Anda di halaman 1dari 46

BAB I

PENDAHULUAN

A. Latar Belakang
Glomerulonefritis akut merupakan penyakit ginjal noninfeksius yang
paling umum pada masa kanak-kanak, glomerulonefritis akut memengaruhi
glomerulus dan laju filtrasi ginjal, yang menyebabkan retensi natrium dan air,
serta hipertensi. Biasanya disebabkan oleh reaksi terhadap infeksi streptokokus,
penyakit ini jarang memiliki efek jangka panjang pada system ginjal (Kathhleen,
2008). Glomerulonefritis akut memengaruhi anak laki-laki lebih sering daripada
anak perempuan, dan biasanya terjadi pada usia sekitar 6 tahun. Terapi yang
biasa diberikan mencakup pemberian antibiotic, antihipertensi, dan diuretic juga
restriksi diet. Komplikasi potensial meliputi hipertensi, gagal jantung kongestif,
dan penyakit ginjal tahap akhir.
Di Indonesia tahun 1980, Glomerulonefritis menempati urutan pertama
sebagai penyebab penyakit ginjal tahap akhir dan meliputi 55% penderita yang
mengalami hemodialisis. (Kathhleen, 2008). Insidens tidak dapat diketahui
dengan tepat, diperkirakan jauh lebih tinggi dari data statistik yang dilaporkan
oleh karena banyaknya pasien yang tidak menunjukkan gejala sehingga tidak
terdeteksi. Kaplan memperkirakan separuh pasien glomerulonefritis akut
pascastreptokok pada suatu epidemi tidak terdeteksi.
Glomerulonefritis akut pascastreptokok terutama menyerang anak pada
masa awal usia sekolah dan jarang menyerang anak di bawah usia 3 tahun.
Perbandingan antara anak laki-laki dan perempuan adalah 2:1. Hasil penelitian
multicentre di Indonesia pada tahun 1988, melaporkan terdapat 170 pasien yang
dirawat di rumah sakit pendidikan dalam 12 bulan. Pasien terbanyak dirawat di

1
Surabaya (26,5%), kemudian disusul berturut-turut di Jakarta (24,7%), Bandung
(17,6%) dan Palembang (8,2%). Pasien laki-laki dan perempuan berbanding
1,3:1 dan terbanyak menyerang anak pada usia antara 6-8 tahun (40,6%).
Penyakit ini lebih sering terjadi pada musim dingin dan puncaknya pada musim
semi.
Maka sesuai dengan peran dan fungsi perawat adalah sebagai pelaksana
Asuhan keperawatan mencakup aspek preventif, promotif dan rehabilitative ingin
berpartisipasi melakukan asuhan keperawatan sehingga penulis tertarik
mengambil judul “Asuhan Keperawatan Pada An. Dengan GNA”.

B. Tujuan Penulisan
1. Tujuan umum
Agar mahasiswa memahami tentang Asuhan Keperawatan Pada An. Dengan
Glomerulo Nefritis Akut (GNA)
2. Tujuan Khusus
Setelah melakukan asuhan keperawatan pada Klien dengan Glomerulo
Nefritis Akut diharapkan:
a. Mampu memahami tentang konsep medis mulai dari definisi sampai
dengan komplikasi serta prognosis Glomerulo Nefritis Akut.
b. Mampu melakukan pengkajian pada anak dengan Glomerulo Nefritis
Akut (GNA)
c. Mampu menentukan masalah keperawatan pada anak dengan
Glomerulo Nefritis Akut (GNA)
d. Mampu merencanakan tindakan keperawatan pada anak dengan
Glomerulo Nefritis Akut (GNA)
e. Mampu melaksanakan tindakan keperawatan pada anak dengan
Glomerulo Nefritis Akut (GNA)
f. Mampu melakukan evaluasi keperawatan pada anak dengan
Glomerulo NefritisAkut (GNA)

2
g. Mampu mendokumentasikan asuhan keperawatan pada anakdengan
Glomerulo Nefritis Akut (GNA)

C. Metode Penulisan
Dalam pembuatan makalah ini kami mengggunakan metode penulisan
study kepustakaan dan pengambilan data melalui internet dan beberapa sumber
yang lain.

D. Sistematika Penulisan
1. Kata pengantar
2. Daftar isi
3. BAB I PENDAHULUAN yang terdiri dari : latar belakang, tujuan penulisan,
metode penulisan, dan sistematika penulisan.
4. BAB II TINJAUAN TEORITIS : A. Konsep Dasar Medis : pengertian,
etiologi, patofisiologi, manifestasi klinis, pemeriksaan diagnostik,
penatalaksanaan, komplikasi, prognosis B. Konsep Dasar Keperawatan :
pengkajian, diagnosa keperawatan, rencana keperawatan, evaluasi.
5. BAB III terdiri dari : kesimpulan dan saran
6. Daftar Pustaka.

3
BAB II

PENDAHULUAN

A. Konsep Dasar Medis


1. Pengertian
Glomerulonefritis akut merupakan penyakit ginjal noninfeksius yang
paling umum pada masa kanak-kanak, glomerulonefritis akut memengaruhi
glomerulus dan laju filtrasi ginjal, yang menyebabkan retensi natrium dan
air, serta hipertensi. Biasanya disebabkan oleh reaksi terhadap infeksi
streptokokus, penyakit ini jarang memiliki efek jangka panjang pada system
ginjal. (Kathhleen, 2008).
Glomerulonefritis akut memengaruhi anak laki-laki lebih sering
daripada anak perempuan, dan biasanya terjadi pada usia sekitar 6 tahun.
Terapi yang biasa diberikan mencakup pemberian antibiotic, antihipertensi,
dan diuretic juga restriksi diet. Komplikasi potensial meliputi hipertensi,
gagal jantung kongestif, dan penyakit ginjal tahap akhir.
GNA adalah suatu reaksi imunnologi pada ginjal terhadap bakteri
atau virus tertentu. Yang sering ialah infeksi karena kuman streptococcus.
Data ini sering ditemukan pada anak berumur antara 3-7 tahun dan lebih
sering mengenai anak pria dibanding anak perempuan. GNA didahului oleh
adanya infeksi ekstra renal terutama di traktus respiratorius bagian atas atau
kulit oleh kuman streptococcus beta hemolyticus golongan A, tipe 12, 4, 16,
25, dan 40. Hubungan antara GNA dan infeksi streptococcus ini ditemukan
pertama kali oleh Lohlein pada tahun 1907 dengan alasan bahwa:
1. Timbulnya GNA setelah terjadinya infeksi skarlatina
2. Diisolasinya kuman streptococcus beta hemolyticus golongan A

4
3. Meningkatnya titer anti streptolisin pada serum pasien.
Glomerulo Nefritis Akut (GNA) adalah istilah yang secara luas
digunakan yang mengacu pada sekelompok penyakit ginjal dimana inflamasi
terjadi di glomerulus. (Brunner & Suddarth, 2001). Glomerulo Nefritis Akut
(GNA) adalah bentuk nefritis yang paling sering pada masa kanak-kanak
dimana yang menjadi penyebab spesifik adalah infeksi streptokokus.
(Sacharin, Rosa M, 1999). GNA adalah reaksi imunologi pada ginjal
terhadap bakteri atau virus tertentu. Yang sering terjadi ialah akibat infeksi
kuman streptococcus, sering ditemukan pada usia 3-7 tahun (Kapita Selecta,
2000).
Kesimpulan, Glomerulo Nefritis Akut (GNA) adalah suatu reaksi
imunologis ginjal terhadap bakteri / virus tertentu. Yang sering terjadi ialah
akibat infeksi kuman streptococcus, sering ditemukan pada usia 3-7 tahun.

