Anda di halaman 1dari 30

I.

PELAYANAN GAWAT DARURAT

1. Kemampuan menangani lifesaving anak dan dewasa


Judul Kemampuan menangani life saving di Gawat darurat
Dimensi Mutu Keselamatan
Tujuan Tergambarnya kemampuan Rumah Sakit dalam memberikan Pelayanan Gawat
Darurat
Definisi Life Saving adalah upaya penyelamatan jiwa manusia dengan urutan Airway, Breath,
Operasional Circulation
Inklusi Semua pasien baru di gawat darurat yang membutuhkan pertolongan darurat
Ekslusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Tiga bulan sekali
Numerator Jumlah kumulatif pasien yang mendapat pertolongan life saving di Gawat Darurat
Denominator Jumlah seluruh pasien yang membutuhkan penanganan life saving di Unit Gawat
Darurat
Sumber Data Rekam Medik di Gawat Darurat
Standar 100 %
Penanggung jawab Kepala Instalasi Gawat Darurat
Pengumpulan data
2. Kematian Pasien ≤ 24 jam di Gawat Darurat
Judul Kematian Pasien ≤ 24 jam di Gawat Darurat
Dimensi Mutu Efektifitas dan Keselamatan
Tujuan Terselenggaranya pelayanan yang efektif dan mampu menyelamatkan pasien gawat
darurat
Definisi Kematian ≤ 24 jam adalah kematian yang terjadi dalam periode 24 jam sejak pasien
Operasional datang
Inklusi Jumlah pasien meninggal dalam kurun waktu 24 jam sejak pasien datang di IGD
Eksklusi Pasien DOA (Death on Arrival)
Frekuensi Tiga bulan
Pengumpulan
Data
Periode Analisa Tiga bulan
Numerator Jumlah pasien yang meninggal dalam periode ≤ 24 jam sejak pasien datang
Denominator Jumlah seluruh yang ditangani di Gawat Darurat
Sumber Data Rekam Medik
Standar ≤ 2 perseribu
Penanggung jawab Kepala Instalasi Gawat Darurat
Pengumpulan data
3. Pemeriksaan skin test sebelum pemberian antibiotik injeksi
Judul Pemeriksaan skin test sebelum pemberian antibiotik injeksi
Dimensi Mutu Keselamatan Pasien
Tujuan Tergambarnya kemampuan rumah sakit dalam mencegah terjadinya kejadian yang
tidak diinginkan
Definisi Skin test adalah suatu pengujian yang dilakukan pada kulit untuk mengidentifikasi
Operasional substansi alergi (alergen) yang menjadi pemicu timbulnya reaksi alergi (2)
Inklusi Pasien yang akan mendapatkan terapi antibiotik
Eksklusi Pasien yang sebelumnya tercatat dalam rekam medik telah dilakukan skin test untuk
mendapatkan antibiotik yang sama
Frekuensi Satu Bulan
Pengumpulan
Data
Periode Analisa Tiga Bulan
Numerator Jumlah pasien yang dilakukan skin test
Denominator Jumlah pasien yang diberikan antibiotik
Sumber Data Instalasi Gawat Darurat
Standar 100%
1
Penanggung jawab Kepala Instalasi Gawat Darurat
Pengumpulan data
4. Kejadian tertusuk limbah benda tajam infeksius
Judul Kejadian tertusuk limbah benda tajam infeksius
Dimensi Mutu Keselamatan
Tujuan Menggambarkan kepatuhan petugas terhadap prosedur dan ketersediaan fasilitas
yang aman
Definisi Terpaparnya cairan tubuh (orang lain/pasien) pada tubuh pekerja kesehatan, yang
Operasional terjadi selama melakukan pekerjaannya, melalui jarum suntik atau instrumen tajam
termasuk (lancet, scaple dll)
Inklusi Tenaga kesehatan yang tertusuk limbah benda tajam infeksius
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Setiap bulan
Numerator Kejadian tertusuk jarum
Denominator -
Sumber Data Laporan staf dan form laporan insiden tertusuk benda tajam
Standar 0
Penanggung jawab IPCN
Pengumpulan data
5. Ketepatan Identifikasi Pasien
Judul Angka Kejadian Pasien Tidak Terpasang Gelang Identitas Pasien Rawat Inap
dan Ketepatan Identitas
Dimensi mutu Keselamatan pasien
Tujuan 1. Mendeskripsikan prosedur untuk memastikan tidak terjadinya kesalahan dalam
identifikasi pasien selama perawatan di rumah sakit.
2. Mengurangi kejadian/kesalahan yang berhubungan dengan salah identifikasi.
Kesalahan ini dapat berupa: salah pasien,kesalahan prosedur,kesalahan
medikasi,kesalahan transfusi dan kesalahan pemeriksaan diagnostik.
3. Mengurangi kejadian cidera pada pasien
Definisi Gelang identifikasi pasien adalah suatu alat berupa gelang identifikasi yang
operasional dipasangkan kepada pasien secara individual dan memuat nama,tanggal lahir serta
nomor rekam medik pasien yang digunakan sebagai identitas pasien selama di rawat
di rumah sakit.
Inklusi Seluruh pasien yang dirawat inap
Eksklusi -
Frekuensi Setiap 1 bulan
pengumpulan
data
Periode analisis Setiap 3 bulan
Numerator 1. Jumlah kumulatif pasien yang tidak terpasang gelang rawat inap dalam periode
waktu tertentu.
2. Jumlah kumulatif pasien yang identitasnya tidak tepat dalam periode waktu
tertentu.
Denominator Jumlah keseluruhan pasien rawat inap dalam periode waktu tertentu
Sumber data Rekapitulasi bulanan tiap ruangan rawat inap
Standar 0% tidak terpasang gelang identitas
0% tidak tepat identitas
Penanggung Pengumpul data SKP 1 (IDENTIFIKASI PASIEN)
jawab pengumpul
data

II. PELAYANAN RAWAT JALAN

2
1. Pemberi pelayanan di klinik spesialis
Judul Pemberi pelayanan di klinik spesialis
Dimensi Mutu Kompetensi tehnis
Tujuan Tersedianya pelayanan klinik oleh tenaga spesialis yang kompeten
Definisi Klinik spesialis adalah klinik pelayanan rawat jalan di rumah sakit yang dilayani oleh
Operasional dokter spesialis (untuk rumah sakit pendidikan dapat dilayani oleh dokter PPDS
sesuai dengan special privilege yang diberikan)
Inklusi Pelayanan poli dilakukan oleh dokter spesialis
Eksklusi -
Frekuensi 1 bulan
Pengumpulan
Data
Periode Analisa 3 bulan
Numerator Jumlah hari buka klinik spesialis yang ditangani oleh dokter spesialis dalam waktu
satu bulan
Denominator Jumlah seluruh hari buka klinik spesialis dalam waktu satu bulan
Sumber Data Register rawat jalan poliklinik spesialis
Standar 100 %
Penanggung jawab Kepala Instalasi rawat jalan
Pengumpulan data
2. Kepuasan Pelanggan pada Rawat Jalan
Judul Kepuasan Pelanggan pada Rawat Jalan
Dimensi Mutu Kenyamanan
Tujuan Terselenggaranya pelayanan rawat jalan yang mampu memberikan kepuasan
pelanggan
Definisi Kepuasan adalah pernyataan tentang persepsi pelanggan terhadap pelayanan yang
Operasional diberikan
Inklusi Seluruh pasien yang mendapatkan pelayanan di rawat jalan
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Tiga bulan sekali
Numerator Jumlah kumulatif rerata penilaian kepuasan pasien rawat jalan yang disurvey
Denominator Jumlah seluruh pasien rawat jalan yang disurvey (minimal n = 50)
Sumber Data Survey
Standar ≥ 90 %
Penanggung jawab Kepala Instalasi rawat jalan /tim mutu/panitia mutu
Pengumpulan data

