabupaten Banyuasin. Kondisi dinamis yang menunjang
tanpa
harusdibina bersamaoleh semuakomponenPembangunan,
percepatan
terpancingdan terjebak pada primordialismedan egoismekesukuanyang
terkotak-kotak.Para pemimpin pemerintahanharus berlapanghati untuk
mengutamakankoordinasidan sinergi,dimana untuk maksud itu Peran
manajerialdari pucuk pimpinan merupakan hal yang sangat vital dan
ke depanyanSbenar-benar
dibarengidengankonseppembangunan strategis.
KabupatenBanyuasinmemilikipotensiekonomi dan sumberdaya alm
dan
yang besar dan secaranyata dapat mengangkatharkat kesejahteraan
Upayayang terencanauntuk melengkapisarana
kemakmuranmasyarakatnya.
dan prasaranadasar harus lebih dipercepatlagi. Hambatanyang menjadi
kendalaperkembanganindustriyang berbasisagribisnisatau yang menjadi
sektorunggulandaerahharussegeradiatasi.Oleh karenaitu, dalam rangka
pelaksanaanRencanaPembangunanJangka PanjangKabupatenBanyuasin,
maka :
di daerahberkewajibanmenjalankan
l) Bupati selakuKepalaPemerintahan
tugas penyelenggaraanpemerintahandaerah dan mengerahkansemua
RetrcamPenfu tgrnnn Jaryka
PadaW Daenh2qte2t6

potensi dan kekuatan pemerintahan dalam melakanakan dan

mengendalikanpembangunandaerah;
2) Dewan PerwakilanRakyat Daerahdan Pem€rintahDaerahserta Lembaga-
lembaga Daerah lainnya baik pemerintatr mauPun swasta berkeurajiban
melaksanakan Rencana Pembangunan Jangka Panjang ?Gbupaten
Banyuasinsesuaidengan tugas, fungsi dan wewenangnya berdasarkan
Pancasiladan Undang-undangDasar1945:
3) Rencari6"Pembangunan Jangka Paniang lGbupaten Banyuasin dalam
petaksanaannya dituangkan dalam Rencana Pembangunan Jangka
Menengah (RPJM) Daerah yang berupa RencanaPembangunanDaerah
Lima Tahun yang memuat uraian kebijakan secaraterperinci dan terukur
sertayang ditetapkandengan KeputusanKepalaDaerah;
4) Rencana PembangunanJangka Menengah Daerah dijabarkan dalam
Rencana Kerja Pemerintah Daerah (RKPD) yang memuat Anggaran
Pendapatandan BelanjaDaerah(APBD)dan ditetapkandengan Keputusan
KepalaDaerah
5) Rencana PembangunanJangka Panjang Kabupaten BanyuasinTahun
2006 - 2025 berlakusejakditetapkan;
6) Keberhasilanpelaksanaanpenyelenggaraanpemerintahanuntuk mencapai
visi dan misi bergantung pada peran aktif masyarakatserta pada sikap
mental, tekad, semangat, ketaatan dan disiplin para penyelenggara
pemerintahan;
tanggungjawab dan demi makin kokohnyapersatuan
7) Dalammelaksanakan
dan kesatuanbangsa,perlu dikembangkanperan aktif masyarakatdalam
JangkaPanjangKabupatenBanyuasin
menyiapkanRencanaPembangunan
pada masayang akandatang;

Hal4 - 2
Roncana Pqnfu ngunan Ja ng*a
PanJangDaenh 2N6-2025

Hasil pembangunanharusdapat dinikmati Jecaralebih merata dan adil


oleh segenapwarga masyarakatdalam uPayameningkatkantaraf hidup
lahir dan bathin dalam suatanayang demokratis,
dan kesejahteraan
tentram,amandan damai.

Balai,
Pangkalan 2008

BUPATI BANYUASIN,

UDDIN INOED

ii
if,
H a l4 - 3
RencanaPembangunan
JangkaPaniangDaerah
Tahun2006 - 2025
Tabel Lampiran- I

JenisPadi,LuasPanendan Total ProduksiPadiMenurutKecamatan


di KabupatenBanyuasin
Tahun2002

JenisPadi
Padi Sawah Total
No lGcamatan Padi tadang Produki
PasangSurut Sonor l€bak Tadah Huian CIon)
LuasPanen Produksi LuaePanen hodukl LuasPanen PrcauUi luas Panen Produl<si LuasPanen Produksi
(Ha) (Ion) (Ha) (Ion) (Ha) Cro) (Ha) CIon) (Ha) (Ion)
1 RantauBayur 1 1 . 1 9 2 . 0 25.909.O 325.O 605.0 26,514.O
2 Betung 102.0 303.0 450.0 846.O 1,149.O
3 Banyuasin
lll
4 PulauRimau 32.555.O 115.989.2 r,409.0 4,579.O 430.0 r.505.0 2,037.O 2,526.O 124.599.2
5 TalangKelapa 7,175.O 33,973.5 33.973.6
6 Banyuasin
I
7 Rambutan 15,700.0 45,257.O 12.204.O 42.409.O 87.666.0
8 MuaraPadang
9 Banyuasin
ll
l0 MakartiJaya 12.899.O 59.335.4 59.335.4
lt MuaraTelang 30.r30.0 122.930.4 122.930.4
Jumlah 98.459.O 377.485.6 24.W7.O 73,200.O 430.0 r.505.0 2.812.O 3,977.O 456.167.6
lumber: BanyuasinDalam Angka 2OO2

L- t
Tabel Lampiran- 2

JenisPadi,LuasPanendan Total ProduksiPadiMenurutKecamatan


di KabupatenBanyuasin
Iahun 2003

JenisPadi
Padi Sawah Total
No Kecamatan Padi Ladarg Produki'
Pasans
Surut Sonor Lebak Tadah {uian (Ion)
luas Panen Produkri LuasPanen Produkri LuasPanen Produksi Luar Panen Produksi luas Panm Prod*si
(Ha) Gon) (Ha) (Ion) (Ha) Gon) (Ha) Fon) (Ha) Gon)
I RantauBayur il,365.O37,504.0 84.O 235.O 37.740.0
2 Betung 350.0 I,l55.O 260.O 858.0 2,013.O
3 Banyuasin
lll 598.0 1,973.O l.ll9.o 3.693.O 89.0 276.O 5,942.O
4 PulauRimau 23.635.O 78.204,5 525.O 1,732.O 79.936.s
5 TalangKelapa 5.985.0 24.170.6 24,170.6
6 Banyuasin
I 6.750.0 22.475.O 3,430.0 11,319.0 33,794.O
7 Rambutan 5,160.0 17.O28.O 200.0 680.0 17,708.0
I MuaraPadang 26.368.O 89,015.5 89.016.6
9 Banyuasin
ll 32.539.0
9,860.0 32.539.O
l0 MakartiJaya 13,137.O 39.8r9.0 39.819.0
ll MuaraTelang 2 1 . 1 1 9 . 0 69.695.9 69,695.9
Jumlah t08,802.0 359.048.6 21,334.0 70.&2.O 898.0 2,924.O 432,374.6
Sumfur: BanyuasinDalam Angka 2N3

L-2
Tabel Lampiran- 3

JenisPadi,LuasPanendan Total ProduksiPadiMenurutKecamatan


di KabupatenBanyuasin
Iahun 2004

JenisPadi
Padi Sawah Total
No l(ecamatan Padi Ladang Produki
PasangSurut Sonor t€bak Tadah Juian CIon)
luas Panen Produksi luas Panen Produkri LuasPanen Produlsi lrraS P41gn Produksi LuasPanen Pnoctrtcl
(Ha) Gon) (Ha) (fon) (Ha) Fon) (Ha) Gon) (Ha) fron)
I RantauBayur 15.585.053,O72.0 53.O72.O
2 Betung 320.O 1,O24.O 455.O 1,456.0 400.0 r,280.0 3,760.O
3 Banyuasin
lll 920.O 2.994.O 3.665.O il,695.0 r4.690.0
4 PulauRimau 25.088.0 92,82s.6 414.O r,53r.B 94.357.4
5 TalangKelapa 7.172.0 26.628.2 t7.o 63.1 26,691.3
6 Banyuasin
I 4,148.O
'ts.062.4
4,297.O 15.469.2 2.612.O 9.403.2 39.934.8
7 Rambutan 5.175.O17,262.5 658.0 2,194.9 225.O 750.5 20,207.9
I MuaraPadang 27,118.0 98.980.7 98.980.7
9 Banyuasin
ll r0.400.0 35.350.0 35.360.0
10 MakartiJaya r 3 . 3 8 7 . 0 49,531.9 2.650.O 9.805.0 s9.336.9
ll MuaraTelang 27.535.0 99.486.O 210.0 756.O 100.242.O
Jumlah n6.r88.0 421.892.8 2,877.O 1o.624.1 30.177.O 98,955.7 3.270.O 11,598.1 I,039.0 3,562.3 5#,633.O
Sumber : BanyuasinDalam Angka 2O04

L-3
Tabel Lampiran- 4

di KabupatenBanyuasin
JenisPadi,LuasPanendan Total ProduksiPadiMenurutKecamatan
Tahun2005

JenisPadi
Padi Sawah Total
No lkcamatan Padi Ladang Produksi
Pasang
Surut Sonor Lebak Tadah Huian CIon)
LuasPanen Produksi luas Panen Prodr*si LuasPanen Produkii luar Panen Produkri Luar Panen Produki
(Ha) fim) (Ha) (Iott) (Ha) (ton) (Ha) (Ion) (Ha) ffon)

I RantauBayur r7.350.0 65.930.0 39.O 148.2 66.O78.2


2 Betung 3r0.0 l.t78.o 470.O 1,786.O 450.O l,7t0.o 4,674.O
3 Banyuasin
lll 983.0 3.735.4 3,655.O 13.889.0 487.O r,850.5 19,475.O
4 PulauRimau 22.363.O 84,979.4 1 . 5 7 5 . O 5.98s.0 171.O 649.8 91,614.2
5 TalangKelapa 7,194.0 27,337.2 45.0 171.O 27,508.2
6 I
Banyuasin 6,850.0 26,030.0 3.956.0 15,O32.8 r,353.0 5.179.4 46,242.2
7 Rambutan 4,948.O 18.802.4 347.O 1.322.1 341.O 1,295.8 21,420.3
I MuaraPadang 28.676.O 108.958.8 r08.958.8
9 ll
Banyuasin 10,394.O 39.497.2 39.497.2
to MakartiJaya 15,759.O 59.922.2 500.0 1.900.0 61,822.2
ll MuaraTelang 25.415.O 96,577.O 3,535.O 13.433.O 1r0,0r0.0
Jumlah 117,954.0 &8,22s.2 5,655.O 2r,489.0 30.379.0 fis,m.2 l,7lo.o 6,501.5 r,488.0 5,654.4 597,370.3
lumber: BanyuasinDalam Angka 2@5