2. Anatomi Fisiologi
Anatomi Ginjal
a. Makroskopis
Ginjal terletak dibagian belakang abdomen atas, dibelakang
peritonium (retroperitoneal), didepan dua kosta terakhir dan tiga otot-
otot besar (transversus abdominis, kuadratus lumborum dan psoas
mayor) di bawah hati dan limpa. Di bagian atas (superior) ginjal
terdapat kelenjaradrenal (juga disebut kelenjar suprarenal). Kedua
ginjal terletak di sekitar vertebra T12 hingga L3. Ginjal pada orang
dewasa berukuran panjang 11-12 cm, lebar 5-7 cm, tebal 2,3-3 cm,
kira-kira sebesar kepalan tangan manusia dewasa. Berat kedua ginjal
kurang dari 1% berat seluruh tubuh atau kurang lebih beratnya antara
120-150 gram.
Bentuknya seperti biji kacang, dengan lekukan yang menghadap
ke dalam. Jumlahnya ada 2 buah yaitu kiri dan kanan, ginjal kiri lebih

5
besar dari ginjal kanan dan pada umumnya ginjal laki-laki lebih panjang
dari pada ginjal wanita. Ginjal kanan biasanya terletak sedikit ke bawah
dibandingkan ginjal kiri untuk memberi tempat lobus hepatis dexter
yang besar. Ginjal dipertahankan dalam posisi tersebut oleh bantalan
lemak yang tebal. Kedua ginjal dibungkus oleh dua lapisan lemak
(lemak perirenal dan lemak pararenal) yang membantu meredam
guncangan.
Setiap ginjal terbungkus oleh selaput tipis yang disebut kapsula
fibrosa, terdapat cortex renalis di bagian luar, yang berwarna coklat
gelap, dan medulla renalis di bagian dalam yang berwarna coklat lebih
terang dibandingkan cortex. Bagian medulla berbentuk kerucut yang
disebut pyramides renalis, puncak kerucut tadi menghadap kaliks yang
terdiri dari lubang-lubang kecil disebut papilla renalis.
Hilum adalah pinggir medial ginjal berbentuk konkaf sebagai pintu
masuknya pembuluh darah, pembuluh limfe, ureter dan nervus. Pelvis
renalis berbentuk corong yang menerima urin yang diproduksi ginjal.
Terbagi menjadi dua atau tiga kaliks renalis majores yang masing-
masing akan bercabang menjadi dua atau tiga kaliks renalis minores.
Medulla terbagi menjadi bagian segitiga yang disebut piramid. Piramid-
piramid tersebut dikelilingi oleh bagian korteks dan tersusun dari
segmen-segmen tubulus dan duktus pengumpul nefron. Papila atau
apeks dari tiap piramid membentuk duktus papilaris bellini yang
terbentuk dari kesatuan bagian terminal dari banyak duktus pengumpul
(Price,1995 : 773).

b. Mikroskopis
Ginjal terbentuk oleh unit yang disebut nephron yang berjumlah
1-1,2 juta buah pada tiap ginjal. Nefron adalah unit fungsional ginjal.
Setiap nefron terdiri dari kapsula bowman, tumbai kapiler glomerulus,

6
tubulus kontortus proksimal, lengkung henle dan tubulus kontortus
distal, yang mengosongkan diri keduktus pengumpul. (Price, 1995)
Unit nephron dimulai dari pembuluh darah halus / kapiler,
bersifat sebagai saringan disebut Glomerulus, darah melewati
glomerulus/ kapiler tersebut dan disaring sehingga terbentuk filtrat (urin
yang masih encer) yang berjumlah kira-kira 170 liter per hari, kemudian
dialirkan melalui pipa/saluran yang disebut Tubulus. Urin ini dialirkan
keluar ke saluran ureter, kandung kencing, kemudian ke luar melalui
Uretra.
Nefron berfungsi sebagai regulator air dan zat terlarut (terutama
elektrolit) dalam tubuh dengan cara menyaring darah, kemudian
mereabsorpsi cairan dan molekul yang masih diperlukan tubuh. Molekul
dan sisa cairan lainnya akan dibuang. Reabsorpsi dan pembuangan
dilakukan menggunakan mekanisme pertukaran lawan arus dan
kotranspor. Hasil akhir yang kemudian diekskresikan disebut urin.
c. Vaskularisasi ginjal
Arteri renalis dicabangkan dari aorta abdominalis kira-kira
setinggi vertebra lumbalis II. Vena renalis menyalurkan darah kedalam
vena kava inferior yang terletak disebelah kanan garis tengah. Saat arteri
renalis masuk kedalam hilus, arteri tersebut bercabang menjadi arteri
interlobaris yang berjalan diantara piramid selanjutnya membentuk
arteri arkuata kemudian membentuk arteriola interlobularis yang
tersusun paralel dalam korteks. Arteri interlobularis ini kemudian
membentuk arteriola aferen pada glomerulus (Price, 1995).
Glomeruli bersatu membentuk arteriola aferen yang kemudian
bercabang membentuk sistem portal kapiler yang mengelilingi tubulus
dan disebut kapiler peritubular. Darah yang mengalir melalui sistem
portal ini akan dialirkan kedalam jalinan vena selanjutnya menuju vena
interlobularis, vena arkuarta, vena interlobaris, dan vena renalis untuk

7
akhirnya mencapai vena cava inferior. Ginjal dilalui oleh sekitar 1200
ml darah permenit suatu volume yang sama dengan 20-25% curah
jantung (5000 ml/menit) lebih dari 90% darah yang masuk keginjal
berada pada korteks sedangkan sisanya dialirkan ke medulla. Sifat
khusus aliran darah ginjal adalah otoregulasi aliran darah melalui ginjal
arteiol afferen mempunyai kapasitas intrinsik yang dapat merubah
resistensinya sebagai respon terhadap perubahan tekanan darah arteri
dengan demikian mempertahankan aliran darah ginjal dan filtrasi
glomerulus tetap konstan ( Price, 1995).
d. Persarafan Pada Ginjal
Menurut Price (1995) “Ginjal mendapat persarafan dari nervus
renalis (vasomotor), saraf ini berfungsi untuk mengatur jumlah darah
yang masuk kedalam ginjal, saraf ini berjalan bersamaan dengan
pembuluh darah yang masuk ke ginjal”.

Fisiologi Ginjal
Ginjal adalah organ yang mempunyai pembuluh darah yang sangat
banyak (sangat vaskuler) tugasnya memang pada dasarnya adalah
“menyaring/membersihkan” darah. Aliran darah ke ginjal adalah 1,2
liter/menit atau 1.700 liter/hari, darah tersebut disaring menjadi cairan filtrat
sebanyak 120 ml/menit (170 liter/hari) ke Tubulus. Cairan filtrat ini diproses
dalam Tubulus sehingga akhirnya keluar dari ke-2 ginjal menjadi urin
sebanyak 1-2 liter/hari.
Fungsi ginjal adalah
a. memegang peranan penting dalam pengeluaran zat-zat toksis atau racun,
b. mempertahankan keseimbangan cairan tubuh,
c. mempertahankan keseimbangan kadar asam dan basa dari cairan tubuh,
dan

8
d. mengeluarkan sisa-sisa metabolisme akhir dari protein ureum, kreatinin
dan amoniak.
e. mengaktifkan vitamin D untuk memelihara kesehatan tulang.
f. produksi hormon yang mengontrol tekanan darah.
g. produksi Hormon Erythropoetin yang membantu pembuatan sel darah
merah.

Tahap Pembentukan Urine


a. Filtrasi Glomerular
Pembentukan kemih dimulai dengan filtrasi plasma pada
glomerulus, seperti kapiler tubuh lainnya, kapiler glumerulus secara
relatif bersifat impermiabel terhadap protein plasma yang besar dan
cukup permabel terhadap air dan larutan yang lebih kecil seperti
elektrolit, asam amino, glukosa, dan sisa nitrogen. Aliran darah ginjal
(RBF = Renal Blood Flow) adalah sekitar 25% dari curah jantung atau
sekitar 1200 ml/menit. Sekitar seperlima dari plasma atau sekitar 125
ml/menit dialirkan melalui glomerulus ke kapsula bowman. Ini dikenal
dengan laju filtrasi glomerulus (GFR = Glomerular Filtration Rate).
Gerakan masuk ke kapsula bowman’s disebut filtrat. Tekanan filtrasi
berasal dari perbedaan tekanan yang terdapat antara kapiler glomerulus
dan kapsula bowman’s, tekanan hidrostatik darah dalam kapiler
glomerulus mempermudah filtrasi dan kekuatan ini dilawan oleh tekanan
hidrostatik filtrat dalam kapsula bowman’s serta tekanan osmotik koloid
darah. Filtrasi glomerulus tidak hanya dipengaruhi oleh tekanan-tekanan
koloid diatas namun juga oleh permeabilitas dinding kapiler
b. Reabsorpsi
Zat-zat yang difilltrasi ginjal dibagi dalam 3 bagian yaitu : non
elektrolit, elektrolit dan air. Setelah filtrasi langkah kedua adalah

9
reabsorpsi selektif zat-zat tersebut kembali lagi zat-zat yang sudah
difiltrasi.
c. Sekresi
Sekresi tubular melibatkan transfor aktif molekul-molekul dari
aliran darah melalui tubulus kedalam filtrat. Banyak substansi yang
disekresi tidak terjadi secara alamiah dalam tubuh (misalnya penisilin).
Substansi yang secara alamiah terjadi dalam tubuh termasuk asam urat
dan kalium serta ion-ion hidrogen. Pada tubulus distalis, transfor aktif
natrium sistem carier yang juga telibat dalam sekresi hidrogen dan ion-ion
kalium tubular. Dalam hubungan ini, tiap kali carier membawa natrium
keluar dari cairan tubular, cariernya bisa hidrogen atau ion kalium
kedalam cairan tubular “perjalanannya kembali” jadi, untuk setiap ion
natrium yang diabsorpsi, hidrogen atau kalium harus disekresi dan
sebaliknya.
Pilihan kation yang akan disekresi tergantung pada konsentrasi
cairan ekstratubular (CES) dari ion-ion ini (hidrogen dan kalium).
Pengetahuan tentang pertukaran kation dalam tubulus distalis ini
membantu kita memahami beberapa hubungan yang dimiliki elektrolit
dengan lainnya. Sebagai contoh, kita dapat mengerti mengapa bloker
aldosteron dapat menyebabkan hiperkalemia atau mengapa pada awalnya
dapat terjadi penurunan kalium plasma ketika asidosis berat dikoreksi
secara theurapeutik.