III. PELAYANAN RAWAT INAP

1. Kejadian infeksi pasca operasi

3
Judul Kejadian infeksi pasca operasi
Dimensi Mutu Keselamatan, kenyamanan
Tujuan Tergambarnya pelaksanaan operasi dan perawatan pasca operasi yang bersih
sesuai standar
Definisi Infeksi pasca operasi adalah adanya infeksi nosokomial pada semua kategori luka
Operasional sayatan operasi bersih yang dilaksanakan di rumah sakit yang ditandai oleh rasa
panas (kalor), kemerahan (color), pengerasan (tumor) dan keluarnya nanah (pus)
dalam waktu lebih dari 3 x 24 jam
Inklusi Seluruh pasien yang melakukan operasi
Eksklusi -
Frekuensi tiap bulan
Pengumpulan
Data
Periode Analisa tiap bulan
Numerator Jumlah pasien yang mengalami infeksi pasca operasi dalam satu bulan
Denominator Jumlah seluruh pasien yang dalam satu bulan
Sumber Data Rekam medis
Standar ≤ 1,5 %
Penanggung jawab Ketua komite medik/komite mutu/tim mutu
Pengumpulan data
2. Angka Kejadian Infeksi Nosokomial
Judul Angka kejadian infeksi nosokomial
Dimensi Mutu Keselamatan pasien
Tujuan Mengetahui hasil pengendalian infeksi nosokomial rumah sakit
Definisi Infeksi nosokomial adalah infeksi yang dialamioleh pasien yang diperoleh selama
Operasional dirawat di rumah sakit yang meliputi dekubitus, phlebitis, sepsis, dan infeksi luka
operasi
Inklusi Semua pasien rawat inap
Eksklusi Pasien yang datang dengan dengan keluhan dan di diagnosa ISK
Frekuensi Tiap bulan
Pengumpulan
Data
Periode Analisa Tiap tiga bulan
Numerator Jumlah pasien rawat inap yang terkena infeksi nosokomial dalam satu bulan
Denominator Jumlah pasien rawat inap dalam satu bulan
Sumber Data Survei, laporan infeksi nosokomial
Standar ≤ 1,5 %
Penanggung jawab Kepala instalasi rawat inap/komite medik/panitia mutu
Pengumpulan data
3. Tidak adanya kejadian pasien jatuh yang berakibat kecacatan/kematian
Judul Tidak adanya kejadian pasien jatuh yang berakibat kecacatan/kematian
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya pelayanan keperawatan yang aman bagi pasien
Definisi Kejadian pasien jatuh adalah kejadian pasien jatuh selama dirawat baik akibat jatuh
Operasional dari tempat tidur, di kamar mandi, dsb, yang berakibat kecacatan atau kematian
Inklusi Semua pasien rawat inap
Eksklusi -
Frekuensi Tiap bulan
Pengumpulan
Data
Periode Analisa Tiap bulan
Numerator Jumlah pasien dirawat dalam bulan tersebut dikurangi jumlah pasien yang jatuh dan
berakibat kecacatan atau kematian
Denominator Jumlah pasien dirawat dalam bulan tersebut
Sumber Data Rekam medis, laporan keselamatan pasien
Standar 100 %
Penanggung jawab Kepala Instalasi Rawat Inap
Pengumpulan data
4. Assesmen Awal Medis Dalam 24 Jam
Judul Assesmen awal medis dalam 24 jam

4
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya kemampuan rumah sakit dalam mengetahui kemampuan pengkajian
awal medis pasien baru <24 jam
Definisi Pengkajian awal medis pasien baru <24 jam adalah suatu tindakan penilaian kondsi
Operasional klinis pasien baru yang dilakukan selama menjalani rawat inap dalam kurun waktu <24
jam secara berkelanjutan
Inklusi Seluruh pasien baru yang dirawat
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa 3 bulan sekali
Numerator Jumlah tindakan pengkajian awal medis yang dilakukan pada pasien baru

Denominator Jumlah seluruh pasien baru


Sumber Data Instalasi Rekam Medik
Standar 100%
Penanggung jawab Kepala Instalasi Rekam Medik
Pengumpulan data
5. Assesmen awal keperawatan dalam 24 jam
Judul Assesmen awal keperawatan dalam 24 jam
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya kemampuan rumah sakit dalam mengetahui kemampuan pengkajian
awal keperawatan pasien baru <24 jam
Definisi Pengkajian awal keperawatan pasien baru <24 jam adalah suatu tindakan penilaian
Operasional kondsi klinis pasien baru yang dilakukan selama menjalani rawat inap dalam kurun
waktu <24 jam secara berkelanjutan
Inklusi Seluruh pasien baru yang dirawat
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa 3 bulan sekali
Numerator Jumlah tindakan pengkajian awal keperawatan yang dilakukan pada pasien baru

Denominator Jumlah seluruh pasien baru


Sumber Data Instalasi Rekam Medik
Standar 100%
Penanggung jawab Kepala Instalasi Rekam Medik
Pengumpulan data
6. Kejadian Pulang Paksa
Judul Kejadian pulang paksa
Dimensi Mutu Efektifitas, kesinambungan pelayanan
Tujuan Tergambarnya penilain pasien terhadap efektifitas pelayanan rumah sakit
Definisi Pulang paksa adalah pulang atas permintaan pasien atau keluarga pasien
Operasional sebelum diputuskan boleh pulang oleh dokter
Inklusi Pasien pulang paksa
Eksklusi -
Frekuensi 1 bulan
Pengumpulan
Data
Periode Analisa 3 bulan
Numerator Jumlah pasien pulang paksa dalam satu bulan
Denominator Jumlah seluruh pasien yang dirawat dalam satu bulan
Sumber Data Rekam Medis
Standar ≤5%
Penanggung jawab Ketua komite mutu/tim mutu
Pengumpulan data
7. Kepuasan Pelanggan Rawat Inap
Judul Kepuasan Pelanggan Rawat Inap

5
Dimensi Mutu Kenyamanan
Tujuan Terselenggaranya persepsi pelanggan terhadap mutu pelayanan rawat inap
Definisi Kepuasan pelanggan adalah pernyataan puas oleh pelanggan terhadap pelayanan
Operasional rawat inap
Inklusi Semua pasien yang mendapatkan pelayanan di rawat inap
Eksklusi -
Frekuensi 1 bulan
Pengumpulan
Data
Periode Analisa 3 bulan
Numerator Jumlah kumulatif hasil penilaian kepuasan pasien yang disurvey (dalam prosen)
Denominator Jumlah total pasien yang disurvei (n minimal 50)
Sumber Data Survei
Standar ≥ 90 %
Penanggung jawab Ketua komite mutu/tim mutu
Pengumpulan data
8. Ketepatan waktu pemberian injeksi antibiotik
Judul Ketepatan waktu pemberian injeksi antibiotik
Dimensi Mutu Ketepatan
Tujuan Terselenggaranya kinerja tenaga kesehatan yang disiplin dan sistematis
Definisi 1. Injeksi adalah suatu cara yang dilakukan untuk memasukkan ke dalam tubuh
Operasional sejumlah sediaan steril berupa larutan, emulsi, atau suspensi atau serbuk yang
harus dilarutkan atau disuspensikan lebih dahulu sebelum digunakan
2. Antibiotik adalah zat yang memiliki kemampuan untuk menghambat kehidupan
mikroorganisme
Inklusi Seluruh pasien rawat inap yang mendapat terapi antibiotik
Eksklusi -
Frekuensi Tiap bulan
Pengumpulan
Data
Periode Analisa Satu bulan
Numerator Pasien yang mendapat terapi injeksi antibiotik secara tepat waktu
Denominator Seluruh pasien yang mendapat terapi injeksi antibiotik
Sumber Data Buku injeksi rawat inap dan rekam medik
Standar 80%
Penanggung jawab Kepala Instalasi Rawat Inap
Pengumpulan data
9. Kejadian tertusuk limbah benda tajam infeksius
Judul Kejadian tertusuk limbah benda tajam infeksius
Dimensi Mutu Keselamatan
Tujuan Menggambarkan kepatuhan petugas terhadap prosedur dan ketersediaan fasilitas
yang aman
Definisi Terpaparnya cairan tubuh (orang lain/pasien) pada tubuh pekerja kesehatan, yang
Operasional terjadi selama melakukan pekerjaannya, melalui jarum suntik atau instrumen tajam
termasuk (lancet, scaple dll)
Inklusi Tenaga kesehatan yang tertusuk limbah benda tajam infeksius
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Setiap bulan
Numerator Kejadian tertusuk jarum
Denominator -
Sumber Data Laporan staf dan form laporan insiden tertusuk benda tajam
Standar 0
Penanggung jawab IPCN
Pengumpulan data

6
IV. BEDAH SENTRAL

1. Waktu tunggu operasi elektif


Judul Waktu tunggu operasi elektif
Dimensi Mutu Efektifitas, kesinambungan pelayanan, efisiensi
Tujuan Tergambarnya kecepatan penanganan antrian pelayanan bedah