L- 4
Tabel Lampiran- 5

JenisPadi,LuasPanendan Total ProduksiPadiMenurutKecamatan


di KabupatenBanyuasin
Iahun 2006

JenisPadi
Padi Sawah Total
No lGcamatan Padi Ladang
Pasanc
Surut Sonor tebak Tadah Huian
Produksi
Gon)
LuasPanen Produkii LuasPanen hoduksi LuasPanen Prodr&si LuasPanen Produkri lus Panen Produlsi
(Ha) [ron) (Ha) Fon) (Ha) (Ion) (Ha) (Ion) (Ha) Fon)

I RantauBayur r6,070.0 61,859.5 34.O r30.9 62.000.4


2 Betung 470.O 1,578.5 470.O r,809.5 450.O 1.733.0 5,121.0
3 B a n y u a s li lnl r.r80.0 4,543.O 3,271.O 12,593.4 29s.0 r , r3 5 . 8 18.272.2
4 PulauRimau 22,613.O 87,050.r il4.0 438.9 87.499.0
5 TalangKelapa 7,445.0 28,663.3 28.663.3
6 Banyuasin
I 5,984.O 23.038.4 4.294.O 16.358.7 39.397.1
Rambutan 5.1s7.0 19.454.5 34.0 130.9 19.585.4
8 Muara Padang 33.383.0 128,524.O 128,524.0
9 Banyuasin
ll r,400.0 4,890.0 4,890.0
t0 MakartiJaya r6.19s.0 62,350.8 62.350.8
ll MuaraTelang 29.440.0 il4,884.0 il4.884.0
12 Tungkalllir t
l3 TanjungLago*
14 *
MuaraSugihan
l5 Air Salek*

Jumlah il8,110.0 455,532.1 29,262.0 il2,085.6 927.O 3,569.5 571,187.2


lumber: RanyuasinDalam Angka 2OO5
Ket : t Datamasihtergabungdalamkecamatan
induk

L-5
Tabel lampiran - 6

LuasPanendan ProduksiTanaman
Palawijadi KabupatenBanyuasin
Tahun 2OO2- 2006

TAHUN
No
JenisTanaman 2@2 2@3 2W 2d)5 2W
Palawija Luas Luas Luas Luas [uas
Produksi Produki Produkl Produksi Produki
Panen Panen Panen Panen Panen
(Ha) fton) (ton) (ton) (Ion) (Ion)
(Ha) (Ha) (Ha) (Ha)
I Jagung 7.829.@ 26,710.4 r.146.00 9.871.00 3.039.00 1r.801.50 4.569.OO 17,123.50 5,350.00 20.873.OO
2. Ubi Kayu 9,913.00 122.191.96 1.654.OO 2r.502.OO 2.242.OO 29.6n4.A0 2,974.OO 33,22r.rO 2.653.OO 29.762.70
3. UbiJalar 251.00 66r.00
so9.00 5,318.84 2.192.O0 723.OO 8.097.r0 920.00 7.269.10 4.733.70
4. KacangTanah 447.OO 945.23
r03.00 561.30 331.00
1.789.00 3s8.00 588.80 376.@ 537.20
5. lGcang Kedelai 105.00 281.00
458.00 607.22 96.00 223.80 223.70 488.00 654.@ 211.00
6. KacangHijau r40.00
174.O1 54.00 70.00 r5r.00 139.r0 267.W 293.90 247.OO 267.40
Sumber: Dinas Pertanian dan PeternakanKabupaten Banyuasin

L-5
Tabel Lampiran - 7

Populasi
TernakMenurutJenisTernakBesardan Kecilper Kecamatan
di KabupatenBanyuasin
Tahun 2OO2- 2006

JenisTemak

No
TemakBesar TemakKecil
Kecamatan
Sapi Kerbau lGmbing Domba Babi
'02 '03 '04 '05 '06 '02 'o3 v '05 '06 'o2 'o3 'u o5 '06 !2 '03 '04 05 '06 '02 !3 1c4 'o5 '06

I Banyuasinlll 2,261 2.317 3.1993.485 4,876 166 t26 2 1 7 222 367 2,228 2,228 3.002 3.174 671 445 445 8s7 778 283
2 PulauRimau 822 822 2,O74 2.112 2,213 21 24 21 2.462 2.462 3,153 3,223 3,30r 215 215 69 6l 570 168 456 462 307
3 RantauBayur 63r 63r 1,057 I,O85 229 2.966 2,963 849 978 2.721 3,252 3,2s2
4 Betung 4,072 4.O72 3 . 3 5 73,374 3,245 4 44 206 160 1.599 1,597 1.520 r,586 1,595 5 150
5 440 363
5 TalangKelapa 2,392 2,392 1 . 5 8 8 991 987 93 93 27 2l 7.936 7.366 1,427 1,457 1,246 306 24 449 449 423 236
6 Banyuasinll 422 422 75 82 2o5 639 707 505 732 628
7 Muara Telang 533 s33 548 374 374 5,214 5,O14 1.164 r.t99 1,234 271 273 3l 49 194 26
I MakartiJaya 25 25 ll 635 4 4 6 535 535 r.oo81,O29 589 168 201 1 , 2 0 1,80
168 289 286 670 52s 286
5 5
9 BanyuasinI 1,237 1 , 2 3 7 1.484 1 . 7 1 8 1,765 258 258 5 3 , 2 2 53,225 2.524 2.547 3,il6 r68 171 76
lo Rambutan 892 892 r,986 2,0@ 3.063 781 1,29 I,ll I,l3
781 515 515 638 638 93 142 142 142 421 431
6 9 2
ll Muara Padang 3,084 3,084 2.996 2,813 2,650 t't4 n4 54 93 121 3,112 3,fi2 2.69o 1.206 4,537 48 48 r93 268 72 72 286
12 Tungkalllir*

l3 TanjungLagot

t4 Muara Sugihani

l5 Air Sahk*

Jumlah t6,37t 16,427 18,375 r8.730 19,@7 1,416 1,416 1,6t9 t,689 t.8t2 29.79n 29.656 t8,5e r7,542 t9.835 4$6 4n6 t.896 2.520 r249 2,4n 2,494 1.90 t,654 905

fiumfur: Dinas Pertanian dan Peternakan Kabupaten Banyuasin2OO2- 2@6

f€t : tr Data masihtergabungdalam kecamataninduk

t-,
L'I
Tabel Lampiran - 8

PopulasiUnggasMenurutJenisunggasper Kecamatan
di KabupatenBanyuasin
Tahun 2002 - 2006

JenisUnggas
Kecamatan

Jumlah

lumber: Dinas Pertanian dan Peternakan Kabupaten Banyuasin2OO2- 2006

Ket : r Datamasihtergabungdalamkecamataninduk

|L _ V- R
TabelLampiran - 9

ProduksiPerikanan
dalamKabupatenBanyuasin
Tahun2OO2- 2006

Produksi(Ion)
lGcarnatan PerilonanBudidaya
PerikananLaut PerikananDarat Perikanan
BudidayaKolam
Keramba

to.5) t -6 t

r3.612.80

Jumlah

Sumber: Dinas Pertanian dan PeternakanKabupaten Eanyuasin2OO2- 2006

Kec : n Datamasihtergabungdalamkecamataninduk
Tabel Lampiran - l0

lkan PerairanLautdi PerairanUmum


JumlahUnit Alat Penangkapan
KabupatenBanyuasinTahun 2OO2- 2006

I PukatTarik lkan 324 362 410


2 Dogol 596 658 743
3 JaringanInsangHanyut 235 n7 339 379 429
4 JarinsanlnsansTetao 724 361
5 Rawai Seienisnva r05 52
6 Bubu 540 269
7 Trammel Net 741 831 932
8 Jermal
9 BaganToncap 229 335 324
lo PancinsLainnva 1.875 937 r90 2',ao 237
il Serok 269 299 335
12 Perangkaplainnya 1,560 779 t50 '179 203
r3 Alat PenanskapKerans 199 223 252
14 Alat PenanekapKepitins 317 355 402
Jumlah 5,039 2,515 3,364 3,831 4,267

L-t0
Tabeltampiran - ll

VolumeKayuMenurutJenisnya
di Kabupaten Tahun2OO2- 2006
Banyuasin

VolumelGyurMenurutJenisnya

No Bulan 2002 2003 2004. 2005 2006


Kayu Kayu Kayu f.ayu lGyu
Meranti KKRC Meranti Meranti KKRC Meranti KKR,C Meranti KKRC
(M3) lndah KKRC (M3) lndah lndah lndah lndah
(M3) (M3) (M3) (M3) (M3) (M3) (M3) (M3) (M3)
fM3) (M3) (M3) (M3)
I Januari t t
19.494.82 3,260.86 71.50
2 Februari * * i
10,610.97 1,847.90
3 Maret * rt
9.971.64 3.987.20
4 April * 15,577.31 r,958.91 5.29 l3.ll
5 Mei n
14,884.25 1.987.51 320.25 24.11
6 Juni tr
11.862.91 5.r 88.5r 425.O5 20.31
7 Juli tt
37.266.72 5.783.00 t40.33
8 Agustus rt * 15.338.682.207.90 201.50 33.14 231.92
9 September * rt * 24.555.65 4,664.50 15.00 23.OO 140.40
r 0 Oktober rt rt tt

ll Nopember * * 21,902.85 14.24 153.66


t2 Desember t t rt
1,500.20 500.r1253.52 12.06 1,407.78
Jumlah * * * 182,976.@ 3l,4lo.& 330.3r 320.25 20r.50 58.31 15.00 23.@ 2,499.11 4.42
Sumber: Dinat Kehutanan dan PerkebunanKabupaten Ranyuasin

Ket : * Data tidak tersedia

L-il
Tabel Lampiran - 12

Peredaran HasilHutan KayuBulatDalamNegeri


Pengiriman
Tahun2OO2- 2006
KabupatenBanyuasin

JENISKAYU

No BULAN 2002 2@3 2W 2005 2006


Ctelam Akasia lGr€t Crelam Akasia lGret Crelam Akasia Gelam Crelam Akasia
lGret (M3) Akasia(M3) lGret (M) lGrA 1Mr;
(Batang) (M3) (M3) (Batang) (M3) (M1 (Batang) (M3) (Batang) (Batang) (M3)

1
Januari * * * 600.o0 5,030.17 222.28 9'.t9.24

2 Februari tr f t 5.061.48 r99.50 53.21

3 Maret t rt 6,O93.54 157.51

4 April ft * 1.518.10 10.499.22

5 Mei tr 3,379.57 12.979.18 144.29 5.224.53

6 Juni t I
4,915.26 24.OO 8.148.89

7 Juli * * I
4.297.91 4r9.25 8,261.24 24.OO 5,274.74

I Agustus tr 5,164.50 150.00 10.696.57 51.23 4.907.U

9 September * * * 9,535.r7 93.75 6,921.16 103.37 9,474.25

l0 Oktober u n
n2.50 58.04 5,3r8.33 21.40 1,965.53

ll Nopember * * r00.00 553.O9 14,84s.18 2,0o4.13 21.O5 5.745.42

t2 Desember L
6,295.46 82.65 6.455.88 160.76 5,633.58

Jumlah * 700.00 4,897.67 553.09 4.O53.8 799.50 l4{J..69 87,#9.89 883.n 275.49 &,r4.93