3. Etiologi
Hubungan antara GNA dan infeksi streptococcus ini ditemukan
pertama kali oleh Lohlein pada tahun 1907 dengan alasan bahwa:
1. Timbulnya GNA setelah terjadinya infeksi skarlatina
2. Diisolasinya kuman streptococcus beta hemolyticus golongan A
3. Meningkatnya titer anti streptolisin pada serum pasien.

10
Antara infeksi bakteri dan timbulnya GNA terdapat masa laten selama lebih
kurang 10 hari. Dari tipe-tipe tersebut diatas tipe 12 dan 25 lebih bersifat
nefritogen daripada yang lain. Mengapa tipe yang satu lebih bersifat
nefritogen daripada yang lainnya belum diketahui dengan jelas. Mungkin
faktor iklim atau alergi yang mempengaruhi terjadinya GNA setelah infeksi
dengan kuman Streptococcus. GNA juga dapat disebabkan oleh sifilis,
keracunan (timah hitam tridion), penyakit amiloid, thrombosis vena renalis,
purpur anafilaktoid, dan lupus erimatosis.

4. Patofisiologi
Suatu reaksi radang pada glomerulus dengan sebutan lekosit dan
proliferasi sel, serta eksudasi eritrosit, lekosit dan protein plasma dalam
ruang Bowman. Gangguan pada glomerulus ginjal dipertimbangkan sebagai
suatu respon imunologi yang terjadi dengan adanya perlawanan antibodi
dengan mikroorganisme yaitu streptokokus A.
Reaksi antigen dan antibodi tersebut membentuk imun kompleks yang
menimbulkan respon peradangan yang menyebabkan kerusakan dinding
kapiler dan menjadikan lumen pembuluh darah menjadi mengecil yang mana
akan menurunkan filtrasi glomerulus, insuffisiensi renal dan perubahan
permeabilitas kapiler sehingga molekul yang besar seperti protein
dieskresikan dalam urine (proteinuria).
a. Pathogenesis
Menurut penyelidikan klinik-imunologis dan percobaan pada binatang
menunjukkan adanya kemungkinan proses imunologis sebagai
penyebab. Beberapa penyelidik menunjukkan hipotesis sebagai berikut:
1) Terbentuknya kompleks antigen-antibodi yang melekat pada
membrane basalis glomerulus dan kemudian merusaknya
2) Proses autoimun kuman Streptococcus yang nefritogen dalam tubuh
menimbulkan badan autoimun yang merusak glomerulus

11
3) Streptococcus nefritogen dan membrane basalis glomerulus
mempunyai komponen antigen yang sama sehingga dibentuk zat
anti yang berlangsung merusak membrane basalis ginjal
b. Patologi
Makroskopis ginjal tampak agak membesar, pucat dan terdapat titik-titik
perdarahan pada korteks. Mikroskopik tampak hampir semua
glomerulus terkena sehingga dapat disebut glomerulus difus. Tampak
proliferasi sel endotel glomerulus yang keras sehingga mengakibatkan
lumen kapiler dan ruang simpai Bowman menutup. Disamping itu
terdapat pula infiltrasi sel epitel kapsul, infiltrasi sel polimorfonukleus
dan monosit. Pada pemeriksaan mikroskop electron akan tampak
membrane basalis menebal tidak teratur. Terdapat gumpalan humps di
subepitelium yang mungkin dibentuk oleh globulin-gama, komplemen
badan antigen streptokokus.

5. Komplikasi
Komplikasi glomerulonefritis akut:
a. Oliguri sampai anuria yang dapat berlangsung 2-3 hari. Terjadi sebagai
akibat berkurangnya filtrasi glomerulus. Gambaran seperti insufisiensi
ginjal akut dengan uremia, hiperfosfatemia, hiperkalemia dan hidremia.
Walaupun oliguria atau anuria yang lama jarang terdapat pada anak, jika
hal ini terjadi diperlukan peritoneum dialisis (bila perlu).
b. Ensefalopati hipertensi, merupakan gejala serebrum karena hipertensi.
Terdapat gejala berupa gangguan penglihatan, pusing, muntah dan
kejang-kejang. Hal ini disebabkan karena spasme pembuluh darah lokal
dengan anoksia dan edema otak.
c. Gangguan sirkulasi berupa dipsneu, ortopneu, terdapat ronki basah,
pembesaran jantung dan meningginya tekanan darah yang bukan saja
disebabkan spasme pembuluh darah tetapi juga disebabkan oleh

12
bertambahnya volume plasma. Jantung dapat membesardan terjadi gagal
jantung akibat hipertensi yang menetap dan kelainan di miokardium.
d. Anemia yang timbul karena adanya hipervolemia disamping sintesis
eritropoietik yang menurun.
e. Gagal Ginjal Akut (GGA)

6. Menifestasi klinis
a. Hematuria (urine berwarna merah kecoklat-coklatan)
b. Proteinuria (protein dalam urine)
c. Oliguria (keluaran urine berkurang)
d. Nyeri panggul
e. Edema, ini cenderung lebih nyata pada wajah dipagi hari, kemudian
menyebar ke abdomen dan ekstremitas di siang hari (edema sedang
mungkin tidak terlihat oleh seorang yang tidak mengenal anak dengan
baik).
f. Suhu badan umumnya tidak seberapa tinggi, tetapi dapat terjadi tinggi
sekali pada hari pertama.
g. Hipertensi terdapat pada 60-70 % anak dengan GNA pada hari pertama
dan akan kembali normal pada akhir minggu pertama juga. Namun jika
terdapat kerusakan jaringan ginjal, tekanan darah akan tetap tinggi
selama beberapa minggu dan menjadi permanen jika keadaan
penyakitnya menjadi kronik.
h. Dapat timbul gejala gastrointestinal seperti muntah, tidak nafsu makan,
dan diare.
i. Bila terdapat ensefalopati hipertensif dapat timbul sakit kepala, kejang
dan kesadaran menurun.
j. Fatigue (keletihan atau kelelahan).

13
7. Pemeriksaan Diagnostik
a. Laju Endap Darah (LED) meningkat
b. Kadar Hb menurun sebagai akibat hipervolemia (retensi garam dan air)
c. Nitrogen urea darah (BUN) dan kreatinin darah meningkat bila fungsi
ginjal mulai menurun.
d. Jumlah urine berkurang
e. Berat jenis meninggi
f. Hematuria makroskopis ditemukan pada 50 % pasien.
g. Ditemukan pula albumin (+), eritrosit (++), leukosit (+), silinder
leukosit dan hialin.
h. Titer antistreptolisin O (ASO) umumnya meningkat jika ditemukan
infeksi tenggorok, kecuali kalau infeksi streptokokus yang mendahului
hanya mengenai kulit saja.
i. Kultur sampel atau asupan alat pernapasan bagian atas untuk
identifikasi mikroorganisme.
j. Biopsi ginjal dapat diindikasikan jika dilakukan kemungkinan temuan
adalah meningkatnya jumlah sel dalam setiap glomerulus dan tonjolan
subepitel yang mengandung imunoglobulin dan komplemen.

8. Penatalaksanaan
a. Penatalaksanaan medis
Tidak ada pengobatan yag khusus yang memengaruhi penyembuhan
kelainan di glomerulus.
1) Istirahat mutlak selama 3-4 minggu. Dahulu dianjurkan selama 6-
8 minggu. Tetapi penyelidikan terakhir dengan hanya istirahat 3-4
minggu tidak berakibat buruk bagi perjalanan penyakitnya.
2) Pemberian penisilin pada fase akut. Pemberian antibiotic ini tidak
memengaruhi beratnya glomerulonefritis, melainkan mengurangi
menyebarnya infeksi streptococcus yang mungkin masih ada.