7
Definisi Waktu tunggu operasi elektif adalah tenggang waktu mulai dokter memutuskan untuk
Operasional operasi yang terencana sampai dengan operasi mulai dilaksanakan
Inklusi Pasien yang merencanakan operasi
Eksklusi -
Frekuensi 1 bulan
Pengumpulan
Data
Periode Analisa 3 bulan
Numerator Jumlah kumulatif waktu tunggu operasi yang terencana dari seluruh pasien yang
dioperasi dalam satu bulan
Denominator Jumlah pasien yang dioperasi dalam satu bulan
Sumber Data Rekam medis
Standar ≤ 2 hari
Penanggung jawab Ketua instalasi bedah sentral
2. Kejadian kematian dimeja operasi
Judul Kejadian kematian dimeja operasi
Dimensi Mutu Keselamatan, efektifitas
Tujuan Tergambarnya efektifitas pelayanan bedah sentral dan anestesi dan kepedulian
terhadap keselamatan pasien
Definisi Kematian dimeja operasi adalah kematian yang terjadi di atas meja operasi pada
Operasional saat operasi berlangsung yang diakibatkan oleh tindakan anastesi maupun tindakan
pembedahan
Inklusi Pasien yang dilakukan pembedahan
Eksklusi -
Frekuensi Tiap bulan dan sentinel event
Pengumpulan
Data
Periode Analisa Tiap bulan dan sentinel event
Numerator Jumlah pasien yang meninggal dimeja operasi dalam satu bulan
Denominator Jumlah pasien yang dilakukan tindakan pembedahan dalam satu bulan
Sumber Data Rekam medis, laporan keselamatan pasien
Standar ≤1%
Penanggung jawab Kepala instalasi bedah sentral/komite medis
3. Tidak adanya kejadian operasi salah sisi
Judul Tidak adanya kejadian operasi salah sisi
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya kepedulian dan ketelitian instalasi bedah sentral terhadap
keselamatan pasien
Definisi Kejadian operasi salah sisi adalah kejadian dimana pasien dioperasi pada sisi yang
Operasional salah, misalnya yang semestinya dioperasi pada sisi kanan, ternyata yang dilakukan
operasi adalah pada sisi kiri atau sebaliknya
Inklusi Pasien yang dilakukan pembedahan
Eksklusi -
Frekuensi 1 bulan dan sentinel event
Pengumpulan
Data
Periode Analisa 1 bulan dan sentinel event
Numerator Jumlah pasien yang dioperasi dalam waktu satu bulan dikurangi jumlah pasien yang
dioperasi salah sisi dalam waktu satu bulan
Denominator Jumlah pasien yang dioperasi dalam waktu satu bulan
Sumber Data Rekam medis, laporan keselamatan pasien
Standar ≤ 100 %
Penanggung jawab Kepala instalasi bedah sentral/komite medis
4. Tidak adanya kejadian operasi salah orang
Judul Tidak adanya kejadian operasi salah orang
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya kepedulian dan ketelitian instalasi bedah sentral terhadap
keselamatan pasien

8
Definisi Kejadian operasi salah orang adalah kejadian dimana pasien dioperasi pada orang
Operasional yang salah
Inklusi Pasien yang dilakukan pembedahan
Eksklusi -
Frekuensi 1 bulan dan sentinel event
Pengumpulan
Data
Periode Analisa 1 bulan dan sentinel event
Numerator Jumlah pasien yang dioperasi dalam waktu satu bulan dikurangi jumlah operasi salah
orang dalam waktu satu bulan
Denominator Jumlah pasien yang dioperasi dalam waktu satu bulan
Sumber Data Rekam medis, laporan keselamatan pasien
Standar ≤ 100 %
Penanggung jawab Kepala instalasi bedah sentral/komite medis
5. Tidak adanya kejadian salah tindakan pada operasi
Judul Tidak adanya kejadian salah tindakan pada operasi
Dimensi Mutu Keselamatan pasien
Tujuan Tergambarnya ketelitian dalam pelaksanaan operasi dan kesesuaiannya dengan
tindakan operasi rencana yang telah ditetapkan
Definisi Kejadian salah satu tindakan pada operasi adalah kejadian pasien mengalami
Operasional tindakan operasi yang tidak sesuai dengan yang direncanakan
Inklusi Pasien yang dilakukan pembedahan
Eksklusi -
Frekuensi 1 bulan dan sentinel event
Pengumpulan
Data
Periode Analisa 1 bulan dan sentinel event
Numerator Jumlah pasien yang dioperasi dalam waktu satu bulan dikurangi jumlah pasien yang
mengalami salah tindakan operasi dalam waktu satu bulan
Denominator Jumlah pasien yang dioperasi dalam waktu satu bulan
Sumber Data Rekam medis, laporan keselamatan pasien
Standar ≤ 100 %
Penanggung jawab Kepala instalasi bedah sentral/komite medis
6. Tidak adanya kejadian tertinggalnya benda asing pada tubuh pasien setelah operasi
Judul Tidak adanya kejadian tertinggalnya benda asing pada tubuh pasien setelah
operasi
Dimensi Mutu Keselamatan pasien
Tujuan Kejadian tertinggalnya benda asing adalah kejadian dimana benda asing
sepertikapas, gunting, peralatan operasi dalam tubuh pasien akibat tundakan suatu
pembedahan
Definisi Kejadian salah satu tindakan pada operasi adalah kejadian pasien mengalami
Operasional tindakan operasi yang tidak sesuai dengan yang direncanakan
Inklusi Pasien yang dilakukan pembedahan
Eksklusi -
Frekuensi 1 bulan dan sentinel event
Pengumpulan
Data
Periode Analisa 1 bulan dan sentinel event
Numerator Jumlah pasien yang dioperasi dalam waktu satu bulan dikurangi jumlah pasien yang
mengalami tertinggalnya benda asing dalam tubuh akibat operasi dalam satu bulan
Denominator Jumlah pasien yang dioperasi dalam satu bulan
Sumber Data Rekam medik, laporan keselamatan pasien
Standar ≤ 100 %
Penanggung jawab Kepala instalasi bedah sentral/komite medik
7. Angka Kepatuhan Melakukan Time Out Dalam Prosedur Pembedahan
Judul Angka kepatuhan melakukan Time Out dalam prosedur pembedahan
Dimensi Mutu Keselamatan

9
Tujuan Tergambarnya kemampuan RS dalam memberikan pelayanan bedah untuk
mengurangi salah pasien, salah sisi operasi, salah prosedur

Definisi Time Out merupakan standar operasi yang meliputi pembacaan dan pengisian fomulir
Operasional sign in yang dilakukan sebelum pasien dianestesi yang di holding area, time out
yang dilakukan di operasi sesaat sebelum insisi pasien operasi dan sign out
setelah operasi selesai. Proses sign in, time out, dan sign out ini dipandu oleh
perawat sirkuler dan diikuti oleh operator, dokter anestesi, perawat.
Inklusi Seluruh pasien yang akan dilakukan tindakan pembedahan
Eksklusi Pasien dengan tindakan anestesi lokal
Frekuensi Setiap kali dilakukan tindakan operasi
Pengumpulan
Data
Periode Analisa 1 bulan sekali
Numerator Jumlah pasien yang dilakukan time out pada prosedur pembedahan dalam 1 bulan

Denominator Jumlah pasien dengan tindakan pembedahan dalam 1 bulan


Sumber Data Instalasi bedah sentral
Standar 100%
Penanggung jawab Kepala instalasi bedah sentral
8. Kelengkapan Assesmen Pre Anestesia
Judul Kelengkapan assesmen pre anestesia
Dimensi Mutu Medikolegal
Tujuan Mengetahui ketidaklengkapan dokumen medis khususnya anestesi

Definisi Dokumen medis pre anestesi lengkap adalah dokumen medis yang terisi
Operasional lengkap semua item yang disediakan
Inklusi Seluruh pasien yang akan dilakukan tindakan anestesi
Eksklusi Pasien dengan anestesi lokal
Frekuensi 1 bulan
Pengumpulan
Data
Periode Analisa 3 bulan
Numerator Jumlah dokumen medis pre anestesi yang tidak lengkap

Denominator Jumlah pasien yang mendapat anestesi


Sumber Data Rekapitulasi dokumen medis
Standar 0%
Penanggung jawab Instalasi bedah sentral
9. Kejadian tertusuk limbah benda tajam infeksius
Judul Kejadian tertusuk limbah benda tajam infeksius
Dimensi Mutu Keselamatan
Tujuan Menggambarkan kepatuhan petugas terhadap prosedur dan ketersediaan fasilitas
yang aman
Definisi Terpaparnya cairan tubuh (orang lain/pasien) pada tubuh pekerja kesehatan, yang
Operasional terjadi selama melakukan pekerjaannya, melalui jarum suntik atau instrumen tajam
termasuk (lancet, scaple dll)
Inklusi Tenaga kesehatan yang tertusuk limbah benda tajam infeksius
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Setiap bulan
Numerator Kejadian tertusuk jarum

Denominator -
Sumber Data Laporan staf dan form laporan insiden tertusuk benda tajam
Standar 0
Penanggung jawab IPCN

10
10. Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien rawat inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum aro pekalongan .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

V. PERSALINAN DAN PERINATOLOGI

1. Kejadian kematian ibu karena persalinan


Judul Kejadian kematian ibu karena persalinan
Dimensi mutu Keselamatan
Tujuan Mengetahui mutu pelayanan rumah sakit terhadap pelayanan persalinan.