Sumbr : Dinas lGhutanan dan PerkebunanKabupaten Ranyuasin

Ket : * Data tidak tersedia

L-12
Tabel l-ampiran - 13

LuasAreadan ProduksiTanamanKaretRakyatdan KelapaSawitRakyatMenurutKecamatan


di KabupatenBanyuasin
Tahun2002

LuasArea (Ha)
JenisTanaman
No l(eamatan Karet Total lGlapa Sawit Total
Produksi Produksi
B€lum Belum
Menghasilkan Menghasilkan Tua/Rusak lumlah CIon) Menghuilkan
Menghasilkan TusAusak .bmldl (Ion)
1
I RantauBayur 2.r00.0 r,889.0 385.0 4,374,O 2,833.0 r40.0 r50.0 290.O 580.0 1,800.0
2 Betung 7,436.0 22.645.O 4,903.4 34,984.4 33.967.0 il.0 r.855.0 1,876.0 3,752.0 22.380.O
3 Banyuasin
lll 6,386.0 20.741.O 5.O72.O 32.199.0 31,111.5 226.0 625.O 85r .0 1.702.O 7,s00.0
4 PulauRimau 1,724.O 5,O54.O 6,778.O 7,581.O 1.928.0 r,638.0 3,566.O 7.132.0 19,656.O
5 TalangKelapa r85.0 12.O 197.O 277.5 r,355.0 70.o 1,425.O 2,850.O 840.0
5 Banyuasin
I 438.0 251.O 18.5 707.5
7 Rambutan r.169.0 993.0 2,162.0 1,753,0
8 Muara Padang 2.O 2.0
9 Banyuasin
ll

l0 Makarti Jaya 71.O 71.O


1 t Muara Telang

Jumlah t8,t55.0 51,936.0 il.383.9 81,474.9 77,523.0 3,ffi.O 4,349.O 8,008.0 15,016.0 52,176.O
Sumber: BanyuasinDalam Angka 2OO2

L-13
Tabel Lampiran - 14

LuasAreadan ProduksiTanamanKaretRakyatdan KelapaSawitRakyatMenurutKecamatan


di KabupatenBanyuasinTahun2003

LuasArea(Ha)
JenisTanaman
No Kecamatan lGret Total Kelapa Sawit Total
Produksi Produksi
Belum Belum
Menghasillan
Menghainkan Tua/Runk Jumlah CIon) Menghiiilkan Tua/Rusak Jumlah CIon)
Menghasilkan

RantauBayur r,631.0 2.271.O 385.0 4,287.O 2,907.1 r40.0 r50.0 290.O 1.800.0
2 Betung 5,855.0 22.644.6 4,903.4 34,403.O 41.583.8 11.0 1,865.0 1.876.0 22.880.O
3 B a n y u a s li lnl 5,120.0 20,741.O 5.O72.O 30.933.0 36,915.0 226.0 62s.0 851.0 7,500.0
4 PulauRimau 1.724.O 5,O54.O 6.778.O 6,784.5 473.O 365.0 838.0 4.300.0
5 TalangKelapa 306.0 r 85.0 t2.o 503.0 347.7 r,355.0 70.0 1,425.O 840.0
6 Banyuasin
I 71.O 251.O r 8.5 340.5 471.9
7 Rambutan 438.O 1,159.O 993.0 2,600.0 2,197.7
8 Muara Padang 2.O 2.O 3.8
9 Banyuasin
ll

l0 MakartiJaya 53.0 53.0 103.4


ll MuaraTelang

Jumlah r6,145.0 52,370.6 u.383.9 79.899.5 91,314.9 2.2A5.O 3,O75.0 5,2W.0 37.320.0
Sumber: RanyuasinDalam Angka 2OO3

L-14
/i#ecamatan induk

Tabel Lampiran - 18

LuasArealdan ProduksiTanamanPerkebunan
KelapaSawit
Tahun2OO2- 2006
di KabupatenBanyuasin

LuasAreal (Ha) JumlahProduksl(Ion)


No Perkebunan
2002 2003 2004. 2005 2006 2002 2003 2004 2005 2006
I PerkebunanRakyat

a. KelapaSawit Rakyat
r5.0r5.00 5.280.00 9.173.00 29,984.OO 11,229.OO52,176.OO 36,900.00 33.409.O0 34.996.OO 4,514.@
b. Pir lV Betung
6.165.00 1.021.00
2. PerkebunanNegara
^ PTPNVll Betung
o'
Barat 8.768.00 8.758.00 r5,597.00 15,587.OO 8,221.OO 117,491.OO 117.491.0054.494.37 22.930.OO
b. PTPNVll Bentayan
7.376.00 7.376.00 37.920.OO
c. Puslitbun
Sembawa
r.082.50 r.082.50I , t 5 3 . 3 8 I,153.38 r,r53.00 16.795.85 15.769.86 19.627.37 2.2',t4.OO
3. PerkebunanSwasta

a. SwastaAsing
555.00 555.00 541.OO 555.00 555.00 9.526.97 9,526.97 8.791.78 1,082.0o
b. SwastaNasional
9.444.44 15.O93.2817.300.28 r7.300.30 19.836.00 112.086.73 il2.086.r3 r35.053.06 r6.395.OO
Jumlah 43,241.94 30,778.78 49,930.66 &,579.68 48,370.00 345.X)7.56 292,773.96 252396.58 77,618.W 4,514.@

Sumber: Dinas Kehutanan dan PerkebunanKabupaten Banyuasin

L-18
Tabel Lampiran - 19

LuasArealdan ProduksiTanamanPerkebunan Karet


di KabupatenBanyuasinTahun 2OO2- 2006

luas Areal (Ha) Jumlah Pnoduksi(Ion)


No Perkebunan
2W2 2003 2W 2005 2006 2@2 2@3 2W 2005 2@6
I Perkebunan
Rakyat
a, KaretRakyat
81.471.90 79.899.OO 84.36r.90 85.il8.40 85.644.@ 77,523.OO 91,314.89 88.477.65 89.640.50 91.126.00
b. ProyekPRPTE/SRDP
3.469.OO 2,316.75 2.100.00 5.203.00 415.880.OO52,200.OO
c. Pir I TelangJaya
2. PerkebunanNegara

a. P.[PNVll Musi Landas


2.853.00 2,853.OO 3.O51.72 3,O45.72 3,039.00 3.122.80 3,122.28 2,877.67 3.035.61 3,il6.O0
b. PTPNVllTebenan
r.967.OO 1.967.O0 1.968.20 r.934.00 1.934.O0 1.58r.82 2.581.82 6.614.70 2.104.50 7.614.00
c. fuslitbunSembawa
1.578,90 r,578.90 t.548.O2 2,214.O2 2.214.OO 2.178.28 2,173.OO 1,743.10 2.986.50 r,503.00
3. PerkebunanSwasta

a. SwastaAsing
2.428.N 2,301.00 2.415.@ 2.4il.00 2,398.00 3.088.90 3.065.r0 6.187.06 2.694.OO 6,470.OO
b. SwastaNasional
2,171.22 2.322.14 7,423.68 2'463.85 2.665.OO 2.237.07 2,291.90 r3.580.87 2.766.OO 3,401.00
Jumlah 95,939.O2 93237.79 102.868.52 97.186.W 97,894-@ 94.9U.87 521,428.98 In,78l.O5 103:28.il il3,330.00
Sumber: Dinas Kehutanan dan PerkebunanKabupaten Banyuasin

L-19
Tabel Lampiran- 20

LuasPanendan ProduksiBuah-buahan
di KabupatenBanyuasin
Tahun2OO2- 2006

TAHUN
2@2 2003 2W 2005 200/6
No JenisBuah-buahan
Luas Luas Luas luas Luas
Produki Produki Produki Produksi Produksi
Panen Panen Panen Panen Panen
(Ha) Gon) (Ha) (Ion) CIon) fton) CIon)
(Ha) (Ha) (Ha)
I Mangga 151.85 1.230.51 347 521 78.30 397.00 49.60 67.20 66.2 r37.8
2 Jeruk 769.23 19.057,38 s39 8.624 5,167.O0 9.926.60 5.00 3.40 773.4 4.490,9
3 Pepaya q,89 940.68 62 3.124 38.80 567.90 239.OO 520.70 22,1 235.6
4 5awo 44,79 1.806,1
8 40 t4l 139.40 216.80 131.40 85.20 86.7 52,4
5 Durian 63.U 2.235.2s 44 132 r48.r0 458.80 97.OO 540.60 52,4 231.1
6 Duku 50.74 3.243,90 44 132 49.40 113.70 20.00 48.80
7 Nangka/Cempedak 483,69 30.997.27 23 1.440 244.30 890.60 410.70 1.3r0.70 450,2 1.250.6
8 JambuBiji 290,23 2.768,93 l3 193 9l.oo 407.30 92.70 r05.30 53.r 2u,6
9 Rambutan t,517,64 16.699.25 32.000 19.000 370.O0 1.879.20 r6l,r0 137.63 418.9 203,3
to Pisang 792.83 17.568,68 216.965 40.823 333.30 6,255.90 342.60 5,855.90 241,4 2.574,6
Sumber: Dinas Pertanian dan PeternakanKabupaten Banyuasin

L-20
Tabel Lampiran- 2l

LuasPanendan ProduksiSayurandi Kabupaten


Banyuasin
Tahun 2OO2- 2006

TAHUN
2002 2003 2@4 2@5 2006
No JenisSayuran
Luas Luas Luas Luas Luas
Produksi Produki Produksi Produksi Produksi
Panen Panen Panen Panen Panen
(Ha) [ron) (Ha) CIon) (Ha) CIon) flon) CIon)
1Ha) (Ha)
I lkcang Panjang 615 852,50 539 1.617 3.446.@ 2.819.30 7.0r8.00 3.510.90 890 39.797
2 Cabai 533 357,50 480 1.40 7.798.@ 3,022.70 r0,362.00 6,O82.40 1.288 26.839
3 Tomat 't66.60
238 r06 1.439 I,r55.00 1,261.90 2,451.0O 2,276.60 234 13.721
4 Terong 293 234.40 214 1.980 2,261.0O 1.329.10 4,435.OO 3,977.50 330 20.721
5 Ketimun 5ll r.637 214 3.424 6,506.00 4.480.50 6.588.00 8.90r.80 487 7r.926
6 lGngkung 153 1.377 6l 793 553.O0 602.30 894.00 t.o89.80 188 8.014
7 Bayam 231 2.079 62 99,2 488.00 401.40 999.00 942.40 203 6.712
I Buncis 3r0 216,90 67 737 1.031.00 1.277.30 3.674.@ 2.893.80 r60 9.423
Sumber: Dinas Pertanian dan Peternakan Kabupaten Banyuasin

L-21
Tabel Lampiran- 22

LuasPanendan Produksi
JenisTanamanPerkebunan
di KabupatenBanyuasin
Tahun2OO2- 2006