14
Pemberian penisilin dianjurkan hanya untuk 10 hari. Pemberian
profilaksi yang lama sesudah nefritisnya sembuh terhadap kuman
penyebab tidak dianjurkan karena terdapat imunitas yang menetap.
Secara teoretis anak dapat terinfeksi lagi dengan kuman neritogen
lain, tetapi kemungkinan ini sangat kecil.
3) Makanan pada fase akut diberikan makanan rendah protein (1 g/kg
BB/hari) dan rendah garam (1g/hari). Makanan lunak diberikan
pada pasien dengan suhu tinggi dan makanan biasa bila suhu
normal kembali. Bila ada anuria atau muntah, diberikan IVFD
dengan larutan glukosa 10%. Pada pasien dengan tanpa
komplikasi pemberian cairan disesuaikan dengan kebutuhan,
sedangkan bila ada komplikasi seperti ada gagal jantung, edema,
hipertensi dan oliguria, maka jumlah cairan yang diberikan harus
dibatasi.
4) Pengobatan terhadap hipertensi. Pemberian cairan dikurangi,
pemberian sedative untuk menenangkan pasien sehingga dapat
cukup beristirahat. Pada hipertensi dengan gejala serebral
diberikan reserpin dan hidralazin. Mula-mula diberikan reserpin
sebanyak 0,07 mg/kg BB secara intramuscular. Bila terjadi
dieresis 5-10 jam kemudian, selanjutnya pemberian sulfat
parenteral tidak dianjurkan lagi karena memberi efek toksis.
5) Bila anuria berlangsung lama (5-7hari), maka ureum harus
dikeluarkan dari dalam darah. Dapat dengan cara peritoneum
dialysis, hemodialisisi, tranfusi tukar dan sebagainya.
6) Diuretikum dulu tidak diberikan pada glomerulonefritis akut,
tetapi akhir-akhir ini pemberian furosamid (Lasix) secara
intravena (1mg/kg BB/kali) dalam 5-10 menit tidak berakibat
buruk pada hemodinamika ginjal dan filtrasi glomerulus.

15
7) Bila timbul gagal jantung, diberikan digitalis, sedativum dan
oksigen
b. Penatalaksanaan keperawatan
Pasien GNA perlu dirawat dirumah sakit karena memerlukan
pengobatan/pengawasan perkembangan penyakitnya untuk mencegah
penyakit menjadi lebih buruk. Hanya pasien GNA yang tidak terdapat
tekanan darah tinggi, jumlah urine satu hari paling sedikit 400ml dan
keluarga sanggup serta mengerti boleh dirawat di ruangan di bawah
pengawasan dokter. Masalah pasien yang perlu diperhatikan adalah
gangguan faal ginjal, resiko terjadi komplikasi, diet, gangguan rasa
aman dan nyaman, dan kurangnya pengetahuan orang tua mengenai
penyakit.
Gangguan faal ginjal. Ginjal diketahui sebagai alat yang salah satu
dari fungsinya adalah mengeluarkan sisa metabolisme terutama protein
sebagai ureum, juga kalium, fosfat, asam urat, dan sebagainya. Karena
terjadi kerusakan pada glumerolus (yang merupakan reaksi autoimun
terhadap adanya infeksi streptococcus ekstrarenal) menyebabkan
gangguan filtrasi glomerulus dan mengakibatkan sisa-sisa
metabolisme tidak dapat diekskresikan maka di dalam darah terdapat
ureum, dan lainnya lagi yang disebutkan di atas meninggi. Tetapi
tubulus karena tidak terganggu maka terjadi penyerapan kembali air
dan ion natrium yang mengakibatkan banyaknya urine berkurang, dan
terjadilah oliguria sampai anuria.
Untuk mengetahui keadaan ginjal, pasien GNA perlu dilakukan
pemeriksaan darah untuk fungsi ginjal, laju endap darah (LED), urine,
dan foto radiologi ginjal. Urine perlu ditampung selama 24 jam, diukur
banyaknya dan berat jenisnya (BJ) dicatat pada catatan khusus (catatan
pemasukan/pengeluaran cairan). Bila dalam 24 jam jumlah urine
kurang dari 400 ml supaya memberitahukan dokter. Tempat

16
penampung urine sebaiknya tidak dibawah tempat tidur pasien karena
selain tidak sedap dipandang juga menyebabkan bau urine didalam
ruangan. Penampung urine harus ada tutupnya yang cocok, diberi
etiket selain “nama” juga jam dan tanggal mulai urine ditampung.
Hati-hati jika ada nama yang sama jangan tertukar; tuliskan juga
nomor tempat tidur atau nomor register pasien. Tempat penampung
urine harus dicuci bersih setiap hari; bila terdapat endapan yang sukar
digosok pergunakan asam cuka, caranya merendamkan dahulu
beberapa saat baru kemudian digosok pakai sikat. Untuk membantu
lancarnya diuresis di samping obat-obatan pasien diberikan minum air
putih dan dianjurkan agar anak banyak minum (ad libitum) kecuali
jika banyaknya urine kurang dari 200 ml. berapa banyak pasien dapat
menghabiskan minum air supaya dicatat pada catatan khusus dan
dijumlahkan selama 24 jam. Kepada pasien yang sudah mengerti
sebelum mulai pencatatan pengeluaran/pemasukan cairan tersebut
harus diterangkan dahulu mengapa ia harus banyak minum air putih
dan mengapa air kemih harus ditampung. Jika anak akan buang air
besar supaya sebelumnya berkemih dahulu ditempat penampungan
urine baru ke WC atau sebelumnya gunakan pot lainnya. Dengan
demikian bahwa banyaknya urine adalah benar-benar dari keseluruhan
urine pada hari itu.
Resiko terjadi komplikasi. Akibat fungsi ginjal tidak fisiologis
menyebabkan produksi urine berkurang, sisa metabolisme tidak dapat
dikeluarkan sehingga terjadi uremia, hiperfosfatemia, hiperkalemia,
hidremia, dan sebagainya. Keadaan ini akan menjadi penyebab gagal
ginjal akut atau kronik (GGA/GGK) jika tidak secepatnya
mendapatkan pertolongan. Karena adanya retensi air dan natrium
dapat menyebabkan kongesti sirkulasi yang kemudian menyebabkan
terjadinya efusi ke dalam perikard dan menjadikan pembesaran

17
jantung. Jika keadaan tersebut berlanjut akan terjadi gagal jantung.
Keadaan uremia yang makin meningkat akan menimbulkan keracunan
pada otak yang biasanya ditandai dengan adanya gejala hipertensif
ensefalopati, yaitu pasien merasa pusing, mual, muntah, kesadaran
menurun atau bahkan lebih parah atau untuk mengenal gejala
komplikasi sedini mungkin pasien memerlukan:
1) Istirahat
2) Pengawasan tanda-tanda vital bila terdapat keluhan pusing
3) Jika mendadak terjadi penurunan haluaran urine periksalah dahulu
apakah pasien berkemih di tempat lain dan keadaan umumnya.
4) Jika pasien mendapat obat-obatan berikanlah pada waktunya dan
tunggu sampai obat tersebut betul-betul telah diminum (sering
terjadi obat tidak diminum dan disimpan di bawah bantal pasien).
Jika hal itu terjadi penyembuhan tidak seperti yang diharapkan.
5) Diet. Bila ureum darah melebihi 60 mg % di berikan protein 1 g/kg
BB/hari dan garam 1 g/hari (rendah garam). Bila ureum antara 40-
60 mg% protein diberikan 2 g/kg BB/hari dan masih rendah
garam. Jika pasien tidak mau makan karena merasa mual atau
ingin muntah atau muntah-muntah segera hubungi dokter, siapkan
keperluan infuse dengan cairan yang biasa dipergunakan ialah
glukosa 5-10% dan selanjutnya atas petunjuk dokter. Jika infuse
diberikan pada pasien yang tersangka ada kelainan jantung atau
tekanan darahnya tinggi, perhatikan agar tetesan tidak melebihi
yang telah dipergunakan dokter, bahayanya memperberat kerja
jantung.
6) Gangguan rasa aman dan nyaman.
Untuk memberikan rasa nyaman kepada pasien disarankan agar
sering kontak dan berkomunikasi dengan pasien akan
menyenangkan pasien, agar pasien tidak bosan pasien dibolehkan

18
duduk dan melakukan kegiatan ringan misalnya membaca buku
(anak yang sudah sekolah), melihat buku gambar atau bermain
dengan teman yang telah dapat berjalan. Sebagai perawat kita juga
harus mendampingi/mengajak bermain dengan pasien yang
memerlukan hiburan agar tidak bosan.
7) Kurang pengetahuan orang tua mengenai penyakit
Penjelasan yang perlu disampaikan kepada orang tua pasien
adalah:
a) Bila ada anak yang sakit demam tinggi disertai rasa sakit
menelan atau batuk dan demam tinggi hendaknya berobat ke
dokter/pelayanan kesehatan supaya anak mendapatkan
pengobatan yang tepat dan cepat.
b) Jika anak sudah terlanjur menderita GNA selama dirawat
dirumah sakit, orang tua diharapkan dapat membantu usaha
pengobatannya misalnya untuk pemeriksaan atau tindakan,
sering memerlukan biaya yang cukup banyak sedangkan rumah
sakit tidak tersedia keperluan tersebut. (sebelumnya orang tua
diberi penjelasan mengenai perlunya pengumpulan urine dan
mencatat minum anak selama 24 jam, untuk keperluan
pengamatan perkembangan penyakit anaknya)
c) Bila pasien sudah boleh pulang, dirumah masih harus istirahat
cukup. Walaupun anak sudah diperbolehkan sekolah tetapi
belum boleh mengikuti kegiatan olahraga. Makanan, garam
masih perlu dikurangi sampai keadaan urine benar-benar
normal kembali (kelainan urine, adanya eritrosit dan sedikit
protein akan masih diketemukan kira-kira 4 bulan lamanya).
Jika makanan dan istirahatnya tidak diperhatikan ada
kemungkinan penyakit kambuh kembali. Hindarkan terjadinya
infeksi saluran pernapasan terutama mengenai tenggorokan

19
untuk mencegah penyakit berulang. Kebersihan lingkungan
perlu dianjurkan agar selalu diperhatikan khususnya
streptococcus yang menjadi penyebab timbulnya GNA. Pasien
harus control secara teratur untuk mencegah timbulnya
komplikasi yang mungkin terjadi seperti glomerulus kronik
atau bahkan sudah terjadi gagal ginjal akut. Juga petunjuk
mengenai kegiatan anak yang telah boleh dilakukan.