11
Definisi operasional Kematian ibu melahirkan yang disebabkan karena perdarahan, pre eklamsia,
eklampsia, partus lama dan sepsis.
Perdarahan adalah perdarahan yang terjadi pada saat kehamilan semua skala
persalinan dan nifas.
Pre-eklampsia dan eklampsia mulai terjadi pada kehamilan trimester kedua, pre-
eklampsia dan elampsia merupakan kumpulan dari dua dari tiga tanda, yaitu :
- Tekanan darah sistolik > 160 mmHg dan diastolik >110mmHg
- Protein uria > 5 gr/24 jam 3+/4-pada pemeriksaankualitati
- Oedemtungkai
Eklampsia adalah tanda pre eklampsia yang disertai dengan kejang dan atau
penurunan kesadaran.
Sepsis adalah tanda-tanda sepsis yang terjadi akibat penanganan aborsi,
persalinan dan nifas yang tidak ditangani dengan tepat oleh pasien atau penolong.
Partus lama adalah…..

Inklusi Pasien yang melahirkan di Ruang Kebidanan


Eksklusi Death on Arrival
Frekuensi Tiap bulan
pengumpulan data
Periode analisis Tiap tiga bulan
Numerator Jumlah kematian pasien persalinan karena pendarahan, pre-eklampsia/eklampsia
dan sepsis
Denominator Jumlah pasien-pasien persalinan dengan pendarahan, pre-eklampsia/eklampsia
dan sepsis.
Sumber data Rekam medis rumah sakit
Standar Pendarahan < 1% pre-eklampsia < 30%, sepsis < 0,2%
Penanggung Jawab Komite Medik
2. Kemampuan menangani BBLR 1500 gr-2500gr
Judul Kemampuan menangani BBLR 1500 gr-2500 gr
Dimensi mutu Efektifitas dan keselamatan
Tujuan Tergambarnya kemampuan rumah sakit dalam menangani BBLR
Definisi operasional BBLR adalah bayi yang lahir dengan berat badan 1500 gr-2500 gr
Inklusi Bayi dengan berat 1500 gr – 2500 gr
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah BBLR 1500 gr-2500 gr yang berhasil ditangani
Denominator Jumlah seluruh BBLR 1500 gr-2500 gr yang ditangani
Sumber data Rekam medis
Standar 100%
Penanggung jawab Komite medik/Komite mutu
3. Kepuasan Pelanggan
Judul Kepuasan Pelanggan
Dimensi mutu Kenyamanan
Tujuan Tergambarnya persepsi pasien terhadap mutu pelayanan persalinan
Definisi operasional Kepuasan pelanggan adalah pernyataan puas oleh pelanggan terhadap
pelayananpersalinan.
Inklusi Pasien yang mendapatkan pelayanan di Ruang Kebidanan
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif hasil penilaian kepuasan dari pasien yang disurvei (dalam
prosen)
Denominator Jumlah total pasien yang disurvei (n minial 50)
Sumber data Survei
Standar > 80%
Penanggung jawab Ketua komite mutu/tim mutu
4. Kejadian tertusuk limbah benda tajam infeksius

12
Judul Kejadian tertusuk limbah benda tajam infeksius
Dimensi mutu Keselamatan
Tujuan Menggambarkan kepatuhan petugas terhadap prosedur dan ketersediaan fasilitas
yang aman
Definisi operasional Terpaparnya cairan tubuh (orang lain/pasien) pada tubuh pekerja kesehatan, yang
terjadi selama melakukan pekerjaannya, melalui jarum suntik atau instrumen
tajam termasuk (lancet, scaple dll)
Inklusi Tenaga kesehatan yang tertusuk limbah benda tajam infeksius
Eksklusi -
Frekuensi Setiap bulan
pengumpulan data
Periode analisis Setiap bulan
Numerator Kejadian tertusuk jarum

Denominator -
Sumber data Laporan staf dan form laporan insiden tertusuk benda tajam
Standar 0
Penanggung jawab IPCN
5. Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien rawat inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum aro pekalongan .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

VI. PELAYANAN INTENSIF

1. Rata-rata pasien yang kembali ke perawatan intensif dengan kasus yang sama < 72jam
Judul Rata-rata pasien yang kembali ke perawatan intensif dengan kasus yang
sama < 72 jam
Dimensi mutu Efektifitas
Tujuan Tergambarnya keberhasilan perawatan intensif

13
Definisi operasional Pasien kembali keperawatan intensif dari ruang rawat inap dengan kasus yang
sama dalam waktu < 72 jam
Inklusi Pasien yang mendapat pelayanan di ruang HCU
Eksklusi Pasien yang meninggal selama perawatan di ruang HCU <72 jam
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah pasien yang kembali ke perawatan intensif dengan kasus yang sama < 72
jam dalam 1 bulan.
Denominator Jumlah seluruh pasien yang dirawat di ruang intensif dalam 1 bulan.
Sumber data Rekam medis
Standar < 3%
Penanggung jawab Komite medik/mutu
2. Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien rawat inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum aro pekalongan .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

VII. RADIOLOGI

1. Waktu Tunggu Hasil Pelayanan Foto Thorax


Judul Waktu tunggu hasil pelayanan thorax foto
Dimensi mutu Efektifitas, kesinambungan pelayanan, efisiensi
Tujuan Tergambarnya kecepatan pelayanan radiologi
Definisi operasional Waktu tunggu hasil pelayanan thorax foto adalah tenggang waktu mulai pasien di
foto sampai dengan menerima hasil yang sudah diekspertisi (<3 jam)
14
Inklusi Semua pasien yang mendapatkan pelayanan di ruang radiologi
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif waktu tunggu hasil pelayanan thorax foto dalam satu bulan.
Denominator Jumlah pasien yang difoto thorax dalam bulan tersebut.
Sumber data rekam medis
Standar < 3%
Penanggung jawab Kepala instalasi radiologI
2. Pelaksana ekspertisi hasil pemeriksaan
Judul Pelaksana ekspertisi hasil pemeriksaan
Dimensi mutu Kompetensi tehnis
Tujuan Pembacaan dan verifikasi hasil pemeriksaan rontgen dilakukan oleh tenaga ahli
untuk memastikan ketepatan diagnosis
Definisi operasional Pelaksana ekspertisi rontgen adalah dokter spesialis Radiologi yang mempunyai
kewenangan untuk melakukan pembacaan foto rontgen/ hasil pemeriksaan
radiologi. Bukti pembacaan dan verifikasi adalah dicantumkannya tanda tangan
dokter spesialis radiologi pada lembar hasil pemeriksaan yang dikirimkan kepada
dokter yang meminta.
Inklusi Semua pasien yang mendapatkan pelayanan di ruang radiologi
Ekslusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah foto rontgen yang dibaca dan diverifikasi oleh dokter spesialis radiologi
dalam 1 bulan.
Denominator Jumlah seluruh pemeriksaan foto rontgen dalam 1 bulan.
Sumber data Register di Instalasi Radiologi
Standar 100 %
Penanggung jawab Kepala instalasi radiologI
3. Kejadian Kegagalan Pelayanan Rontgen
Judul Kejadian kegagalan pelayanan rontgen
Dimensi mutu Efektifitas dan efisiensi
Tujuan Tergambarnya efektifitas dan efisiensi pelayanan rontgen
Definisi operasional Kegagalan pelayanan rontgen adalah kerusakan foto yang tidak dapat dibaca
Inklusi Semua pasien yang mendapatkan pelayanan di ruang radiologi
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah foto rusak yang tidak dapat dibaca dalam 1 bulan
Denominator Jumlah seluruh pemeriksaan foto dalam 1 bulan
Sumber data Register radiology
Standar <2%
Penanggung jawab Kepala instalasi Radiologi
4. Kepuasan pelanggan
Judul Kepuasan pelanggan
Dimensi mutu Kenyamanan
Tujuan Tergambarnya persepsi pelanggan terhadap pelayanan radiologi
Definisi operasional Kepuasan pelanggan adalah pernyataan puas oleh pelanggan terhadap
pelayananradiology
Inklusi Semua pasien yang mendapatkan pelayanan di ruang radiologi
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah pasien yang disurvei yang menyatakan puas
Denominator Jumlah total pasien yang disurvei (n minimal 50)
Sumber data Survei
Standar > 80 %
15
Penanggung jawab Ketua komite mutu/tim mutu
5. Penggunaan Metode Sbar Pada Komunikasi Efektif Tenaga Medis Pasien Rawat Inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum aro pekalongan .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