TAHUN
20o.2 2003 2W 2005 2@6
No JenisTanaman
Luas Luas Luas Luas Luas
Produki Produki Produki Produki Produlai
Panen Panen Panen Panen Panen
(ton) (fon) fion) (Ion) CIon)
(Ha) (Ha) (Ha) (Ha) (Ha)
1 Cengkeh 9 0,30
2 Kelapa 16.737.50 26.037.60 34.613 39,450 39.379.50 41.499.20 4r.528.80 46.882.60 41.684 47.@4
3 Kopi 3.867.50 526,68 4.3'.t6.40 r.il5,50 4.429.40 896.O9 4.475.OO r,016.30 4.475.OO r.091,50
4 Coklat/Kakao 59 6.,432 91.00 r.200.00 91.00 3.r3 496,0O 3,s6
5 Lada 14 3,620
Sumber: Dinas Pertanian dan Petemakan Kabupaten Banyuasin

L-22
Tabel lampiran- 23

JumlahProduksiJenisBahanGalianGolonganC dan BahanTambang


BanyuasinTahun2OO2- 2006
di K.abupaten

JenisBahanGalianCrolongan
C (M3) JenisBahanTambang
No Tahun
TanahUrug Tanah Liat Pasir
MinyakBumi
Koral
(Barel) Gar (Ion) BatuBara(Ion)

I 2002 * ,t rt
484.414 20,757 53.755 409
2 2003 1,512,000
137,551 r08.504
3 2004 8.260.620
63,517 31.328 12,000
4 2005 7,515.420
71,550 8,855 6,250
5 2006 8.317.312
293,O25 11,590 7,500
fiumfur: Dinas Pertambangandan Energi Kabupaten Banyuasin
Ket : * Data tidak tersedia

L-23
Tabel Lamplran- 24

JumlahPerkembangan
Pendudukdan Tingkat Kepadatandi K.abupaten
Banyuasin
Tahun2002 -2005

JumlahPendduk (Jlwa)
No l(ecamatan lbukota Rata-Rata Rata-Rata Rata-Rata Rata-Rata Rata{ata
2@2 Kepadatan 2003 Kepadatan 2004 Kepadatan 2005 lGpadatan 2W lkpadatan
(Kmz) ftm2) {Km2) fim2) ftmu)
I RantauBayur TebingAbang 38,314 55.00 38.810 55.00 40,813 59.00 42,975 72.00 43.383 73.16
2 Rambutan Rambutan 36,854 s7.oo 36,174 58.00 38,O08 61.00 39.129 53.00 40,367 64.63
3 Banyuasin
I Mariana 66.136 94.00 67,126 95.00 59,766 99.00 71,823 t02.00 74,138 105.70
4 MakartiJaya MakartiJaya 39,350 s3.00 39,800 54.0O 41,657 57.@ 42.885 58.00 44.295 50.r5
5 Betung Betung 57,155 72.W 57.523 72.OO 59,427 75.OO 61,179 77.O0 53.139 79.52
6 Banyuasin
lll Pangkalan
Balai 80,788 92.0O 81,697 93.00 8r.3r3 93.00 83,710 96.00 86,397 98.83
7 PulauRimau Teluk betung 83,142 88.00 83,208 88.00 79.317 84.00 81.655 85.00 84.306 89.30
8 MuaraTelang TelangJaya 5r.780 45.OO s2.o95 45.00 s6,175 49.OO 57.831 50.00 59.585 5r.90
9 TalangKelapa 5ukajadi 115,413 98.00 t't7.o82 r00.00 123.637 r05.00 127,282 108.00 131.347 111.74
t0 Muara Padang SumberMulyo 76,289 49.OO 75.779 49.0O 78.r
8s 50.00 80,490 52.O0 83,M9 53.28
II Banyuasin
ll Sungsang 40,599 r5.00 41,128 r5.00 4.515 17.00 45.827 17.OO 47,291 17.64
12 Tungkalllir*
l3 TanjungLagor
t4 Muara Sugihant
l5 Air Saleki

Jumlah 685.841 66.18 690,422 66.82 712,813 69.@ 734.787 n.ao 757,397 73.26
Sumber: RanyuasinDalam Angka Tahun 2OO2- 2@6
Ket : * Data masih tergabung dalam kecamatan induk

L-24
Tabel Lampiran- 25

JumlahPendudukMenurutJenisKelamindan 5ex Ratio per Kecamatan


di KabupatenBanyuasin
Tahun2002 - 2OO6

Tatrun

No Keernatan 2@2 2@3 2W 2W 2W


5ex lex 5ex
Laki- Laki- SexRatio tex Ratio
hki-hki Perempuan Ratio Percmpuan Ratio Perempuan Ratio Laki-l-aki Perempuan taki-|.aki Perenpuan
(9ol l-aki (9o) taki (oh\ (o/o) (/o)

I Banyuasin
lll 40.252 40.536 99.30 4r,180 40,517 ror.50 41.628 39,685 t04.90 42,855 N.855 104.90 43,419 42,978 ror.03
2 PulauRimau 41.509 41,633 99.70 43,345 39.863 r08.70 39.878 39,439 lol.ll 41.O54 q,602 t01.lo 41.595 42.712 97.38
RantauBayur r8.857 19,457 96.90 19.518 19,292 t 0 1 . 2 0 20,438 20.375 roo.3l 21,O40 20,976 r00,30 21.317 22,066 96.61
+ Betung 28.978 28.188 102.80 29,596 27.927 r0s.90 30.505 28,922 105.48 31.Q4 29,775 105.50 31,817 31.322 t01.58
TalangKelapa 55.082 60.331 9r.30 60.o32 57.050 105.20 63,798 s9.839 106.62 65.679 6r.603 t06.60 66,544 64.804 1o2.69
A Banyuasin
ll 20,688 r9.9il r03.90 21.499 19,629 r09.so 22.962 21.s53 106.54 23.639 22,188 106.50 23.gso 23,341 to2.6l
7 MuaraTelang 25.655 26,125 98.20 27.456 24.643 il1.40 28.827 27.348 105.41 29.677 29,154 105.40 30,068 29.617 101.52
I MakartiJaya r9,86r 19.489 r01.90 19.762 20.038 98.60 20.507 21.150 96.96 21.112 21,774 96.96 21.390 22.90s 93,38
9 Banyuasin
I 33.249 32.887 l0r.r0 34.333 32.793 10/.70 35.466 34.300 r03.40 36,512 35.311 103.40 36.993 37,146 99.59
lo Rambutan 18.395 18.469 99.60 1 8 , 2 8 5 17.889 102.20 r9,866 18,122 109.73 20.472 r8.656 r09.70 20,742 t9,625 to5.69
ll Muara Padang 39,256 37.033 106.00 40.437 35.342 114.41 40.631 37.554 r08.r9 41,829 38.661 108.20 42.380 40,670 \M.20
12 Tungkalllir*

l3 Tanjung Lagotr

14 Muara Sugihantr

l5 Air Salek*

Jumlah 341,782 34/.Osg r00.06 355,43 334.983 ro5.76 3&506 348,287 10/..42 375,273 359,555 r04..4l 380,215 377,r% 1,t06.28
fumber: RanyuasinDalam Angka Tahun2@2 - 2@6

L_25
- 26
Tabel Lampiran

JumlahAkseptorAktif Menurut JenisKontrasepsi


di KabupatenBanyuasin

No JenisKontnasepsi Tahun
2002 2003 2004 2005 2@6
I IUD tr
3,725 3,642 3.6',14 3,496
2. MOP rl
447 M3 443 425
3. MOW *
3,529 3,474 3.462 3,385
4. IMPL
19,O76 19,427 20,693 19,385
5. 5untik
41,699 37,695 42,696 40,979
6. Pil
29,O22 26.068 29,441 29,O24
7. Kondom
646 789 1,237 1,403
Jumlah * 98,14 91,528 lot,586 98,O97
Sumber: Dinas Kependudukan, KB dan Catatan lipil Kabtpaten Banytasin
Ket : r Data tidak terredia

L-26
Tabel Lampiran- 27

KebutuhanHidup Minimum Pekerjadan Perkembangan


Upah Minimum Regional
di KabupatenBanyuasin

I 2@2
2 2@3
3 2W 400.(no 415.0@ 425.OOO 4tr;0.wo 450.OOO 2160,@0 470.OOO 475,WO zAO,OOO 490,000 495,OOO 500,@o 458,333 403,500

4 2005 503.0@ 520,OOO 525,O@ 530.000 535.000 540,000 550.000 555,0@ 550,000 565,oCX)575,000 600,ooo 546.,5(n 503,OOO

5 2006 620,OOO 630,000 635,000 645,0@ 650.000 665,000 670.000 675.@O 685,OOO 690.000 695,000 700.@o 663,333 604,(X)O

tumber: Banytasin Dalam Angka

L-27
- 28
Tabel Lampiran

Upah Minimum Sektoraldi KabupatenBanyuasin

t. Pertanian 508,500 545,0@ 660,0@


2. Pertambangan
dan Penggalian 577,250 617,7@ 724,400
3. IndustrTPengolahan 505,000 554,0@ 661,O@
4. Listrik,GasdanAir 520,000 560,300 728,O@
5. Bangunan 570,5@ 613,3@ 789,300
6. Perdagangan,
Hotel dan Restoran 565,800 600,000 700.000
7. Angkutandan lbmunikasi 520,0@ 550,2@ 653,5@
8. Keuangan,
Asuransi,
Persewaan 572,W 622,44O 72s.O@
Bangunan,
TanahdanJasa
Perusahaan

JasaKemaqyarakatan 500,000 559,950 675,W


Lain-lain 460,@0 503,700 604,000

Sumber: Eanytasin Dalam Ang*a

L-28
Tabel Lampiran- 29

Jumlahdan LokasiPenempatanTransmigrasi
di KabupatenBanyuasinTahun 2002 - 2006

1 UPTPerambahan
5P.I
2@ 300 300 300 711 t.ll4 I,ll4 t.lr4
2 UPTPerambahan
SP.2
100 364
3 UPTBertak5P.I
300 40 440 &o 1,250 r.816 1,816 t.816
4 UPTBertakSP.2
400 400 400 400 1.730 1,713 1.713 1,713
5 UPTBertak5P.3
215 r50 365 365 365 926 676 r.566 1,566 1,566
6 UPTAir Kumbang
Padang
5P.4
r00 300 300 M 1,226 1,226
7 UPTAir Kumbang
Padang
5P.5
175 375 375 7W 1,49 1.49
I UPTAlr Kumbang
Padang
5P.6
260 260 260 1.040 t.lo7 I,l07
9 UPTAir KumbangPadang5P.7
250 250 250 I,O00 1,004 r.004
to UPTAir Tenggulang
5P.6
300 300 2.220 2,220
650
Sumbr : Dinat TenagalGrja dan TrasmigrasiKabupaten Banyuasin