9. Prognosis
Gajala fisik menghilang dalan minggu ke-2 atau minggu ke-3 dan
tekanan darah umumnya menurun dalam waktu 1 minggu. Kimia darah
menjadi normal pada minggu ke-2. Hematuria mikroskopik dan
makroskopik dapat menetap selama 4-6 minggu. Hitung Addis
menunjukan kenaikan jumlah eritrosit untuk 4 bulan atau lebih, dan LED
meninggi terus sampai kira-kira 3 bulan. Protein sedikit dalam urine dan
menetap untuk beberapa bulan. Eksaserbasi kadang-kadang terjadi akibat
infeksi akut selama fase penyembuhan, tetapi umumnya tidak mengubah
proses penyakitnya. Pasien tetap mennjukan kelainan urine salama 1
tahun dianggap menderita glomerulonefritis kronik, walaupun dapat
terjadi penyembuhan sempurna. Laju endap darah (LED) digunakan
untuk mengukur progresivitas penyakit ini karena umumnya tetap
meninggi pada kasus-kasus yang menjadi kronik. Diperkirakan 95%akan
sembuh sempurna, 2% meninggal selama fase akut dari penyakit ini dan
2% menjadi glomerulonefritis kronik.

20
B. Konsep Dasar Keperawatan
1. Pengkajian
a) Genitourinaria
a. Urine berwarna coklat keruh
b. Proteinuria
c. Peningkatan berat jenis urine
d. Penurunan haluaran urine
e. Hematuria
b) Kardiovaskular
Hipertensi ringan
c) Neurologis
a. Letargi
b. Iritabilitas
c. Kejang
d) Gastro Intestinal
a. Anoreksia
b. Muntah
c. Diare
e) Mata, Telinga, hidung dan tenggorokan
Edema periorbital sedang
f) Hematologis
a. Anemia sementara
b. Azotemia
c. Hiperkalemia
g) Integumen
a. Pucat
b. Edema menyeluruh

21
2. Diagnosa Keperawatan
a. Gangguan perfusi jaringan serebral yang berhubungan dengan retensi
air dan hipernatremia
b. Kelebihan volume cairan yang berhubungan dengan oliguria
c. Gangguan nutrisi: kurang dari kebutuhan tubuh yang berhubungan
dengan anoreksia
d. Intoleran aktivitas yang berhubungan dengan kelelahan
e. Resiko kerusakan integritas kulit yang berhubungan dengan imobilitas
dan edema
f. Ansietas (orang tua) yang berhubungan dengan rawat inap anak
dirumah sakit
g. Deficit pengetahuan yang berhubungan dengan pemahaman intruksi
perawatan dirumah

3. Intervensi Keperawatan
a. Diagnosa 1: Gangguan perfusi jaringan serebral yang berhubungan
dengan retensi air dan hipernatremia
Hasil yang diharapkan: anak memiliki perfusi jaringan normal
yang ditandai oleh TD normal, penurunan retensi cairan, dan tidak
ada tanda hipernatremia.
Intervensi:
1) Pantau dan catat TD anak setiap 1-2 jam selama fase akut
Rasional: pemantauan sering memungkinkan deteksi dini, dan
penanganan segera terhadap TD anak
2) Lakukan tindakan kewaqspadaan berikut ini bila terjadi kejang:
i. Pertahankan jalan napas melalui mulut dan letakkan
peralatan penghisap disisi tempat tidur anak

22
ii. Sematkan tanda diatas tempat tidur anak dan pada pintu,
berisi peringatan tentang status kejang anak yang ditujukan
untuk petugas kesehatan.

Rasional: melakukan tindak kewaspadaan bila terjadi kejang


dapat mencegah cedera selama episode serangan kejang.
Kendati tidak umum pada glomerulusnefritis akut, kejang
dapat terjadi akibat kurang perfusi oksigen ke otak.

c. Beri obat anti-hipetensi, misalnya hidralazin hidroksida


(Aprisonilene) sesuai program. Pantau anak untuk adanya efek
samping.
Rasional: pemberian obat anti hipertensi dapat diprogramkan,
karena hipertensi tidak terkontrol dapat menyebabkan
kerusakan ginjal. Kendati penyebab persis hipertensi tidak
diketahui, hipertensi mungkin berhubungan dengan kelebihan
beban cairan didalam system sirkulasi.
d. Pantau status volume cairan anak setiap 1-2 jam. Pantau
haluaran urine; haluaran harus 1-2ml/kg/jam.
Rasional: pemantauan sangat penting dilakukan, karena
penambahan volume lebih lanjut akan meningkatkan TD.
e. Kaji status neurologis anak ( tingkat kesadaran, reflek dan
respon pupil) setiap 8 jam. Beritahu dokter segera setiap ada
perubahan signifikan pada status anak
Rasional: pengkajian yang sering memungkinkan deteksi dini
dan terapi yang memadai untuk setiap perubahan status
neurologi anak.
f. Beri obat diuretic misalnya hidroklorotiazi (Esidrix) atau
puromesid (lasix) sesuai program.

23
Rasional: diuretic meningkatkan ekskresi cairan.
b. Diagnosa 2: Kelebihan volume cairan yang berhubungan dengan
oliguria
Hasil yang diharapkan: anak dapat mempertahankan volume cairan
normal yang ditandai oleh haluaran urin rata-rata sebanyak 1-2
ml/kg/jam
intervensi:
1) Timbang berat badan anak setiap hari, dan pantau haluaran
urine setiap 4 jam.
Rasional: menimbang berat badan setiap hari dan pemantauan
haluaran urine yang sering, memungkinkan deteksi dini dan
terapi yang tepat terhadap perubahan yang terjadi pada status
cairan anak. Kenaikan berat badan yang cepat mengindikasikan
retensi cairan. Penurunan haluaran urin dapat mengindikasikan
ancaman gagal ginjal.
2) Kaji anak untuk deteksi edema, ukur lingkar abdomen setiap 8
jam, dan (untuk anak laki-laki periksa pembengkakan pada
skrotum.
Rasional: pengkajian dan pengukuran yang sering,
memungkinkan deteksi dini dan pemberian terapi yang tepat
terhadap setiap perubahan kondisi anak. Lingkar abdomen
yang bertambah dan pembengkakan pada skrotum biasanya
mengindikasikan asites.
3) Pantau anak dengan cermat untuk melihat efek samping
pemberian terapi diuretic, khususnya ketika menggunakan
hidroklorotizid atau furosemid.
Rasional: obat-obatan diuretic dapat menyebabkan
hipokalemia sehingga membutuhkan pemberian suplemen
kalium per intravena.

24
4) Pantau dan catat asupan cairan anak.
R/: anak membutuhkan pembatasan asupan cairan akibat
retensi cairan dan penurunan laju filtrasi glomerulus; ia juga
membutuhkan retriksi asupan natrium.
5) Kaji warna, konsistensi dan berat jenis urine anak.
Rasional: urine yang berbusa mengindikasikan peningkatan
deplesi protein, suatu tanda kerusakan fungsi ginjal.
6) Pantau semua hasil uji laboratorium yang di programkan.
Rasional: peningkatan kadar nitrogen urea darah dan kreatinin
dapat mengindikasikan kerusakan fungsi ginjal.
c. Diagnosa 3: Gangguan nutrisi: kurang dari kebutuhan tubuh yang
berhubungan dengan anoreksia
Hasil yang diharapkan: anak akan mengalami peningkatan asupan
nutrisi yang ditandai oleh makan sekuran-kurangnya 80% porsi
setiap kali makan.
Intervensi:
1) Beri diet tinggi karbohiodrat.
Rasional: diet tinggi karbihidrat biasanya terasa lebih lesat dan
member kalori esensial bagi anak.
2) Beri makanan porsi kecil dalam frekuensi sering, yang
mencakup beberapa makanan favorit anak.
Rasional: menyediakan makanan dalam porsi yang lebih kecil,
untuk satu kali makan tidak akan membebani anak sehingga
mendorongnya makan lebih banyak setiap kali anak duduk.
Dengan member anak makanan favoritnya, akan memastikan ia
mengkonsumsi setiap porsi makanan lebih banyak.
3) Batasi asupan natrium dan protein anak sesuai program.
Rasional: karena natrium dapat menyebabkan retensi cairan,
biasanya natrium dibatasi dengan gangguan ini. Pada kasus-