VIII. LABORATORIUM

1. Waktu tunggu hasil pelayanan laboratorium


Judul Waktu tunggu hasil pelayanan laboratorium
Dimensi mutu Efektifitas, kesinambungan pelayanan, efisiensi
Tujuan Tergambarnya kecepatan pelayanan laboratorium
Definisi operasional Pemeriksaan laboratorium yang dimaksud adalah pelayanan pemeriksaan
laboratorium rutin dan kimia darah. Waktu tunggu hasil pelayanan laboratorium
untuk pemeriksaan laboratorium adalah tenggang waktu mulai pasien diambil
sample sampai dengan menerima hasil yang sudah diekspertisi.
Inklusi Semua pasien yang mendapatkan pelayanan di ruang laboratorium

16
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif waktu tunggu hasil pelayanan laboratorium pasien yang disurvey
dalam satu bulan
Denominator Jumlah pasien yang diperiksa di laboratorium yang disurvey dalam bulan tersebut.
Sumber data Survey
Standar <140 menit (manual)
Penanggung jawab Kepala Instalasi Laboratorium
2. Tidak Adanya Kesalahan Penyerahan Hasil Pemeriksaan Laboratorium
Judul Tidak adanya kesalahan penyerahan hasil pemeriksaan laboratorium
Dimensi mutu Keselamatan
Tujuan Tergambarnya ketelitian pelayanan laboratorium
Definisi operasional Kesalahan penyerahan hasil laboratorium adalah penyerahan hasil laboratorium
pada salah orang.
Inklusi Semua pasien yang mendapatkan pelayanan di ruang laboratorium
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah seluruh pasien yang diperiksa laboratorium dalam satu bulan dikurangi
jumlah penyerahan hasil laboratorium salah orang dalam satu bulan
Denominator Jumlah pasien yang diperiksa di laboratorium dalam bulan tersebut
Sumber data Rekam medis
Standar 100%
Penanggung jawab Kepala Instalasi Laboratorium
3. Kepuasan pelanggan
Judul Kepuasan pelanggan
Dimensi mutu Kenyamanan
Tujuan Tergambarnya persepsi pelanggan terhadap pelayanan laboratorium
Definisi operasional Kepuasan pelanggan adalah pernyataan puas oleh pelanggan terhadap
pelayananlaboratorium.
Inklusi Semua pasien yang mendapatkan pelayanan di ruang laboratorium
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif hasil penilaian kepuasan dari pasien yang disurvei (dalam
prosen)
Denominator Jumlah total pasien yang disurvei (n minial 50)
Sumber data Survei
Standar > 80 %
Penanggung jawab Kepala Instalasi Laboratorium
4. Kejadian tertusuk limbah benda tajam infeksius
Judul Kejadian tertusuk limbah benda tajam infeksius
Dimensi mutu Keselamatan
Tujuan Menggambarkan kepatuhan petugas terhadap prosedur dan ketersediaan fasilitas
yang aman
Definisi operasional Terpaparnya cairan tubuh (orang lain/pasien) pada tubuh pekerja kesehatan, yang
terjadi selama melakukan pekerjaannya, melalui jarum suntik atau instrumen
tajam termasuk (lancet, scaple dll)
Inklusi Tenaga kesehatan yang tertusuk limbah benda tajam infeksius
Eksklusi -
Frekuensi Setiap bulan
pengumpulan data
Periode analisis Setiap bulan
Numerator Kejadian tertusuk jarum

Denominator -
Sumber data Laporan staf dan form laporan insiden tertusuk benda tajam
17
Standar 0
Penanggung jawab IPCN
5. Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien rawat inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum aro pekalongan .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

IX. FARMASI

1. Tidak adanya kejadian kesalahan pemberian obat


Judul Tidak adanya kejadian kesalahan pemberian obat
Dimensi mutu Keselamatan dan kenyamanan
Tujuan Tergambarnya kejadian kesalahan dalam pemberian obat
Definisi operasional Kesalahan pemberian obat meliputi :
1. Salah dalam memberikan jenis obat
2. Salah dalam memberikan dosis
3. Salah orang
4. Salahjumlah
Inklusi Pasien survei yang mendapatkan obat
Eksklusi -
18
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah seluruh pasien instalasi farmasi yang disurvey dikurangi jumlah pasien
yang mengalami kesalahan pemberian obat
Denominator Jumlah seluruh pasien instalasi farmasi yang disurvei
Sumber data Survei
Standar 100%
Penanggung jawab Kepala Instalasi Farmasi
2. Penulisan resep sesuai formularium
Judul Penulisan resep sesuai formularium
Dimensi mutu Efisiensi
Tujuan Tergambarnya efisiensi pelayanan obat kepada pasien
Definisi operasional Formularium obat adalah daftar obat yang digunakan di rumah sakit.
Inklusi Resep yang sesuai dengan formularium
Eksklusi
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah resep yang diambil sebagai sampel yang sesuai formularium dalam satu
bulan.
Denominator Jumlah seluruh resep yang diambil sebagai sampel dalam satu bulan (n minimal
50)
Sumber data Survey
Standar 100%
Penanggung jawab Kepala Instalasi Farmasi
3. Kepatuhan penyimpanan obat High Alert
Judul Kepatuhan penyimpanan obat High Alert
Dimensi mutu Pemantauan obat high alert
Tujuan Obat high alert terkendali dengan baik
Definisi operasional Tergambarnya kemampuan rumah sakit dalam pemantauan/ pengendalian obat
high alert
Inklusi Obat high alert yang diberi label dengan benar
Eksklusi -
Frekuensi Setiap bulan
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah obat high alert yang dilabeli dengan benar dalam periode waktu tertentu

Denominator Jumlah keseluruhan obat high alert yang tersedia dalam waktu yang sama

Sumber data Bagian Farmasi


Standar 100%
Penanggung jawab Pengumpul data SKP 3 (KETEPATAN HIGHTALERT)
2. Kepatuhan Dokter Dalam Peresepan Obat Sesuai Formularium
Judul Kepatuhan Dokter Dalam Peresepan Obat Sesuai Formularium
Dimensi mutu Efisiensi, efektifitas dan keselamatan pasien.
Tujuan Tergambarnya tingkat kepatuhan dokter dalam peresepan obat sesuai
formularium.
Definisi operasional Formularium adalah himpunan obat yang diterima/ disetujui oleh Bagian Farmasi
untuk digunakan di rumah sakit dan dapt direvisi pada setiap batas waktu yang
ditentukan.
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah resep obat yang sesuai formularium.
Denominator Jumlah keseluruhan resep obat.
Sumber data Dokumen resep Bagian Farmasi Rawt Jalan
Standar 100%
Penanggung jawab Kepala Bagian Farmasi
19
pengumpul data