L-29
- 30
Tabel Lampiran

di KabupatenBanyuasin
JumlahKeluargaSejahteradan Prasejahtera

I Banyuasin
I 4,577 5,518 5,255 7,366 7,921 5,105 7,935 5,762
2 Banyuasin
ll 7,607 5,O98 1,868 6,422 3,197 5,582 3,063 4,636
3 Banyuasin
lll 6.799 4,352 6,709 5,990 3.467 4.589 4,026 4,690
4 Tlg Kelapa 4,139 4,237 4,278 6,677 5,142 6,185 3,726 5,527
5 Rambutan 3.488 1,324 3,579 2,774 3,568 3,507 3,048 2.975
6 M. Padang 12.401 3.953 r3.r83 5,170 6.542 4.608 1.953 2,469
7 MakartiJaya 4,956 1,959 4,645 3,651 4,806 2,282 2,376 2,065
8 MuaraTelang 5,654 4.866 5,453 5,456 2,758 4,n3 1,795 4,369
9 Betung 2,234 1,556 2.466 3.370 2,ffi 3,326 3,121 4.336
lo RantauBayur 5,680 1,545 5,865 1,595 5,088 2,549 4,765 1,260
lt Pulaurimau 8.155 2.946 8,826 5,761 il,189 3,92r 7,782 2,469
'/2 T. Lago 1,889 2.739
l3 M.Sugihan 3,142 1,152
14 Air Salek r,544 2,536
t5 Tungkalllir 4.O23 1,325
Jumlah 59,690 17,3& 62,127 54,228 56318 #.557 54.198 48,309
Sumber:BKKBdan CatatanSipil KabupatenBanytasin
Ket : PS = Pra Sejahtera
KS = Keluarga Sejahtera

L-30
Tabel Lampiran- 31

Perkembanganlndikator Makro Ekonomi


di KabupatenBanyuasin

I PDRBatasdasarhargaberlaku$utarupiah)
-DenganMigas 4.089.860 4.7M.340 5.868.620 7.029.269 8.455.998
-TanoaMicas 3.259.O21 3.616.895 4.132.697 4.X)1.154 5.682.434
2. PDRBatasdasarhargakonstan(iutaRupiah)
-DeneanMieas 3.175.278 3.419.737 3.576.197 3.800.765 4.049.106
-TanpaMicas 2.608.773 2.735.O18 2.876.201 3.O52.270 3.252.M9
3. PertumbuhanPDRB(%)
-DensanMicas 1o,23 r5.oo 23,70 19,78 20,30
-TanpaMieas 9,66 1o,98 14.26 18,59 15.94
4. Ekonomi(96)
Pertumbuhan
-DenganMigas 4.29 7,70 4,58 6,28 6,53
-TanDaMicas 5,27 4,84 5,16 6,72 6,56
5. Pendapatanper kapitaatasdasarhargaberlaku
-DenganMigas 4,833,607 5.43r.r32 6.525.772 7.573.143 8.861.874
-TanoaMieas 4,255,256 4.574.31s 5.O76.975 5.833.644 6.579.163
6. Pendapatanper kapita atasdasarharga konstan (Rp)
-DenganMigas 3.794.098 3.957.957 4.020.510 4.410.OO4 4.410.506
-Tanpa Migas 3.117.r88 3.165.472 3.233.545 3.324.702 3.542.743
Sumber: Radan PusatStatistik Kabupaten Ranyuasin

L-3l
€€ "l

ulteniuea ueJednqexJeted ueepPtued rotuex : Jaqunt

ol8'l 9tL t6 98 tst l8€ 8t wv 9OOZunqsl

9ZO'Z 898 60[ g8 LLL 18€ 989 99? r.lPllxnf

801 e€, zt 9L 88 e^lntllqn5 ot


80t 06 8t 8t Suestun5 6
o0€ 001 ooz oo7, g1-oAlnurop;5 8
o8 tz t z9 I z9 9 Euen;a;1 L
9€t 09 98 98 eAe1rpe1e61 9

zoz L8 v 9l i8 It 88 LN tunlag Inlal I


z€L 09 9b z8 8ZL
lpe(e1n5 v
6LL 9ll I 8Z 9€, 8Z ov oJoure)lns t
vgv ozz zv z9 zot z9L wt vzz 8un1a6 z
862 00r I I 9€t €9 ovl b9 ue1e18ue4 I
1e1eg

ulsenAuegualednqe; lp resede1o;a8ua6
roluql
qelg elolaltq 8uetrrprEdltun uegelSa;7eqes6
1edua1 qplLunf

gg - uerguq laqel
v€,'1
Inpu! ueleurelal ureleptunqetral qlrpul ele6 { : }a)
WZ - Z@Z unqel e48uy uteleg upenlueg : ragunt

LIJ zol L8 z9 ol 18 6L 6l zoJ z8 qBlunr


slelPsrlv 9l
erenw
+ueqlSns VL
*ote1 8un(ue1 € t
+r!ll lqEunf ZL
L L L 9 9 tl t1 tl 97, €1 tuepe6erenw ll
L L 9 € n I t I z I uPlnqueu 0t
97 LI 9t L 81 6 8 I 8 L I ulsPn^ueg 6
9 t b , €, L I L v L eAel;ye1e61 8
L I n , € vl bl bl bl ZL 8ue1a1
Prenry L
6 9 9 z z I v , b I il ulsen^ueg 9
ZJ LI tt 6 8 9 9 9 9 L edela) tuele1 I
/ I I e b z z z I l Sunpg b
b , z ?, z I I I b I rnAegne1ue6 E
8 I 9 € b 8t 81 8l LZ 61 neurlunelnd z
,z zz LJ 6 9L L L L 9 6 ggg
u;senAueg I

9OOZ- egOZunLlelulseMuegualednqe;1p
ueleuoa) rad On) uoN uppq6;1 lsetado;eAqeAueg

gg - uer;duq Fqel
Tabel Lampiran- 32

JumlahPerusahaanIndustriMenurutTenagaKerja
di KabupatenBanyuasinTahun 2002 - 2W6

I Banyuasin
lll 73 73 52 53 53 925 l2 6 6 l0
2 PulauRimau il ll l3 2 2 2
3 Rantau
Bayur I I 12 12 t2 I I I
4 Betung 54 50 17 20 20 475 15 I I 2
5 TalangKelapa 305 305 93 97 97 3,750 95 22 26 33
6 Banyuasin
ll 42 42 31 3l 3l 725 6
7 Muara Telang I I
8 MakartiJaya 54 54 54 I I 3
9 Banyuasin
I 6 8 7 7 7 1,189 85 2 2 6
l0 Rambutan
ll Muara Padang I I 5
12 Tungkalllir*
t3 Tanjung Lago*
t4 MuaraSugihan*
r 5 Air 5alek*

57
Jumber: Dhas Koperindag, UKM dan PM lGbupaten Banyuasin.

Ket : * Data masih tergabung dalam keamatan induk

L-32
Tabel Lampiran- 35

Banyaknya
JenisKegiatanUsahaKUD dan Non KUD per Kecamatan
di KabupatenBanyuasin

JenlslGglatanUraha

No l(ecamatan KUD Non KUD


Simpan Jasa- 5impan Jasa-
Distribusi Pemasaran Produksi DistribusiPemasaran Produksi
Pinjam Jasa Pinjam Jasa
1 RantauBayur I
'|
2 Betung I I I
3 PulauRimau lt 3 6 I I

4 Tungkalllir *
5 Banyuasin
lll I
3 26 2 2
6 TalangKelapa 1 I 7 4
7 TanjungLago*
B Banyuasin
lll 2 5 I 2 t3 3 3
9 Rambutan 1
I I 1 I
lo MuaraPadang I 17 3 4 i
I 4 2
il MuaraSugihan*
12 MakartiJaya I 2 3 1 5
t3 Air Salek*
14 Banyuasin
ll 2 I I 6 1

r5 MuaraTelang 2 9 5 8 2 8 4
Jumlah I 49 l6 27 I 54 24 3 25 I
Tahun2005 7 49 l5 27 I 49 23 3 25 2
Sumber: Dinas Koperindag, UKM dan PM Kabupaten Banyuasin
Ket: frAngka masih tergabung dalam kecamatan induk

L-35
Tabel Lampiran- 36

JumlahPuskesmas,PKM Pembantu,RumahBersalin, poliklinik/polindes


dan Dokter
per Kecamatandi KabupatenBanyuasin
Tahun 2002 - 2006

I Banyuasinlll rr 2 3 3 3 tr 9 9 9 t5 rl rt rt
24 24 24 4 4 4 5
2 PulauRimau n 4 4 4 2 tl 27 27 27 ll Fl rl rr
33 33 2l 5 5 5 2
3 RantauBayur rt 2 2 2 F'
7 7 7 6 tr n t4 t4 t4 tr I I I 3
4 Betung tt
2 2 2 2 r 6 6 6 6 rr rt t6 t6 rl
I
17 2 2 2 3
5 Talang Kelapa F'
3 3 3 3 IJ t2 12 t2 t2 n I I I I n t3 l3 l3 rt 6 5 6 7
6 Banyuasin
ll F'
2 2 2 2 H 7 7 7 8 n rr l5 16 t5 tr 2 2 2 3
7 MuaraTelang tr I 2 2 2 rr 6 6 5 9 t.l n l3 l3 l3 n 2 2 2
8 Makarti Jaya F'
I I I I t-I 4 4 4 4 rt I H
8 8 8 2 2
A l.l 2
9 BanyuasinI r| 2 2 2 2 n 9 9 9 9 n I I rt
I
2 ll l3 ll H
A 3 3 3 6
t0 Rambutan 2 2 2 2 4 4 4 4 n H
17 17 17 rr 3 3 3 3
1l Muara Padang rt 3 3 3 I 11 22 22 22 4 r? rl 33 33 t2 r| 4 4 4 4
t2 Tungkalllir* Fl
2 n ll r| Lt 12 A I
t3 Tanjung Lago* E H
A fl IJ A

l4 MuaraSugihan* F'
I rt 9 r
A rr n
r5 Air Salek* r
A I u 9 r
A tr rr
Jumlah n 23 26 26 fr E n3
il3 il3 117 I 2 2 2 3 E 3 t98 m t78 E 34 34 x gf
lumber: Banytasin Dalam Angka Tahun 2@2 - 2M
Ket : r Data masihtergabungdalam kecamataninduk
: E Datatidak tersedia

L-36
Tabel Lampiran- 37

JumlahPenderitaPenyakitTertentuMenurutJenispenyakitper Kecamatan
di KabupatenBanyuasin Tahun2OO2- 2006