25
kasus berat, ginjal tidak mampu memetabolisasi protein
sehingga membutuhkan retriksi protein.
d. Diagnosa 4: Intoleran aktivitas yang berhubungan dengan
kelelahan
Hasil yang diharapkan: anak akan mengalami peningkatan
toleransi beraktivitas yang ditandai oleh kemampuan bermain
dalam waktu yang lama.
Intervensi:
1) Jadwalkan periode istirahat untuk setiap kali beraktivitas.
Rasional: periode istirahat yang sering dapat menyimpan
energy dan mengurangi produksi sisa metabolic yang dapat
membebani kerja ginjal lebih lanjut.
2) Sediakan permainan yang tenang, menantang dan sesuai usia.
Rasional: permainan yang demikian dapat menyimpan energy
tetapi mencegah kebosanan.
3) Kelompokan asuhan keperawatan anak untuk memungkinkan
anak tidur tanpa gangguan dimalam hari.
Rasional: mengelompokkan pemberian asuhan keperawatan,
membantu anak tidur sesuai dengan kebutuhan.
e. Diagnosa 5: Resiko kerusakan integritas kulit yang berhubungan
dengan imobilitas dan edema.
Hasil yang diharapkan: anak akan mempertahankan integritas kulit
normal, yang ditandai oleh warna kulit kemerah mudaan, dan tidak
ada kemerahan, edema, serta kerusakan kulit.
Intervensi:
1) Beri matras busa berlekuk sebagai tempat tidur anak.
Rasional: matras busa berlekuk mengatasi bagian-bagian
tulang yang menonjol sehingga mengurangi resiko kerusakan
kulit.

26
2) Bantu anak mengubah posisi setiap 2 jam.
Rasional: mengganti posisi dengan sering dapat mengurangi
tekanan pada area kapiler dan meningkatkan sirkulasi sehingga
mengurangi resiko kerusakan kulit.
3) Mandikan anak setiap hari, menggunakan sabun yang
mengandung lemak tinggi
Rasional: deodorant dan sabun yang mengandung parfum
dapat mengeringkan kulit sehingga mengakibatkan kerusakan
kulit.
4) Topang dan tinggikan ekstremitas yang mengalami edema.
Rasional: menopang dan meninggikan ekstremitas dapat
meningkatkan aliran balik vena dan dapat mengurangi
pembengkakan.
5) Pada anak laki-laki, letakkan bantalan sekitar skrotumnya.
Rasional: pemberian bantalan dapat mencegah kerusakan kulit.
f. Diagnosa 6: Ansietas (orang tua) yang berhubungan dengan rawat
inap anak dirumah sakit
Hasil yang diharapkan: orang tua akan mengalami penurunan rasa
cemasyang ditandai oleh pengungkapan ketakutan mereka, dan
pemahaman tentang kondisi anak.
Intervensi:
1) Dengarkan setiap kekhawatiran orang tua.
Rasional: mendengar dapat member dukungan selama stress.
2) Jelaskan semua prosedur kepada orang tua, dan libatkan
mereka dalam diskusi tentang perawatan anak.
Rasional: dengan terus mempertahankan orang tua agar tetap
memperoleh informasi, dan melibatkan mereka dalam diskusi
tentang perawatan anak, dapat mengembangkan kemampuan
control sehingga mengurangi kecemasan.

27
3) Rujuk orang tua ke kelompok pendukung yang tepat, jika
dibutuhkan.
Rasional: kelompok pendukung memberi wacana bagi orang
tua untuk mengekspresikan perasaan dan kekhawatiran.
g. Diagnosa 7: Deficit pengetahuan yang berhubungan dengan
pemahaman intruksi perawatan dirumah.
Hasil yang diharapkan: orang tua akan mengekspresikan
pemahaman tentang instruksi perawatan dirumah.
Intervensi:
1) Jelaskan kepada orang tua tentang patofisiologi penyakit.
Rasional: penjelasan yang demikian membantu orang tua
memahami penyakit dan pentingnya melanjutkan terapi
dirumah.
2) Yakinkan kembali orang tua bahwa penyakit tersebut jarang
menyebabkan efek jangka panjang.
Rasional: orang tua biasanya kuatir tentang efek penyakit,
khususnya jika menjalani dialisis. Selama fase akut penyakit.
3) Jelaskan kepada orang tua tentang pentingnya
mempertahankan anak pada restriksi diet natrium, sampai
edema mereda dan fungsi ginjal kembali normal.
Rasional: diet restriksi natrium diperlukan karena asupan
natrium yang berlebihan dapat menghalangi eksresi air.
4) Instruksikan orang tua untuk membatasi aktivitas anak sampai
dokter menyetujui bahwa anak dapat melakukan aktivitas
seperti sedia kala.
Rasional: restriksi aktivitas diperlukan untuk mencegah stress
pada ginjal yang dapat menyebabkan kekambuhan penyakit.
5) Ajarkan orang tua tentang tanda dan gejala infeksi pernapasan
atas, seperti meningkatnya suhu tubuh, nyeri tenggorokan dan

28
batuk; juga ajarkan mereka tentang tanda dan gejala gagal
ginjal misalnya penurunan haluaran urine, kenaikan berat
badan dan edema.
Rasional: dengan mengetahui tanda dan gejala infeksi berulang
serta gagal ginjal mendorong orang tua mencari bantuan medis
saat diperlukan.
6) Anjurkan orang tua untuk menepati semua perjanjian tindak
lanjut itu
Rasional: suatu kujungan tindak lanjut sangat diperlukan untuk
menentukan resolusi penyakit dan mendeteksi komplikasi.

4. Implemantasi
Pelaksanaanatauimplementasiadalahpemberiantindakankeperawatan yang
dilaksanakanuntukmencapaitujuanrencanatindakan yang
telahdisusun.Setiaptindakankeperawatan yang
dilakukandicatatdalampencatatankeperawatan agar
tindakankeperawatanterhadapklienberlanjut.Prisipdalammelaksanakantind
akankeperawatanyaitucarapendekatanpadaklienefektif,
tehnikkomunikasiteraupetiksertapenjelasanuntuksetiaptindakan yang di
berikankepadaklien. Pelaksanaan disesuaikan dengan intervensi yang telah
ditentukan.

Dalammelakukantindakankeperawatanmengunakantigatahapyaituindepen
dent, dependent, dan interdependent, tindakankeperawatansecara
independent adalahsuatutindakan yang di
lakukanolehperawattanpapetunjukdanperintahdokteratautenagakesehatanla
innya dependent adalahtindakan yang
sehubungandenganpelaksanaanrencana. Tindakanmedis. Interdependent
adalahtindakankeperawatan yang menjelaskansuatukegiatan yang

29
memerlukansuatukerjasamadengantenagakesehatan lain nya,
misalnyatenaga social, ahligizi, dandokter, ketrampilan yang harus di
punyaperawatdalammelaksanakantindakankeperawatanyaitukognitif,
dansikappsikomotor.

5. Evaluasi
Evaluasiadalahtindakanintelektualuntukmelengkapi proses kerawatan
yang
menandakanseberapajauhdiagnosakeperawatanrencanatindakandanpelaksa
naannyasudahberhasildicapaikemungkinanterjadipadatahapevaluasiadalah
masalahdapatdiatasi, masalahteratasisebagian,
masalahbelumteratasiatautimbulmasalah yang baru.
Evaluasidilakukanyaituevaluasi proses danevaluasihasil.

Evaluasi proses adalah yang


dilaksanakanuntukmembantukeefektifanterhadaptindakan.
Sedangkanevaluasihasiladalahevaluasi yang
dilakukanpadaakhirtindakankeperawatansecarakeseluruhansesuaidenganw
aktu yang adapadatujuan. Evaluasi disesuaikan dengan kriteria hasil yang
telah ditentukan:
g. Anak memiliki perfusi jaringan normal yang ditandai oleh TD normal,
penurunan retensi cairan, dan tidak ada tanda hipernatremia.
h. Anak dapat mempertahankan volume cairan normal yang ditandai oleh
haluaran urin rata-rata sebanyak 1-2 ml/kg/jam
i. Anak akan mengalami peningkatan asupan nutrisi yang ditandai oleh
makan sekuran-kurangnya 80% porsi setiap kali makan.

30
j. Anak akan mengalami peningkatan toleransi beraktivitas yang ditandai
oleh kemampuan bermain dalam waktu yang lama.
k. Anak akan mempertahankan integritas kulit normal, yang ditandai oleh
warna kulit kemerah mudaan, dan tidak ada kemerahan, edema, serta
kerusakan kulit.
l. Orang tua akan mengalami penurunan rasa cemasyang ditandai oleh
pengungkapan ketakutan mereka, dan pemahaman tentang kondisi
anak.
m. Orang tua akan mengekspresikan pemahaman tentang instruksi
perawatan dirumah.