X. Gizi

1. Sisa makanan yang tidak termakan oleh pasien


Judul Sisa makanan yang tidak termakan oleh pasien
Dimensi mutu Efektifitas dan efisien
Tujuan Tergambarnya efektifitas dan efisiensi pelayanan instalasi gizi
Definisi operasional Sisa makanan adalah porsi makanan yang tersisa yang tidak dimakan oleh pasien
(sesuai dengan pedoman asuhan gizi rumah sakit)
Inklusi Pasien baru 1x24 jam yang mendapat pelayanan gizi
Eksklusi Pasien dengan diet khusus
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif porsi sisa makanan dari pasien yang disurvey
20
Denominator Jumlah pasien yang disurvey dalam satu bulan
Sumber data Survey
Standar >20%
Penanggung jawab Kepala Instalasi Gizi/Kepala Instalasi Rawat Inap
2. Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien rawat inap
Judul Penggunaan metode SBAR pada komunikasi efektif tenaga medis pasien
rawat inap
Dimensi mutu Komunikasi yang efektif
Tujuan Tergambarnya kemampuan rumah sakit dalam pelaporan kondisi pasien kritis
menggunakan komunikasi efektif
Definisi operasional Terlaksananya penggunaan komunikasi yang efektif dengan metode SBAR
(Situational Background Asessment Recommendation) diseluruh instalasi
pelayanan keperawatan di Rumah Sakit Umum .
Inklusi Penggunaan komunikasi SBAR
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Setiap 3 bulan
Numerator Jumlah pasien yang dilaporkan menggunakan SBAR dengan benar
Denominator Jumlah keseluruhan pasien yang seharusnya dilaporkan menggunakan SBAR
Sumber data Kuesioner harian dan bulanan di setiap ruang rawat inap
Standar 100%
Penanggung jawab Pengumpul data SKP 2 (KOMUNIKASI EFEKTIF)

XI. TRANSFUSI DARAH

1. Pemenuhan kebutuhan darah bagi setiap pelayanan transfusi


Judul Pemenuhan kebutuhan darah bagi setiap pelayanan transfusi
Dimensi mutu Keselamatan dan kesinambungan pelayanan
Tujuan Tergambarnya kemampuan bank darah rumah sakit dalam menyediakan
kebutuhan darah.
Definisi operasional Cukup jelas
Inklusi Seluruh pasien yang mendapatkan transfusi darah
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah permintaan kebutuhan darah yang dapat dipenuhi dalam 1 bulan
Denominator Jumlah seluruh permintaan darah dalam 1 bulan
21
Sumber data Survey
Standar 100%
Penanggung jawab Yang bertanggung jawab terhadap pengelolaan bank darah

2. Kejadian Reaksi Transfusi


Judul Kejadian reaksi transfusi
Dimensi mutu Keselamatan
Tujuan Tergambarnya ketelitian persiapan darah dan pelaksanaan transfusi darah
Definisi operasional Reaksi transfusi adalah kejadian tidak diharapkan (KTD) yang terjadi akibat
tindakan transfusi darah atau komponen darah kepada pasien, terdiri dari :
1. Reaksi akut adalah reaksi yang terjadi selama transfusi sampai 24 jam
setelah transfusi :
a. Ringan : pruritus, urtika, rash
b. Sedang-berat : gelisah, kemerahan di kulit, demam, urtika, takikardi,
sampai kaku otot
c. Reaktik anafilaktik : timbul beberapa menit awal transfusi dengan tanda-
tanda syok dan distress pernafasan (tidak ada demam)
d. Reaksi hemolitik intravaskular : timbul beberapa menit awal transfusi
dengan tanda-tanda hipotensi, penurunan kesadaran perdarahan tidak
terkontrol
e. TRALi (transfusion-associated acute lung injury), terjadi 1-4 jam sejak awal
transfusi, ditandai dengan gagal nafasdengan gambaran torak foto
kesuraman yang diinfus
2. Reaksi lambat adalah reaksi yang terjadi 5-10 hari pasca transfusi :
a. Reaksi hemolitik lambat : demam, anemia, ikterik, hemoglobunuri
b. Purpura : perdarahan dan trombositopenia berat (<100.000/uL)

Catatan : Untuk reaksi lambat ditetapkan oleh DPJP


Insklusi Seluruh pasien yang mendapatkan transfusi
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kejadian reaksi transfusi dalam satu bulan
Denominator Jumlah seluruh pasien yang mendapat transfusi dalam satu bulan
Sumber data Rekam medik
Standar <0,01%
Penanggung jawab Kepala UTD

XII. REKAM MEDIK

1. Kelengkapan pengisian rekam medik 24 jam setelah selesai pelayanan


Judul Kelengkapan pengisianrekam medik 24 jam setelah selesai pelayanan
Dimensi mutu Kesinambungan pelayanan dan keselamatan
Tujuan Tergambarnya tanggung jawab dokter dalam kelengkapan informasi rekam medik.
Definisi operasional Rekam medik yang lengkap adalah, rekam medik yang telah diisi lengkap oleh
dokter dalam waktu < 24 jam setelah selesai pelayanan rawat jalan atau setelah
pasien rawat inap diputuskan untuk pulang, yang meliputi identitas pasien,
anamnesis, rencana asuhan, pelaksanaan asuhan, tindak lanjut dan resume
Inklusi Rekam medik yang terselenggara tiap bulan
Eksklusi Rekam medik rawat jalan
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan

22
Numerator Jumlah rekam medik yang disurvei dalam 1 bulan yang diisi lengkap
Denominator Jumlah rekam medik yang disurvei dalam 1 bulan.
Sumber data Survey
Standar 100%
Penanggung jawab Kepala instalasi rekam medik/kepala bidang pelayanan dan penunjang medik.
2. Kelengkapan informed concent setelah mendapatkan informasi yang jelas
Judul Kelengkapan informed concent setelah mendapatkan informasi yang jelas
Dimensi mutu Keselamatan
Tujuan Tergambarnya tanggung jawab dokter untuk memberikan kepada pasien dan
mendapat persetujuan dari pasien akan tindakan medik yang dilakukan.
Definisi operasional Informed concent adalah persetujuan yang diberikan pasien/keluarga pasien atas
dasar penjelasan mengenai tindakan medik yang akan dilakukan terhadap pasien
tersebut.
Inklusi Lembar informed consent
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah pasien yang mendapat tindakan medik yang disurvey yang mendapat
informasi lengkap sebelum memberikan persetujuan tindakan medik dalam 1
bulan.
Denominator Jumlah pasien yang mendapat tindakan medik yang disurvey dalam 1 bulan
Sumber data Survey
Standar 100%
Penanggung jawab Kepala instalasi rekam medik
3. Waktu penyediaan dokumen rekam medik pelayanan rawat jalan
Judul Waktu penyediaan dokumen rekam medik pelayanan rawat jalan
Dimensi mutu Efektifitas, kenyamanan, efisiensi
Tujuan Tergambarnya kecepatan pelayanan pendaftaran rawat jalan
Definisi operasional Dokumen rekam medis rawat jalan adalah dokumen rekam medis pasien baru
atau pasien lama yang digunakan pada pelayanan rawat jalan. Waktu penyediaan
dokumen rekam medik mulai dari pasien mendaftar sampai rekam medis
disediakan/ditemukan oleh petugas.
Inklusi Penyediaan rekam medik rawat jalan
Eksklusi -
Frekuensi Tiap bulan
pengumpulan data
Periode analisis Tiap 3 bulan
Numerator Jumlah kumulatif waktu penyediaan rekam medis sampel rawat jalan yang diamati
Denominator Total sampel penyediaan rekam medis yang diamati (N tidak kurang dari 100).
Sumber data Hasil survei pengamatan diruang pendaftaran rawat jalan untuk pasien
baru/diruang rekam medis untuk pasien lama.
Standar Rerata < 10 menit
Penanggung jawab Kepala Instalasi Rekam Medik
4. Waktu penyediaan dokumen rekam medik pelayanan rawatinap
Judul Waktu penyediaan dokumen rekam medik pelayanan rawat inap
Dimensi mutu Efektifitas, kenyamanan, efisiensi
Tujuan Tergambarnya kecepatan pelayanan rekam medik rawat inap
Definisi operasional Dokumen rekam medis rawat inap adalah dokumen rekam medis pasien baru atau
pasien lama yang digunakan pada pelayanan rawat inap. Waktu penyediaan
dokumenrekammedikpelayananrawatinapadalahwaktumulaipasien
diputuskan untuk rawat inap oleh dokter sampai rekam medik rawat inap tersedia
di bangsal pasien.
Inklusi Penyediaan rekam medik rawat inap
Eksklusi -
Frekuensi tiap bulan
pengumpulan data
Periode analisis Tiap 3 bulan
Numerator Jumlah kumulatif waktu penyediaan rekam medis sampel rawat inap yang diamati
Denominator Total sampel penyediaan rekam medis rawat inap yang diamati
23
Sumber data Hasil survei pengamatan diruang pendaftaran rawat jalan
Standar Rerata < 15 menit
Penanggung jawab Kepala Instalasi Rekam Medik
5. Laporan 10 besar penyakit (demografi pasien) laporan per bulan dan jumlah pasien
Judul Laporan 10 besar penyakit (demografi pasien) laporan per bulan dan jumlah
pasien
Dimensi mutu Morbiditas pasien Instalasi Rawat Inap dan Instalasi Rawat Jalan
Tujuan Mengetahui jumlah angka morbiditas dari pelayanan kesehatan di Instalasi Rawat
Inap dan Instalasi Rawat Jalan
Definisi operasional Evaluasi data rekam medik tentang diagnosa pasien yang terdapat dalam
pelayanan Instalasi Rawat Inap dan Instalasi Rawat Jalan
Inklusi 10 besar penyakit rawat inap dan rawat jalan
Eksklusi -
Frekuensi Setiap hari
pengumpulan data
Periode analisis Bulanan dan Tahunan
Numerator 10 besar penyakit yang ada dalam pelayanan Instalasi Rawat Inap dan Instalasi
Rawat Jalan
Denominator -
Sumber data Data Rekam Medik Instalasi Rawat Inap dan Instalasi Rawat Jalan
Standar Adanya tren 10 penyakit terbanyak setiap bulan
Penanggung jawab Kepala Instalasi Rekam Medik
6. Pemanfaatan Bor
Judul Pemanfaatan BOR
Dimensi Mutu Efektivitas dan Mutu Pelayanan
Tujuan Tergambarnya pemanfaatan pelayanan rawat inap
Definisi Bed Occupancy Rate adalah prosentase pemakaian tempat tidur pada satuan
Operasional waktu tertentu
Inklusi -
Eksklusi -
Frekuensi 1 Bulan
Pengumpulan
Data
Periode Analisa 1 Bulan
Numerator Jumlah hari perawatan di rumah sakit
Denominator Jumlah tempat tidur x Jumlah hari dalam satu periode
Sumber Data Rekam Medik
Standar 75%
Penanggung jawab Kepala Instalasi Rawat Inap
Pengumpulan data Kepala Instalasi Rekam Medik