JenisPenyakit
No lGcamatan
Pnemonia Diare TBC Malaria
'02 '03 'o+ '05 '06 '02 '03 '04 '05 '06 '02 '03 '04 '05 ,6 '02 '03 ,u '05 '06
I Banyuasin
lll 85 38 9 93 265 1 . 3 1 3 2 , 2 2 6 2.874 3.321 3.426 28 M r80 71 6 526 684 470 210 157
2 PulauRimau 97 t41 155 259 317 1,243 1 . 9 5 7 r.859 2,O85 3.200 21 z r36 36 90 724 997 819 263 1.O4s
3 RantauBayur t02 53 79 576 987 1.377 484 3,166 4.852 t3 8 203 22 90 441 +51 t5 | t41 479
4 Betung 99 22 55 430 559 1.055 t,240 3 . 1 0 8 2.843 5 , Z V5 t8 46 120 66 60 483 641 778 250 872
5 TalangKelapa 87 7l 107 70 456 1 . 4 1 2 3 , 3 9 8 3.220 3.405 4.323 23 53 730 t07 l3l w5 677 659 299
6 Banyuasin
ll to4 tzu 100 142 244 1,236 1,627 t.zzv 784 2.677 24 il8 84 687 490 108 tIz 1,343
7 MuaraTelang 95 r30 53 229 307 7'r 1 853 3.432 12 102 9 46 s46 75 102 54 865
8 MakartiJaya 86 34 25 125 485 2,018 437 595 3.171 16 30 r30 4l 6l 467 5l l0t 950
9 Banyuasin
I 8l l8 77 43 274 2.350 2.457 2,395 2,243 z-v)v 35 30 344 r03 l3 394 1,359 1.il8 291 237
t0 Rambutan 90 49 5Z 47 t+l 1,783 1 , 5 2 7 t . 7 8 6 2.106 887 33 42 253 45 50 581 556 UJ) 412 284
11 Muara Padang 94 126 16 130 21n 3,824 2.366 1 , 6 5 9 1,574 1.861 t4 23 r50 t1 35 732 833 l.0to 210 512
t2 Tungkalllir*
l3 TanjungLago*

t4 MuaraSugihan*
r5 Air 5alek*

Jumlah t,(}20 672 749 rATr 3,%2 18,963 18,9t9 p,9n 22,94 33,181 237 26 2.476 561 666 5,9U 6,765 6,67 2,343 7,1$
Sumber: BanyuasinDalam Angka Tahun2002 - 2006
Ket : * Datamasihtergabungdalamkecamataninduk

|L - _ ?J T7
Tabel Lamplran- 38

JumlahTenagaMedis per Kecamatan


di KabupatenBanyuasinTahun 2OO2- 2006

I Banyuasin
lll 6 4 3 5 6 2 2 2 2 I
53 52 57 47 4 33 25 2l 26 l9 27 27 5 5 I
2 PulauRimau 5 5 3 3 4 0 22 21 20 2l 6 t4 t6 l4 14 2 2 2 2 2 I
3 RantauBayur I I 3 3 3 2 t2 t2 12 n l4 4 4 2 2 5 ll il I I 2
4 Betung 2 2 4 3 4 I I 22 17 2l 2l l3 9 I ll 12 7 6 6 3 3 3
5 TalangKelapa 6 6 7 7 8 4 4 2 2 3 48 44 5l 49 20 3l 3l 28 34 3 l7 t7 7 7 2
6 Banyuasinll I 2 I 4 14 t6 t2 r0 12 6 o 4 4 2 I 2
7 MuaraTelang 2 2 3 2 I o l3 20 15 t5 t7 4 A 7 7 3 I I I I
8 MakartiJaya 2 3 I I o o 9 9 9 9 5 3 3 3 3 3 2 2 I I o
9 BanyuasinI 3 3 6 6 3 I I 25 2l 26 26 27 21 23 17 20 2 l0 l0 2 2 I
l0 Rambutan 3 3 4 4 4 I I 2 2 4 24 25 24 25 t9 l3 t3 l0 14 10 9 9 4 4 2
ll Muara Padang 4 4 3 2 4 o 22 17 24 23 24 7 8 6 5 I 2 2 I I 0
12 Tungkalllir* 2 9 I
l3 Tanjung Lago*

14 Muara Sugihan*
r5 Air Salek*

l5 Dinkes 4 2 I I I 6 4 I 4 4 2

39 I 8 251 2s9 145 6s 88 88 3l l8

Sumber: Banytasin Dalam Angka Tahun 2@2 - 2@5


Ket : * Datamasihtergabung
dalamkecamatan
induk

L_38
TabelLampiran- 39

JumlahSekolah,
RuangKelas,
GurudanMurid5DNegeri
per Kecamatan
di Kabupaten Tahun2002- 2006
Banyuasin

I BanyuasinIII 66 67 67 67 67 326 554 369 782 456 608 631 710 698 803 r0,807 10,530 10,s30 10.338 1o,673
2 PulauRimau 49 50 52 52 47 234 359 263 335 324 36 363 363 269 397 9,330 8,794 9,195 5.794 7.542
3 RantauBayur 37 37 38 38 38 167 280 2U 236 24 259 307 264 288 304 6.721 5,858 5.695 5,781 5,695
4 Betung 41 42 41 4 4l 231 317 148 328 97 380 367 365 324 435 9,523 9,45 9,502 8,376 9.299
5 TalangKelapa 47 47 48 49 48 272 469 269 478 508 701 749 747 74 821 12.087 15,482 t4.998 l5.o3s ls.737
6 Banyuasinll 19 l9 20 20 20 93 261 83 162 176 r30 154 134 149 156 4.708 4.344 4.260 4,031 5,773
7 Muara Telang 35 35 35 34 35 r33 294 70 r88 323 211 292 321 268 357 6,713 8,162 8,84 5,3s6 9.250
8 MakartiJaya 27 27 27 27 27 n6 201 158 162 t96 202 223 230 246 261 5,521 5.3Q 5,293 4,826 5.081
9 Banyuasln
I N 41 47 49 47 264 452 149 356 372 379 413 401 439 427 8,496 8,357 9,260 9,225 8.084
t0 Rambutan 23 23 23 23 23 270 il6 l@ 245 393 178 213 237 245 4.557 4.366 4,&2 4302 4,241
lt Muara Padang 60 @ 50 62 62 269 367 258 Q7 44 207 330 330 3Q 393 11.795 9.760 11,5M ro,85l 8,784
t2 Tungkal llir*

l3 TanjungLago*
14 Muara Sugihan*

15 Air Salek*

# 458 455 2,t05 3,824 3,8t6 4,O22

Sumber: Ranytasin Dalam Angka Tahun 2@2 - 2@6


Ket : i Data masihtergabungdalam kecamataninduk

t -?q
Tabel lampiran - 4O

JumlahSekolah,RuangKelas,Guru dan Murid 5D Swasta


Tahun 2OO2- 2006
per Kecamatandi KabupatenBanyuasin

I Banyuasin
lll 2 I 2 6 23 l5 72 97
2 PulauRimau I 6 36 a 2U 774
3 RantauBayur
4 Betung I 2 2 2 2 6 12 t2 t2 12 4 t2 6 6 t4 8l 201 201 201 r83
5 TalangKelapa I 4 I I I 7 12 6 6 6 I 45 9 9 9 114 305 60 50 l05
6 Banyuasinll

7 MuaraTelang
I Makarti Jaya 2 t2 12 177
9 Banyuasin
I 3 8 2 2 2 14 48 t2 t2 t2 25 47 6 6 t0 583 978 226 226 232
10 Rambutan
ll Muara Padang I 2 2 2 2 6 ll 12 12 l2 2 7 t2 12 t3 56 248 175 175 328
12 Tungkalllirt

l3 Tanjung Lagor
14 Muara Sugihan*

l5 Alr Salek*

Jumlah 9 l9 7 7 t3 36 t0l 42 42 78 67 33 86 l,ilo 62

Sumber: BanyuasinDalam Angka Tahun2@2 - 2OO5


Ket : * Data masihtergabungdalam kecamataninduk

L- 40
Tabel lampiran - 4l

JumlahSekolah,RuangKelas,Guru dan Murid MadrasahlbtidaiyahSwasta


per Kecamatandi KabupatenBanyuasinTahun 2OO2- 2006

I Banyuasin
Ill z 2 2 2 3 12 7 to l0 l8 l8 t2 20 l9 28 t65 94 267 215 300
2 PulauRimau 5 4 4 4 4 l9 t2 l7 t7 24 22 33 35 30 36 346 634 522 333 342
3 RantauBayur
4 Betung I 2 I I I 3 4 6 6 6 4 l5 3 4 7 43 r84 44 47 96
5 TalangKelapa 8 7 7 8 8 3l 29 36 42 48 60 6l 64 78 r09 891 903 1,020 930 995
5 Banyuasin
ll 2 I 4 4 4 6 3 12 t2 24 lo 5 24 29 32 254 121 460 426 552
7 Muara Telang 5 I 8 8 I l5 29 30 30 48 56 61 74 84 86 925 999 1 . 1 3 5 1,064 1.591
8 Makarti Jaya 2 3 2 2 2 6 12 9 9 t2 t2 l8 14 t9 r8 t9l 276 218 208 284
9 BanyuasinI 3 5 3 4 5 t2 t4 lt 17 35 20 29 29 38 4 334 499 341 Q8 520
l0 Rambutan I I I I 3 3 3 3 6 5 5 I
6 8 53 56 43 35 67
ll Muara Padang l5 14 to l3 t3 45 6 4 62 78 93 92 94 105 loo 1.O43 1.720 1,033 1 , 3 2 7 1,391
12 Tungkallllrr
l3 Tanjung Lago*

14 Muara Sugihan*

15 Alr Salekr

Jumlah {4 17 ryl 47 '.0t tlm 159 : 178 208 299 300 332 3& 412 ffi 4,245 5,486 5,083 4,993 6r98
Sumfur: BanyuasinDalam Angka Tahun2@2 - 2@6
Ket : * Data masihtergabungdalam kecamataninduk
Tabel Lampiran- 42

JumlahSekolah,RuangKelas,Guru dan Murid SLTPNegeri


per Kecamatandi KabupatenBanyuasinTahun2@2 - 2006

I Banyuasinlll 4 4 4 4 5 4l 51 5l 5l 62 t35 152 147 147 180 2,491 2,427 2,355 2.355 2,280
2 PulauRimau 2 2 2 2 3 16 20 t4 t4 29 32 32 l2 12 61 768 778 797 797 1,028
3 RantauBayur I I I I 3 8 9 8 I 14 l9 14 8 8 50 353 345 3s3 353 380
4 Betung 3 3 3 3 3 36 34 36 36 42 69 75 47 47 88 l.3.tO r,490 t.370 1.370 r,338
5 TalangKelapa 2 2 2 2 2 20 26 20 20 l9 60 66 60 60 8l t,122 r.095 I,068 r,068 r,098
6 Banyuasinll I I I I 1
6 7 l2 12 7 l5 17 4 4 l6 259 302 320 320 320
7 MuaraTelang 3 4 4 4 4 l8 30 35 35 3l 55 64 l8 l8 69 967 1.033 1.043 1.043 1,067
8 Makarti Jaya 2 2 2 2 3 r8 23 t9 l9 23 33 30 t7 l7 66 827 906 958 958 1,005
9 BanyuasinI 3 3 3 3 3 25 33 27 27 3l 70 94 66 66 l02 I,156 1.301 1320 r,320 1 . 1 5 5
l0 Rambutan 2 2 2 2 2 t8 23 r9 t9 9 48 54 43 43 320 804 921 942 942 320
It Muara Padang 7 7 7 7 7 27 58 47 47 54 99 67 42 42 il9 2,@7 2.067 1,974 1,974 2,078
12 Tungkalllirt

l3 Tanjung Lago*
14 Muara Sugihan*
t5 Air Salek*

Jumlah 30 36 2?3 MB 635 66 M & 12,lU 12.69

Sumber: RanyuasinDalam Angka Tahun2@2 - 2M


K€t : * Data masihtergabungdalam kecamataninduk

L-42
Tabel lamplran - 43

JumlahSekolah,RuangKelas,Guru dan Murid SLTPSwasta


Tahun 2OO2- 2OO5
per Kecamatandi KabupatenBanyuasin

I BanyuasinIll 6 6 6 6 5 26 27 34 34 35 59 126 68 68 r06 751 742 866 866 837


2 PulauRimau 6 7 7 7 6 12 27 27 27 l3 76 63 61 6l 63 689 898 827 827 690
3 RantauBayur I I I I 3 3 3 3 3 t8 l8 7 7 t5 t0t l06 97 97 8t
4 Betung 4 4 4 4 4 22 33 26 26 30 7l 87 42 42 84 r,139 1.202 1,146 1 , 1 6 1,132
5 Talang Kelapa 3 2 3 3 6 t6 t3 2l 2l 26 52 26 39 39 92 8il 577 543 543 t,167
6 Banyuasinll I 5 5 270
7 Muara Telang 3 5 4 4 4 9 16 t7 17 l6 32 62 38 38 54 375 525 623 623 547
8 Makarti Jaya 2 2 I I 2 6 6 8 8 9 27 t3 9 9 25 231 211 84 84 283
9 Banyuasin
I 4 6 5 5 7 25 22 26 26 36 55 95 54 54 107 &9 668 666 666 903
lo Rambutan l I I I 7 6 7 7 lo l9 t9 t2 t2 23 280 222 255 255 321
ll Muara Padang 2 2 4 4 2 6 6 ll ll 6 20 39 l08 t08 27 182 280 372 372 220
t2 Tungkallllr*
t3 Tanjung Lagoi