C. Studi Kasus
1. Resume
Anak mengalami bengkak seluruh tubuh sejak 3 hari sebelum masuk
rumah sakit. Bengkak awalnya terjadi pada mata saja, timbul saat
bangun tidur, dan menghilang saat siang hari. Lama-kelamaan
bengkak menjadi menetap dan meluas hingga keseluruh tubuh. Sejak 7
hari sebelum masuk rumah sakit, BAK anak berwarna merah
kehitaman, tidak ada rasa nyeri saat BAK, tidak ada kesulitan untuk
BAK, tidak ada nyeri pinggang, nyeri perut dan tidak ada riwayat
terjatuh sebelumnya. Anak juga menjadi jarang BAK, hanya 2 kali
dalam sehari dengan jumlah yang tidak terlalu banyak. Sejak 10 hari
sebelum masuk rumah sakit anak menderita panas, panas tidak naik,
panas turun dengan obat penurun panas, siang dan malam sama,
selama panas tidak ada kejang, mengigau dan mengigil. Nafsu makan
menurun dan meminum kurang dari biasanya, BAB normal. Tidak ada
perdarahan gusi maupun mimisan. Anak juga ada menderita batuk dan
pilek. Tidak ada riwayat pemakaian obat tertentu, dan riwayat keluarga
yang menderita sakit ginjal. Sejak anak sering bermain ditanah,

31
muncul luka-luka yang akhirnya menjadi koreng yang menetap bila
digaruk. Tekanan darah 140/100mmHg (Normal: 100/60mmHg) N:
118x/menit, regular, Suhu: 36,6° C, Respirasi 30x/menit. Berat badan
25kg (75,09% menurut standar BB/U) panjang / tinggi badan :1117cm
(92,12% menurut standar TB/U).
a. Data apa saja yang harus dikaji lebih lanjut pada kasus diatas
b. Buatlah pengkajian sampai dengan analisa data sesuai kasus
diatas
c. Diagnosa keperawatan apa saja yang muncul berdasarkan
kasus diatas
d. Intervensi keperawatan berdasarkan diagnose yang muncul

2. Proses Keperawatan
a) Data yang dikaji harus dikaji lebih lanjut
a. Usia anak. X berumur 7 tahun
b. Rumus BB ideal anak = Umur (tahun) x 7-
5

= 7x7-5

2
c. Klien hanya minum 2 gelas berisi 200cc.
d. Hasil Lab:
= 23,5 kg
i. Na+ serum di atas normal (>145 mEq/L)
ii. Kadar K+ serum di atas normal (> 5,5 mEq/L)
iii. Klorida (Cl-) = (107,0 mEq - 112,7 mEq)

32
e. Pemeriksaan Laboratorium
Penafsiran Berdasarkan Warna Urine
No Warna Urine Penyebab Patologis Penyebab Non Patologis
1 Merah Ada hemoglobin, mioglobin -oleh karena obat tertentu
dan porfirin ( berarti ada -karena zat warna dari
perdarahan saluran kencing) makanan tertentu, misal Biet,
Senna, Robarber
2 Jingga Zat warna empedu -karena obat-obat : antisepti
saluran kencing, pyridium,
dan obat fenothiazin
3 Kuning -Urine pekat -Banyak makan wortel
- obat fenacetin, kaskara,
-Keberadaan
Nitrofurantion
urobiliin dan
bilirubin
4 Hijau -Keberadaan biliverdin -Obat preparat vitamin dan
-Keberadaan bakteri obat psikoaktif
pseudomonas
5 Biru Tak patologis Deuretika tertentu
6 coklat -Keberadaan hematin asam, -Obat-obat Nitroforation,
mioglobin, dan zat warna levodopa
empedu
7 Hitam/hampir Keberadaan Melanin, -Obat Levodopa, Kaskara,

33
hitam Urobilin dan senyawa besi dan Fenol
Methemoglobin

f. Berat badan normal dan Kebutuhan Cairan menurut umur.


Umur BB (kg) Keb. Cairan
Hari 3,0 250 - 300
1 tahun 9,5 1150 - 1300
2 tahun 11,8 1350 - 1500
6 tahun 20,0 1800 - 2000
10 tahun 28,7 2000 - 2500
14 tahun 45,0 2200 - 2700
18 tahun 54,0 2200 - 2700

g. Perhitungan balance cairan anak: usia tergantung tahapan umur


untuk menentukan Air Metabolisme yaitu:
i. Usia 1-3 tahun = 8cc/kg BB/hari
ii. Usia 5-7 tahun = 8-8,5cc/kg BB/hari
iii. Usia 7-11 tahun = 6-7cc/kg BB/hari
iv. Uisa 12-14 tahun =5-6cc/kg BB/hari
h. Balance Cairan
Intake:

34
Air (makan+minum) : 500 cc
Cairan Infus : 1000 cc/24jam
A.M : 200 cc ( AM= 8cc/kg BB/hari)
Output:
Urine : 2x200 cc
Feses : 2x100 cc (kondisi normal 1xBB
100 cc) normalnya 2x/hari

IWL :
Rumus IWL normal = 15ccxkgBB/24 jam
15ccx25kg= 375cc
Balance cairan = intake-output
= 1700-975
= 725 cc

35
3. Pengkajian Sampai Dengan Analisa Data

Data Fokus

Data Subjektif Data Objektif


1. Ibu klien mengatakan klien mengalami 1. Anak mengalami bengkak seluruh
bengkak seluruh tubuh sejak 3 hari tubuh
sebelum masuk rumah sakit. 2. BAK anak berwarna merah
2. Ibu klien mengatakan klien bengkak kehitaman.
awalnya terjadi pada mata saja, timbul 3. Klien terlihat bengkak mata dan
saat bangun tidur, dan menghilang saat seluruh badannya.
siang hari. 4. BAK klien warnanya merah
3. Ibu klien mengatakan bahwa lama- kehitaman.
kelamaan bengkak menjadi menetap dan 5. Klien terlihat kurang minum dan
meluas hingga keseluruh tubuh. nafsu makan.
4. Ibu klien mengatakan klien mengalami 6. TTV : TD: 140 mmhg, N: 118x per
bengkak sejak 7 hari sebelum masuk menit, Suhu: 36,60C, RR=
rumah sakit 30x/menit.

36
5. Ibu klien mengatakan BAK klien
berwarna merah kehitaman, tidak ada
rasa nyeri saat BAK, tidak ada kesulitan
untuk BAK, tidak ada nyeri pinggang,
nyeri perut dan tidak ada riwayat terjatuh
sebelumnya.
6. Ibu klien mengatakan klien juga menjadi
jarang BAK, hanya 2 kali dalam sehari
dengan jumlah yang tidak terlalu banyak.
7. Ibu klien mengatakan nafsu makan
menurun dan meminum klien kurang dari
biasanya.

Analisa Data

No Data Masalah Etiologi


1. DS: Kelebihan Oliguria
volume
1. Ibu klien mengatakan
cairan
klien mengalami
bengkak seluruh tubuh
sejak 3 hari sebelum
masuk rumah sakit.
2. Ibu klien mengatakan
klien bengkak awalnya
terjadi pada mata saja,
timbul saat bangun tidur,
dan menghilang saat
siang hari.

37
3. Ibu klien mengatakan
bahwa lama-kelamaan
bengkak menjadi
menetap dan meluas
hingga keseluruh tubuh.
4. Ibu klien mengatakan
klien mengalami
bengkak sejak 7 hari
sebelum masuk rumah
sakit
5. Ibu klien mengatakan
BAK klien berwarna
merah kehitaman, tidak
ada rasa nyeri saat BAK,
tidak ada kesulitan untuk
BAK, tidak ada nyeri
pinggang, nyeri perut
dan tidak ada riwayat
terjatuh sebelumnya.
6. Ibu klien mengatakan
klien juga menjadi
jarang BAK, hanya 2
kali dalam sehari dengan
jumlah yang tidak terlalu
banyak.
7. Ibu klien mengatakan
nafsu makan menurun
dan meminum klien

38
kurang dari biasanya

DO:

1. Anak mengalami
bengkak seluruh tubuh
2. BAK anak berwarna
merah kehitaman.
3. Klien terlihat bengkak
mata dan seluruh
badannya.
4. BAK klien warnanya
merah kehitaman.
5. Klien terlihat kurang
minum dan nafsu makan.
6. TTV : TD: 140 mmhg,
N: 118x per menit,
Suhu: 36,60C, RR=
30x/menit.