XIII. Pengolahan Limbah

1. Baku mutu limbah cair


Judul Baku mutu limbah cair
Dimensi mutu Keselamatan
Tujuan Tergambarnya kepedulian rumah sakit terhadap keamanan limbah cair rumah
sakit
Definisi operasional Baku mutu adalah standar minimal pada limbah cair yang dianggap aman bagi
kesehatan, yang merupakan ambang batas yang ditolerir dan diukur dengan
indikator :
BOD (Biological Oxygen Demand) : 30mg/liter
COD (Chemical Oxygen Demand) : 80 mg/liter
TSS (Total Suspended Solid) 30mg/liter
PH : 6-9
Inklusi Limbah cair Rumah Sakit
Eksklusi -
Frekuensi 3 bulan
pengumpulan data
24
Periode analisis 3 bulan
Numerator Hasillaboratorium pemeriksaan limbah cair rumah sakit yang sesuai dengan
bakumutu.
Denominator Jumlah seluruh pemeriksaan limbah cair.
Sumber data Hasil pemeriksaan
Standar 100%
Penanggung jawab Kepala IPSRS
2. Pengolahan limbah padat berbahaya sesuai dengan aturan
Judul Pengolahan limbah padat berbahaya sesuai dengan aturan
Dimensi mutu Keselamatan
Tujuan Tergambarnya mutu penanganan limbah padat infeksius di rumah sakit
Definisi operasional Limbah padat berbahaya adalah sampah pada akibat proses pelayanan yang
mengandung bahan-bahan yang tercemar jasad renik yang dapat menularkan
penyakit dan/atau dapat mencederai, antara lain :
1. Sisa jarumsuntik
2. Sisa ampul
3. Kasabekas
4. Sisajaringan
Pengolahan limbah padat berbahaya harus dikelola sesuai dengan aturan dan
pedoman yang berlaku
Inklusi Limbah padat Rumah Sakit
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah limbah padat yang dikelola sesuai dengan standar prosedur operasional
yang diamati
Denominator Jumlah total proses pengolahan limbah padat yang diamati
Sumber data Hasil pengamatan
Standar 100%
Penanggung jawab Kepala IPSRS / Kepala K3 RS

XIV. Administrasi dan Manajemen

1. Cost Recovery
Judul Cost recovery
Dimensi mutu Efisiensi, efektivitas
Tujuan Tergambarnya tingkat kesehatan keuangan di rumah sakit
Definisi operasional Cost recovery adalah jumlah pendapatan fungsional dalam periode waktu tertentu
dibagi dengan jumlah pembelanjaan operasional dalam periode waktu tertentu.
Inklusi
Eksklusi
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah pendapatan fungsional dalam satu bulan
Denominator Jumlah pembelanjaan operasional dalam satu bulan
Sumber data Sub bagian kepegawaian
Standar >40%
Penanggung jawab Kepala Bagian Tata Usaha/Keuangan
2. Ketepatan waktu penyusunan laporan keuangan
25
Judul Ketepatan waktu penyusunan laporan keuangan
Dimensi mutu Efektivitas
Tujuan Tergambarnya disiplin pengelolaan keuangan rumah sakit
Definisi operasional Laporan keuangan meliputi realisasi anggaran dan arus kas
Laporan keuangan harus diselesaikan sebelum tanggal 10 setiap bulan berikutnya
Inklusi
Eksklusi
Frekuensi Tiga bulan
pengumpulan data
Periode analisis Tiga bulan
Numerator Jumlah laporan keuangan yang diselesaikan sebelum tanggal setiap bulan
berikutnya dalam tiga bulan
Denominator Jumlah laporan keuangan yang harus diselesaikan dalam tiga bulan
Sumber data Sub bagian kepegawaian
Standar 100%
Penanggung jawab Kepala Bagian Tata Usaha/Keuangan
3. Ketepatan waktu pemberian imbalan (insentif) sesuai kesepakatan waktu
Judul Ketepatan waktu pemberian imbalan (insentif) sesuai kesepakatan waktu
Dimensi mutu Efektivitas,
Tujuan Tergambarnya kinerja manajemen dalam memperhatikan kesejahteraan
karyawan.
Definisi operasional Insentif adalah imbalan yang diberikan kepada karyawan sesuai dengan kinerja
yang dicapai dalam satu bulan.
Inklusi
Eksklusi
Frekuensi Tiap 6 bulan
pengumpulan data
Periode analisis Tiap 6 bulan
Numerator Jumlah bulan dengan kelambatan pemberian insentif
Denominator 6
Sumber data Catatan di bagian keuangan
Standar 100%
Penanggung jawab Bagian Keuangan

XV. AMBULANCE

1. Waktu pelayanan ambulance


Judul Waktu pelayanan ambulance
Dimensi mutu Akses
Tujuan Tersedianya pelayanan ambulance yang dapat diakses setiap waktu oleh
pasien/keluarga pasien yang membutuhkan.
Definisi operasional Waktu pelayanan ambulance adalah ketersediaan waktu penyediaan ambulance
untuk memenuhi kebutuhan pasien/keluarga pasien
Inklusi Waktu pelayanan ambulance
Eksklusi Ambulance terpakai seluruhnya
Frekuensi Setiap bulan
pengumpulan data
Periode analisis Tiga bulan sekali
Numerator Total waktu buka (dalam jam) pelayanan ambulance dalam satu bulan
Denominator Jumlah hari dalam bulan tersebut
Sumber data Instalasi gawat darurat
Standar 24 jam
Penanggung jawab Penanggungjawab ambulance/kereta jenazah
2. Kecepatan memberikan pelayanan ambulance di rumah sakit
Judul Kecepatan memberikan pelayanan ambulance di rumah sakit
26
Dimensi mutu Kenyamanan, keselamatan
Tujuan Tergambarnya ketanggapan rumah sakit dalam menyediakan kebutuhan pasien
akan ambulance
Definisi operasional Kecepatan memberikan pelayanan ambulance adalah waktu yang dibutuhkan
mulai permintaan ambulance/kereta jenazah diajukan oleh pasien/keluarga pasien
di rumah sakit sampai tersedianya ambulance. Maksimal 30 menit
Inklusi Kecepatan penyediaan pelayanan ambulance
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah penyediaan ambulance yang tepat waktu dalam 1 bulan
Denominator Jumlah seluruh permintaan ambulance dalam satu bulan
Sumber data Catatan penggunaan ambulance
Standar 100%
Penanggung jawab Penanggung jawab ambulance