14 Muara Sugihani

15 Alr Salekt

Jumlah 33 38 t38 r80 54 596 5,478

fumbr: Ranytadn Dalam Angka Tahun 2@2 - 2OO6


Ket : * Datamasihtergabung
dalamkecamatan
induk

L- 43
TabelLamplran- 44

JumlahSekolah,
RuangKelas,GurudanMurid MTs.Swasta
perKecamatan
di Kabupaten
BanyuasinTahun2OO2- 2OO5

I Banyuasin
Ill I 6 5 6 7 27 49 t9 24 27 124 128 112 133 r50 r,538 t,980 1.235 1.305 t.Q7
2 PulauRimau 5 7 8 8 8 t5 l9 6 32 24 36 56 25 122 t25 857 380 589 574 608
3 RantauBayur I I 2 2 3 3 t2 6 l5 15 t6 l9 34 147 99 ll9 205 24
4 Betung 2 3 3 3 3 3 9 12 l8 9 30 & 64 48 59 313 172 231 268 309
5 TalangKelapa 3 4 3 6 6 l3 22 20 36 l8 45 49 66 62 83 464 281 250 349 341
6 Banyuasin
ll 3 3 3 3 3 9 I 3 l8 9 37 36 l8 30 35 48 242 208 188 214
7 MuaraTelang 5 7 3 6 6 l8 22 36 36 l8 57 77 36 93 9 882 613 617 678 773
I Makarti Jaya 3 3 3 2 3 9 t4 3 l8 9 28 4 t7 41 56 451 260 227 160 257
9 BanyuasinI 5 5 5 5 3 16 6 30 l5 l0 57 31 66 80 176 478 470 532 665
lo Rambutan 4 I I I l3 3 3 6 3 36 t4 t6 l8 23 581 32 q 63 94
ll Muara Padang 8 6 7 6 7 27 2l 36 36 21 il9 8l 78 82 98 1.427 727 790 673 771
l2 Tungkallllrr
l3 Tanjung lagoi

14 Muara Sugihan*
l5 Air Saleki

Jumlah 43 42 48 5l l& 26 159 7s2 4,995

ium&r: Banytasln Dalam Angka Tahun 2@2 - 20O5


Ket : * Data masihtergabungdalam kecamataninduk

L-4
Tabel lamplran - 45

JumlahSekolah,RuangKelas,Guru dan Murid SMU Negeri


Tahun 2OO2- 2006
per Kecamatandi KabupatenBanyuasin

I Banyuasin
lll I I 2 z 2 l2 14 20 20 24 33 38 38 38 70 470 583 60s @5 664
2 PulauRimau I I 2 3 3 5 l3 I I 23 79 l8l l8l 337
3 RantauBayur
4 Betung I I I 8 l0 t2 12 l0 2l 25 l8 l8 35 469 &6 439 439 493
5 TalangK.elapa I I 2 l2 12 14 14 t4 26 $ 42 42 53 397 549 585 585 607
6 Banyuasinll I 3 3 5 I I l9 77 77 203
7 Muara Telang I I I 6 9 9 9 9 16 20 6 6 2l 3r9 341 332 332 372
I Makarti Jaya I I 4 6 6 9 17 n ll 32 309 436 436 482
9 BanyuasinI I I I 6 l0 12 12 19 26 27 25 25 35 413 48 459 459 467
l0 Rambutan I I 2 6 6 9 t6 t8 l8 27 2@ 306 306 305
ll Muara Padang 2 2 2 2 2 9 l8 l8 t8 20 33 4 12 t2 33 793 804 726 726 667

t2 Tungkallllr*
l3 TanjungLagot
14 Muara Sugihan*

l5 Air Salek*

Juralah 7 rc t2 u2 t* f;t 8t IB @ r* 155 216 172 t':2 w 2,861 t,7r9 1,1# 4.r# 4,597

lumbr: RanyuaslnDalam Angka Tahun 2@2 - 2N5


Ket : * Data masihtergabungdalam kecamataninduk

L- 45
Tabel lampiran - 46

JumlahSekolah,RuangKelas,Gurudan Murid SMU Swasta


per Kecamatandi KabupatenBanyuasinTahun 2OO2- 2006

I Banyuasinlll 4 4 4 4 4 3l 22 22 22 34 83 il9 72 72 112 r.o50 972 1,O76 1,076 1.r87


2 PulauRimau I I I 5 ll ll 19 62 62 142
3 RantauBayur
4 Betung 2 3 3 3 3 9 20 t7 17 25 38 41 55 55 66 63s 791 r,050 t,050 9il

5 TalangKelapa I I I 3 2 5 7 7 t6 l5 t9 t7 t7 63 180 264 256 256 482


6 Banyuasin
ll I I
I I 3 3 3 3 9 l8 9 9 63 73 96 96
7 MuaraTelang I I
I
1 I 4 5 5 6 l9 t8 r8 l9 125 125 r90 190 179
8 MakartiJaya I I I I 3 3 3 3 2 9 t3 8 8 l5 59 27 21 2l 71
9 Banyuasin
I 4 4 3 3 3 9 17 25 25 l8 2l 58 37 37 58 &5 557 537 637 496
l0 Rambutan
il Muara Padang I I I 3 2 I 8 t8 l2 12 34 6 46 46 46 ll0

t2 Tungkallllr*
l3 Tanjung Lago*
t4 Muara Sugihant

r5 Air Salekr

Jumlah l5 t6 t6 l8 t8 57 75 82 82 114 175 305 ain 239 3U6 2.573 2,8s5 3,434 3,434 3,578

tumber: EanyuasinDalam Ang*a Tahun 2@2 - 2M


Ket : * Data masihtergabungdalam kecamataninduk

L-46
Tabel Lampiran- 47

JumlahSekolah,RuangKelas,Guru dan Murid MadrasahAliyahNegeri


per Kecamatandi KabupatenBanyuasinTahun 2OO2- 2006

1 Banyuasin
lll I I I I 314 6 r3 t5 9 l5 38 28 45 33 44 480 419 447 407
2 PulauRimau
3 RantauBayur
4 Betung
5 TalangKelapa

6 Banyuasin
ll

7 MuaraTelang

8 Makarti Jaya

I Banyuasln
I
l0 Rambutan
ll Muara Padang

t2 Tungkalllir*

t3 Tanjung Lago^
14 Muara Sugihani

r5 Air Salekr

Jumlah I I I I 314 6 t3 t5 I r5 38 a 45 :til +4 {*. 419 M7 &7 I

Sumber: Ranyuailn Dalam Angka Tahun 2OO2- 2M


Ket ; * Datamasihtergabung
dalamkecamatan
induk

L- 47
Tabel Lampiran- 48

JumlahSekolah,RuangKelas,Guru dan Murid MadrasahAliyah Swasta


per Kecamatandi KabupatenBanyuasinTahun 2OO2- 2006

I BanyuasinIll 3 3 3 3 3 l8 17 l0 9 t2 79 67 71 73 79 &5 s73 648 883 545


2 PulauRimau I I I I I 3 3 3 3 3 lt ll lt t4 62 8l 68 59
3 RantauBayur I 3 9 30
4 Betung l 2 4 5 l2 23 & t30
5 TalangKelapa 3 3 3 3 3 I 8 9 9 9 52 4l 49 49 46 267 187 r35 184 133
6 Banwasinll I 3 14 58
7 MuaraTelang I 3 4 5 5 5 9 12 t3 l5 14 35 42 28 78 )) t59 149 114 324
8 MakartiJaya I I I I I 2 3 3 3 3 9 17 l9 28 27 l6 114 120 87 104
9 Banyuasin
I 2 2 2 I 5 8 6 6 3 14 21 33 33 17 62 128 145 55 98

l0 Rambutan z 5 l9 l05
lt Muara Padang 2 3 3 2 2 5 6 9 6 6 t2 35 4 47 25 6l 2@ 196 120 142
t2 Tungkallllr*
13 Tanjung Lago*
t4 Muara Sugihant

15 Air Salek*

Jumlah t5 l8 r7 17 18 58 f9 a, q) v 23r 239 27i' z'1, :m I,t(N l.56t 1,474 rJil 1,463

Sumber: Banytadn Dalam Angka Tahun 2@2 - 2OO5


Ket : * Data masihtergabungdalam kecamataninduk

L-48
Tabel Lampiran- 49

Nilai dan KualitasObyek dan DayaTarikWisata(ODTW) KabupatenBanyuasin

Sarana
Prasarana
N SumberDayaWisata lfualitasLingkungan
o
NamaObyek Ragam Kualitas
A B c Jrnl D E F Jml G H I Jml J K L Jml

I TamanNasionalSembilang 3 3 3 9 I I I
3 I 1 I
I 3 3 3 3 9

2 HabitatGajahAir Sugihan 2 2 I 5 I I 3 I I I
I 3 3 3 3 9

3 Perkebunan
PTPNVll. Melania 1 I
I 3 2 2 2 6 2 2 2 6 3 2 3 8

4 Perkebunan
Sembawa I 1
I 3 2 2 3 7 2 2 2 6 3 2 3 8
Perkebunan
KelapaSawitMas
5 1 I 3 1 I 3 I
I I I 3 3 3 3 9
Lanskan
Perkebunan
KelapaSawitSungai
6 I I 3 I 3 I I I 3 3 3 3 9
Rengit
7 HutanWisataP. Kemamoo I I 3 I I 3 I I I 3 3 3 3 9