39
4. Diagnosa Keperawatan
No Diagnosa Tanggal Tanggal
Keperawatan ditemukan teratasi
1. Kelebihan
volume cairan
berhubungan
dengan Oligura

40
5. Intervensi Keperawatan
Tujuan dan kriteria hasil: Setelah dilakukan tindakan keperawatan
selama … x 24 jam diharapkan masalah kelebihan volume cairan
dapat teratasi dengan hasil yang diharapkan:
Anak dapat mempertahankan volume cairan normal yang ditandai oleh
haluaran urin rata-rata sebanyak 1-2 ml/kg/jam, penafsiran warna urine
menunjukkan normal, hasil laboratorium menunjukkan tanda normal
(Na, K, Cl).
Intervensi:
a. Timbang berat badan anak setiap hari, dan pantau haluaran
urine setiap 4 jam.
Rasional: menimbang berat badan setiap hari dan pemantauan
haluaran urine yang sering, memungkinkan deteksi dini dan
terapi yang tepat terhadap perubahan yang terjadi pada status
cairan anak. Kenaikan berat badan yang cepat mengindikasikan
retensi cairan. Penurunan haluaran urin dapat mengindikasikan
ancaman gagal ginjal.
b. Kaji anak untuk deteksi edema, ukur lingkar abdomen setiap 8
jam, dan (untuk anak laki-laki periksa pembengkakan pada
skrotum.

41
Rasional: pengkajian dan pengukuran yang sering,
memungkinkan deteksi dini dan pemberian terapi yang tepat
terhadap setiap perubahan kondisi anak. Lingkar abdomen
yang bertambah dan pembengkakan pada skrotum biasanya
mengindikasikan asites.
c. Pantau anak dengan cermat untuk melihat efek samping
pemberian terapi diuretic, khususnya ketika menggunakan
hidroklorotizid atau furosemid.
Rasional: obat-obatan diuretic dapat menyebabkan
hipokalemia sehingga membutuhkan pemberian suplemen
kalium per intravena.
d. Pantau dan catat asupan cairan anak.
R/: anak membutuhkan pembatasan asupan cairan akibat
retensi cairan dan penurunan laju filtrasi glomerulus; ia juga
membutuhkan retriksi asupan natrium.
e. Kaji warna, konsistensi dan berat jenis urine anak.
Rasional: urine yang berbusa mengindikasikan peningkatan
deplesi protein, suatu tanda kerusakan fungsi ginjal.
f. Pantau semua hasil uji laboratorium yang di programkan.
Rasional: peningkatan kadar nitrogen urea darah dan kreatinin
dapat mengindikasikan kerusakan fungsi ginjal.
BAB III
PENUTUP

A. Kesimpulan
Dari penulisan makalah di atas, maka kami selaku penulis menarik
kesimpulanKesimpulan, Glomerulo Nefritis Akut (GNA) adalah suatu
reaksi imunologis ginjal terhadap bakteri / virus tertentu. Yang sering

42
terjadi ialah akibat infeksi kuman streptococcus, sering ditemukan pada
usia 3-7 tahun. Masalahkeperawatan yang munculadalahGangguan
perfusi jaringan serebral yang berhubungan dengan retensi air dan
hipernatremiaKelebihan volume cairan yang berhubungan dengan
oliguria, Gangguan nutrisi: kurang dari kebutuhan tubuh yang
berhubungan dengan anoreksia, Intoleran aktivitas yang berhubungan
dengan kelelahan, Resiko kerusakan integritas kulit yang berhubungan
dengan imobilitas dan edema, Ansietas (orang tua) yang berhubungan
dengan rawat inapo anak dirumah sakit, Deficit pengetahuan yang
berhubungan dengan pemahaman intruksi perawatan dirumah. Pasien
GNA perlu dirawat dirumah sakit karena memerlukan
pengobatan/pengawasan perkembangan penyakitnya untuk mencegah
penyakit menjadi lebih buruk. Hanya pasien GNA yang tidak terdapat
tekanan darah tinggi, jumlah urine satu hari paling sedikit 400ml dan
keluarga sanggup setra mengerti boleh dirawat diruah di bawah
pengawasan dokter. Masalah pasien yang perlu diperhatikan adalah
gangguan faal ginjal, resiko terjadi komplikasi, diet, gangguan rasa
aman dan nyaman, dan kurangnya pengetahuan orang tua mengenai
penyakit.

B. Saran
Berdasarkan kesimpulan diatas maka penulis memberikan saran sebagai
berikut :
1. Untuk klien dan keluarga
Orang tua diharapkan dapat membantu usaha pengobatannya
misalnya untuk pemeriksaan atau tindakan, sering memerlukan
biaya yang cukup banyak sedangkan rumah sakit tidak tersedia

43
keperluan tersebut. (sebelumnya orang tua diberi penjelasan
mengenai perlunya pengumpulan urine dan mencatat minum
anak selama 24 jam, untuk keperluan pengamatan perkembangan
penyakit anaknya)
2. Untuk perawat
Perawat diharapkan dapat meningkatkan kwalitas asuhan
keperawatan dan pendokumentasian keperawatan yang lebih
akurat dan lengkap sesuai dengan keadaan klien guna
mempercepat penyembuhan dan meningkatkan kepuasan
klien.Pentingnyamemberikanedukasikepadaklienuntukmenambahp
engetahuanPenjelasan yang perlu disampaikan kepada orang tua
pasien adalah:Bila ada anak yang sakit demam tinggi disertai rasa
sakit menelan atau batuk dan demam tinggi hendaknya berobat ke
dokter/pelayanan kesehatan supaya anak mendapatkan pengobatan
yang tepat dan cepat.Jika anak sudah terlanjur menderita GNA
selama dirawat dirumah sakit, orang tua diharapkan dapat
membantu usaha pengobatannya misalnya untuk pemeriksaan atau
tindakan, sering memerlukan biaya yang cukup banyak sedangkan
rumah sakit tidak tersedia keperluan tersebut. (sebelumnya orang
tua diberi penjelasan mengenai perlunya pengumpulan urine dan
mencatat minum anak selama 24 jam, untuk keperluan pengamatan
perkembangan penyakit anaknya). Bila pasien sudah boleh pulang,
dirumah masih harus istirahat cukup. Walaupun anak sudah
diperbolehkan sekolah tetapi belum boleh mengikuti kegiatan
olahraga. Makanan, garam masih perlu dikurangi sampai keadaan
urine benar-benar normal kembali (kelainan urine, adanya eritrosit
dan sedikit protein akanmasih diketemukan kira-kira 4 bulan
lamanya). Jika makanan dan istirahatnya tidak diperhatikan ada
kemungkinan penyakit kambuh kembali. Hindarkan terjadinya

44
infeksi saluran pernapasan terutama mengenai tenggorokan untuk
mencegah penyakit berulang. Kebersihan lingkungan perlu
dianjurkan agar selalu diperhatikan khususnya streptococcus yang
menjadi penyebab timbulnya GNA. Pasien harus control secara
teratur untuk mencegah timbulnya komplikasi yang mungkin
terjadi seperti glomerulus kronik atau bahkan sudah terjadi gagal
ginjal akut. Juga petunjuk mengenai kegiatan anak yang telah
boleh dilakukan.

3. Untuk mahasiswa
a. Mahasiswa diharapkan lebih memahami teori tentang asuhan
keperawatan pada klien
denganGlomeruloNefritisAkutsehingga mampu
melaksanakan asuhan keperawatan pada klien dengan
GlomeruloNefritisAkutsehingga secara khomprehensif.
b. Mahasiswa meningkatkan komunikasi terapeutik sehingga
terjadi trust antara klien dan mahasiswa guna tercapai tujuan
asuhan keperawatan.

DAFTAR PUSTAKA

Betz, Cecily L. 2002. “Buku Saku Keperawatan Pediatri”. Jakarta: EGC.

Harnowo, Sapto. 2001. “Keperawatan Medikal Bedah untuk Akademi Keperawatan”.


Jakarta: Widya Medika.

45
Jhonson, Marion, dkk. 2000. NOC. St. Louis Missouri: Mosby INC.

Mansjoer, Arif M. 2000.”Kapita Selekta Kedokteran”, ed 3, jilid 2. Jakarta: Media


Aesculapius.

Mc. Closkey, cjuane, dkk. 1996. NIC. St.Louis missouri: Mosby INC.

Morgan Speer, Kathleen. 2008. Rencana Asuhan Keperawatan Pediatrik dengan


klinikal pathways. Jakarta: EGC

Ngastiyah. 2005.”Perawatan Anak Sakit”. Jakarta: EGC.

Price, Sylvia. A, Lorraine, M. Wilson. (1995). Buku 1 Patofisiologi “Konsep Klinis


Proses-Proses Penyakit”, edisi : 4. Jakarta : EGC.

Sacharin, Rosa M. 1999. “Prinsip Keperawatan Pediatrik”. Jakarta: ECG.

Santosa Budi. 2006. “Panduan Diagnosa Keperawatan Nanda 2005-2006”: Definisi


dan Klasifikasi. Jakarta: EGC.

Suriadi, dkk. 2001.”Asuhan Keperawatan Anak”. Jakarta: PT. Fajar Luterpratama.

46