XVI. PELAYANAN PEMELIHARAAN SARANA RUMAH SAKIT

1. Kecepatan waktu menanggapi kerusakan alat


Judul Kecepatan waktu menanggapi kerusakan alat
Dimensi mutu Efektivitas, efisiensi, kesinambungan pelayanan
Tujuan Tergambarnya kecepatan dan ketanggapan dalam pemeliharaan alat
Definisi operasional Kecepatan waktu menanggapi alat yang rusak adalah waktu yang dibutuhkan
mulai laporan alat rusak diterima sampai dengan petugas melakukan
pemeriksaan terhadap alat yang rusak untuk tindak lanjut perbaikan,maksimal
dalam waktu 15 menit harus sudah ditanggapi.
Inklusi
Eksklusi
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah laporan kerusakan alat yang ditanggapi kurang atau sama dengan 15
menit dalam satu bulan.
Denominator Jumlah seluruh laporan kerusakan alat dalam satu bulan
Sumber data Catatan laporan kerusakan alat
Standar > 80 %
Penanggung jawab Kepala IPRS

27
XVII. PENDAFTARAN
1. Kepuasan Pelanggan pada Pendaftaran
Judul Kepuasan Pelanggan pada Rawat Jalan
Dimensi Mutu Kenyamanan
Tujuan Terselenggaranya pelayanan rawat jalan yang mampu memberikan kepuasan
pelanggan
Definisi Kepuasan adalah pernyataan tentang persepsi pelanggan terhadap pelayanan yang
Operasional diberikan
Inklusi Seluruh pasien yang mendapatkan pelayanan di rawat jalan
Eksklusi -
Frekuensi Setiap bulan
Pengumpulan
Data
Periode Analisa Tiga bulan sekali
Numerator Jumlah kumulatif rerata penilaian kepuasan pasien rawat jalan yang disurvey
Denominator Jumlah seluruh pasien rawat jalan yang disurvey (minimal n = 50)
Sumber Data Survey
Standar ≥ 90 %
Penanggung jawab Kepala Instalasi Pendaftaran /tim mutu/panitia mutu

2. Kelengkapan informed concent setelah mendapatkan informasi yang jelas dari pendaftaran
Judul Kelengkapan informed concent setelah mendapatkan informasi yang jelas
Dimensi mutu Keselamatan
28
Tujuan Tergambarnya tanggung jawab petugas pendaftaran untuk memberikan informasi
kepada pasien dan mendapat persetujuan dari pasien akan tindakan medik yang
dilakukan.
Definisi operasional Informed concent adalah persetujuan yang diberikan pasien/keluarga pasien atas
dasar penjelasan mengenai tindakan medik yang akan dilakukan terhadap pasien
tersebut.
Inklusi Lembar informed consent
Eksklusi -
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah pasien yang mendapat tindakan medik yang disurvey yang mendapat
informasi lengkap sebelum memberikan persetujuan tindakan medik dalam 1
bulan.
Denominator Jumlah pasien yang mendapat tindakan medik yang disurvey dalam 1 bulan
Sumber data Survey
Standar 100%
Penanggung jawab Kepala instalasi Pendaftaran
3. WAKTU TUNGGU PELAYANAN PENDAFTARAN
Judul Waktu tunggu pelayanan Pendaftaran
Dimensi mutu Efektifitas, kesinambungan pelayanan, efisiensi
Tujuan Terselenggaranya pelayanan pendaftaran rawat jalan pada hari kerja yang mudah
dan cepat diakses oleh pasien
Definisi operasional Waktu tunggu pelayanan Pendaftaran adalah tenggang waktu mulai pasien
mendaftar sampai dengan sampai di kirim ke poli klinik
Inklusi Semua pasien rawat jalan yang sedang melakukan pendaftaran
Eksklusi Pasien yang tidak datang pada waktu yang ditentukan
Frekuensi 1 bulan
pengumpulan data
Periode analisis 3 bulan
Numerator Jumlah kumulatif waktu tunggu mendaftar sampai dikirim ke poli klinik.
Denominator Jumlah pasien yang mendaftar dalam bulan tersebut.
Sumber data rekam medis
Standar < 3%
Penanggung jawab Kepala instalasi Pendaftaran

XVIII.PENCEGAHAN PENGENDALIAN INFEKSI

1. Tersedianya Alat Pelindung Diri


Judul Tersedianya APD (Alat Pelindung Diri)
Dimensi mutu Mutu pelayanan, keamanan pasien, petugas dan pengunjung
Tujuan Tersedianya APD di setiap instalasi RS
Definisi operasional Alat terstandar yang berguna untuk melindungi tubuh, tenaga kesehatan, pasien
atau pengunjung dari penularan penyakit di RS seperti masker, sarung tangan
karet, penutup kepala, sepatu bootsdan gaun
Inklusi Alat pelindung diri yang tersedia
Eksklusi
Frekuensi Setiap hari
pengumpulan data
Periode analisis 1 bulan
Numerator Jumlah instalasi yang menyediakan APD
Denominator Jumlah instalasi di rumah sakit
Sumber data Survey
Standar 75%
Penanggung jawab Tim PPI

2. Kegiatan pencatatan dan pelaporan infeksi nosokomial di Rumah Sakit


Judul Terlaksananya kegiatan pencatatan dan pelaporan infeksi nosokomial di
rumah sakit
Dimensi mutu Keamanan pasien, petugas dan pengunjung
29
Tujuan Tersedianya data pencatatan dan pelaporan infeksi di RS
Definisi operasional Kegiatan pengamatan faktor resiko infeksi nosokomial, pengumpulan data (cek
list) pada instalasi yang tersedia di RS, minimal 1 parameter (ILO, ILI, VAP,ISK)

Inklusi Semua pasien rawat inap


Eksklusi Pasien yang datang dengan dengan keluhan dan di diagnosa ISK
Frekuensi Setiap hari
pengumpulan data
Periode analisis 1 bulan
Numerator Jumlah instalasi yang melakukan pencatatan dan pelaporan
Denominator Jumlah instalasi yang tersedia
Sumber data Survey
Standar 75%
Penanggung jawab Tim PPI RS

Keterangan :
ILO : Infeksi Luka
Operasi ILI : Infeksi
LukaInfus
VAP : Ventilator Associated
Pneumonie ISK : Infeksi
SaluranKemih

3. Angka kepatuhan cuci tangan tenaga medis Rumah Sakit


Judul Angka kepatuhan cuci tangan tenaga medis Rumah Sakit
Dimensi mutu Keselamatan pasien
Tujuan Menggambarkan pelaksanaan cuci tangan sebagai upaya pencegahan infeksi dan
keselamatan pasien
Definisi operasional Terlaksananya cuci tangan five moment oleh semua karyawan di Rumah Sakit
Umum terutama yang bersentuhan langsung dengan pasien.
Inklusi
Eksklusi
Frekuensi Setiap bulan
pengumpulan data
Periode analisis 3 bulan sekali
Numerator Karyawan yang patuh melakukan cuci tangan five moment
Denominator Semua karyawan di Rumah Sakit Umum yang seharusnya melakukan cuci tangan
five moment (terutama yang bersentuhan langsung dengan pasien).
Sumber data Blangko kepatuhan cuci tangan
Standar 85 %
Penanggung jawab IPCN
4. Ketaatan Penggunaan APD
Judul Ketaatan Penggunaan APD
Dimensi mutu Keselamatan
Tujuan Tergambarnya kepatuhan petugas rumah sakit dalam memakain alat pelindung diri
Definisi operasional Suatu peralatan yang dipakai oleh petugas kesehatan untuk melindungi dirinya
dari risiko penularan mikroorganisme infeksius dari pasien misalnya darah, cairan
tubuh
Inklusi
Eksklusi
Frekuensi Hasil observasi dalam bulan tersebut
pengumpulan data
Periode analisis Setiap bulan
Numerator Total pemakaian APD sesuai paparan darah
Denominator Total kegiatan yang diobservasi (pemasangan infus)
Sumber data Lembar audit kepatuhan, hasil observasi
Standar 80%
Penanggung jawab IPCN, IPCLN, Kepala Instalasi

30

Anda mungkin juga menyukai