I Bom BerlianPangkalan
Balai I I 3 1 I 3 I I t
I 3 3 3 3 9

9 PantaiKawasanPesisir
DesaPejaye I I 3 I I 3 I I 3 3 3 3 9

t0 Perkampungan
NelayanSungsang 3 2 2 7 2 3 2 7 I 2 2 5 I I I 3
'|
1l MakamDemangLebarDaun I 3 I I I 3 I I 3 3 3 3 9

12 Monumen5ilkAir I I 2 4 1 1 I 3 I I 3 3 3 3 9
A: lGunikan D: RagamPraoranaTrans, G: Prasaana
Transportad t. Irondisitjrgk Fislk

B: RagamDayaTarik Ez RagamUtilltas H: Utilltrj K: Kepdtan.llrgk.terbengun

C: Wsatswan F: R.agam
saranaPenunJang l: SaranaPenunjang L: Luar lahan

L-49
TabelLampiran- 50

Banyaknya
Krapasltas
Produksi,
Air MinumYangDidistribuslkan
danJumlahPelanggan
Air Minum
dl Kabupaten Tahun2OO2- 2006
Banyuasin

I lGpasitas(M3)
CabangPangkalan
Balai 233.280 135.080 20r.888 182,749 371.836
CabangBetung 354.420 415.584 443.232 497,664 552.096
Air Batu
Cabang 38,880 38,880 27.000 25,920 26,940
Cabang
5ungaiPinang 3il.040 3il.040 259.200 252.720 319.128
CabangMariana 233,280 233.280 272.460 268,154 353.r 63
Jumlah I,170,9ff) 1,134,864 1,203,780 1,227,207 1,623,163
2. Alr Yang Dldlstribusikan(M3)
CabangPangkalan
Balai 222,804 129,959 r90.848 174,745 358,393
- CabangBetung 33r,776 383.616 412.128 454,356 496,588
CabangAir Batu 38.880 38,880 24,300 19,440 20,o40
- CabangSungaiPinang 181.520 l8l.zf40 233.280 217.728 21o,420
Mariana
Cabang 233.280 233.280 252,720 250,644 266,722
Jumlah t,0082@ 967,185 l,lll,276 I,ll6,913 1,352,163
3. Jumlah Pelanggan(RT)
CabangPangkalanBalai 773 674 437 519 772
CabangBetung 839 963 1,039 1,089 1,143
- CabangAir Batu 92 82 75 85 75
CabangSungaiPinang 503 613 686 756 792
CabangMariana 578 585 671 684 725
Jumlah 2,885 2,917 2.908 3,133 3,fr7
Sumber : PDAM Cabang PangkalanBalai, Retung,Air Batu, SungaiPlnang dan Mariana

L-50
TabelLampiran- 5l

PanjangJalan,Jembatandan StatusJalanDirinciMenurutJenis
di KabupatenBanyuasin

I JenisPermukaanJalan
a. AspalHotmix 150.90 263.10 223.50 256.60 395.00
b. AspalLapen il7.00 289.1O 172.50 179.1O
c. JalanCor 529.10
d. Kerikil/BatuPecah 158.24 498.70 160.50
e. Tanah 33.20 151.40 430.40
f. Burda 27.OO
g. JalanLain$idak dirinci) 2.331.16 r 33.60 19.80
Total 2,817.50 r"202.30 I,1205' 256.@ I,124.00
tl JenisJembatan
a. Beton Lebar5 meter r95.OO 2.941.50 7U.50 764.50 94r'',50
b. BetonLebar2.5 m - 3 m 800.00 2.314.00 2.217.OO 2.217,OO 2.403.OO
c. RangkaBesi 398.00 350.00 273.OO 273.OO 273.OO
JembatanPipa EksPertaminadan 1.090.00 r,090.00
d.

e. LainCridakDirinci)
Jembatan 2.454.OO 1.364.OO 1,364.00
Total 1,394.00 5,605JO 5,708.50 5,708.50 6;474.fi
ill Status
Jalan
a. JalanNegara 221.30 67.@ 61.00 61.00 61.00
b. JalanPropinsi 240.O5 208.00 82.00 82.OO 82.OO
c. JalanKabupaten 2,817.50 927.30 977.50 98r.00 98r.00
Total 1,124.
Jumber: Dinas Pekerjaan Umum Rlna Marga lGbupaten Banytasin

L-5r
Tabel Lampiran- 52

JumlahKendaraan
AngkutanDaratDirinciMenurutJenisnya
di Kabupaten
Banyuasin

I BusUmum 73 220 170 171 71


2 BusBukanUmum l0 30 I t2 il

3 Mobil Penumpang 104 2 376 397 429


4 TrukUmum 20 7
5 TrukBukanUmum 268 131 949 793 499
6 PickUp Umum 46 to
7 PickBukanUmum 126 97 582 506

Sumber: DlnasPerhubungan
KabupatenRanytasin

L- 52
Tabellampiran- 53

JumlahSaranaAngkutanSungaiMenurutJenisnya
di Kabupaten
Banyuasin

I AngkutanPenumpang
SpeedBoatKecil E E E 267 267
2 AngkutanPenumpang
SpeedBoatBesar E tr E 23 23
3 AngkutanBarangJukung E E E 270 270
4 AngkutanBarangTugBoat E E E 3 3
5 AngkutanBarangKetek E E tr 1,200 1,200
6 AngkutanBarangTongkang rt
H E E 65 65
7 KapalNelayaVPompong E E E 2,987 2,887
Jumlah E E E 4,715 4,715
fumber : Dinas Perhubungan lGbupaten Ranytasin

lQt : f,l Data tidak teredia

L-53
Tabel Lampiran- 54

Kondisidan PerkembanganJaringanlrigasi
di KabupatenBanyuasin

Tahun2OO3 Tahun2fl)4 Tahun2005


No JenisSaluran
Panjang Kondid Panfang Kondlsi Panjang Kondiri
(Km) Rusak(Km) Km) Rusak(Km) (kn) Rusak0h)
I 5aluranPrimer
1 . 1 8 1 . 4 6 86.673.OO I,181.45 86,673.00 I,181.45 77,641.00
2 SaluranSekunder
l,8l6.ol 242.7'.13.OO l,8l6.ol 233,416.@ r,8r5.ol r9r.916.00
3 5aluranTersier
5.000.35 2,978.O3 s,000.36 275.O3 5.000.36 197.40
4 PintuAir 451 Unit 93 Unit 451 Unit 93 Unit 461 Unit 82 Unit

5 JembatanPenghubung 1226 m 143Unit 1226 m 137Unit 1239m l12Unit

Sumber: Dinas Pekerjaan Umum PengahanlGbupaten Banyuasin

L- 54
Tabel Lampiran- 55

Kapasitas
Sentraldan JumlahSambungan TeleponMenurutKecamatan
di KabupatenBanyuasin

Pelanggan
No l(ecamatan Bisnls Perumahan Sosial

2op'2 2qr3 2ofn 2@5 2ffi 2q}2 2@3 M 2(n5 2@6 m, 21x)3 2W 2qr5 2m6

1 RantauBayur n tr n
2 Betung tr 72 73 94 29 tr 551 543 607 692 n 623
3 Banyuasin
lll tr 39 44 45 rr 557 566 565 tr 596
4 PulauRimau tr 17 rt 614 n
5 TalangKelapa I-r 436 436 r.084 1,084 tr 1.937 1.937 10.228 10.228 E 2.373 23 23
6 Banyuasin
I E t9 19 tr 186 r85 E 205
7 Rambutan tr tr tr
I rt n
Muara Padang A tr
9 Banyuasin
ll tr l3 l3 9 9 tr 141 t4l 137 137 n 154
l0 MakartiJaya tr tr H

1t
tl Muara Telang n E H

t2 Tungkalllir t E E E
l3 TanjungLago* tr tr H

14 Muara Sugihantr n tr tr
l5 Air Salek* tr H H
A

Jumlah E 579 585 r.233 1,139 tr 3,372 3,373 11.537 ll,67l E 3,951 23 23
Sumber : BanyuasinDalam Angka Tahun 2N2 - 2OO5
Ket : * Datamasihtergabungdalamkecamataninduk

E DataTidakTersedia

L-55
fabel Lampiran- 56

JumlahPelanggan,
KVATersambung dan Pemakaian
EnergiListrik
di KabupatenBanyuasin

Kelompok
No
Pemakai
2(x)3 2004, 2@5 2W 2003 2004 2005 2006 2003 2W 2@5 2006
I Sosial 405 503 376 376 603 746 347.5 347.5 947.O57 102.248 42.598 42,598
2 RumahTangga 34.129 r8,570 14.783.0 1.954.102
26,582 35,s60 35.560 23.973 14,783.O 26,931,388 3.O54.340 1.954.102
3 Bisnis 520 684 684 684 r,089 t,678 1,741.O 1,741.O 1.671.591 205.258
245.670 205,258
4 lndustri 9 I 3 3 516 384.5 384.5 r.888.481 39,420 39.420
5.984 22.791.331
5 Pemerintah 93 112 ll6 il6 38r 850.O 850.0 499.637 92,983 99,O87 99.O87
4.456
Penerangan
6 20 24 29 29 il8 140 r81.8 18r.8 263,180 36,234 31,282 31.282
Jalan

JUMLAH 27.629 35,560 36.768 36,768 26,745 3r,509 18,287.8 18,287.8 53,104,t84 5,4r9,956 2,37r,747 2,371.747

Sumber: PerusahaanListrik Negara CabangPalembang

Ket : r Data tidak tersedia

L-56
- 57
TabelLampiran

Rencana
Pengembangan dan FungsiPusat-Pusat
Permukiman
di Kabupaten
Banyuasin
sampaiTahun 20L3
hrsat PelayananYang di Skala Fungsl
No Kota Bldang Pelayanan
Usulkan Pelayanan 1 2 3 4 5 6
I PusatUtama(OrdeI) Pangkalan
Balai Regional .:. * .:. a .:. €. Pemerintahan
Betung * .:t o a * * Pendidikan
Jasadan Perdagangan
:l L. r--i LI fl ii Industri
at i-r
i- I Agrobisnis
tl rl t'r r-_l [ ]
Sub
u SubPusat(OrdeII) Sukajadi
Reqional
* * * .:r .:. o Jasadan Perdagangan

Mariana * a * {. .:. * IndustriPengolahan


Tanjung
Api-Api tt tl D o o o Permukiman
L] il !l ti LI Pelabuhan
Samudra
! I Ll

SubSubPusat(Ordetr) TelangJaya Lokal * * o .& a o Pertanian


Tanaman
Pangan
MakartiJaya t .3. o il .:. o Perkebunan
SumberMakmur €. * o .:. tr* Perikanan
TelukBetung a * d u a ct Pertambangan
TebingAbang * * o * 3
Sungsang a * o o * u
Sumber:RTRWKobupoten
Bonyuosin
Keterangan : €. FungsiYangsudahada
O Pengembangan fungsibaru
1. Pusatpelayanan
wilayah 4. Pelabuhan/Dermaga
2. Permukiman 5.Perdagangan/asa
3.Industri 6. Transportasi/Telekomunikasi

L-57

Anda mungkin juga menyukai