Anda di halaman 1dari 42

RESPONSIKASUS

OSTEOARTRITIS

RESPONSIKASUS OSTEOARTRITIS Oleh: IKt.AgusIndraAdhiputra(0802005121) Pembimbing: Prof.Dr.dr.TjokordaRakaPutra,SpPD-KR

Oleh:

IKt.AgusIndraAdhiputra(0802005121)

Pembimbing:

Prof.Dr.dr.TjokordaRakaPutra,SpPD-KR

DALAMRANGKAMENJALANIKEPANITERAANKLINIKMADYA

DIBAGIANILMUPENYAKITDALAMRSUPSANGLAH

FAKULTASKEDOKTERANUNIVERSITASUDAYANA

2017

i

KATAPENGANTAR

PujisyukurpenulispanjatkankepadaTuhanYangMahaEsakarenaberkat

rahmat-Nyapenulisdapatmenyelesaikanlaporanresponsikasusyangberjudul “Osteoarthritis”tepatpadawaktunya.Penulisantugasinimerupakansalahsatu prasyaratdalammengikutiKepaniteraanKlinikMadya diBagian /SMFIlmu PenyakitDalamFakultasKedokteranUniversitasUdayana/RSUPSanglah. Dalampenyusunantugasini,banyakpihakyangtelahmembantudariawal hinggaakhir,baikmoralmaupunmaterial.Olehkarenaitupadakesempatanini, penulisinginmengucapkanterimakasihkepada:

1)

Prof.Dr.dr.Tjokorda Raka Putra,SpPD-KR, selaku pembimbing

2)

laporan ini, atas bimbingan, saran dan masukan selama penyusunannya. Dokter-dokter residen yang bertugas di Bagian / SMF Ilmu

3)

PenyakitDalamFakultasKedokteranUniversitasUdayana/RSUP Sanglah,atasbimbingandansaran-sarannya. Rekan-rekan dokter muda yang bertugas di Bagian / SMFIlmu

PenyakitDalamFakultasKedokteranUniversitasUdayana/RSUP

Sanglah,atasbantuannyadalampenyusunanlaporanini.

Penulismenyadaribahwaresponsikasusinimasihjauhdarisempurna,

untukitusarandankritikmembangun,sangatpenulisharapkandemiperbaikan

tugasserupadiwaktuberikutnya.Semogatugasinijugadapatmemberimanfaat

bagipihakyangberkepentingan.

ii

Denpasar, 2017

Penulis

DAFTAR ISI

 

Halaman

KATAPENGANTAR

i

DAFTARISI

ii

BABI.PENDAHULUAN

1

BABII.TINJAUANPUSTAKA

2

2.1 DefinisiOsteoartritis

2

2.2 EpidemiologiOsteoartritis

2

2.3 PatogenesisOsteoartritis…………………………………

3

2.4 FaktorResikoOsteoartritis

4

2.4.1FaktorPredisposisi

4

2.4.2FaktorBiomekanis

7

2.5 DiagnosisOsteoartritis

8

2.5.1Anamnesis

8

2.5.2PemeriksaanFisik

9

2.5.3KriteriaDiagnosis

9

2.6 PemeriksaanDiagnostik

11

2.7 Penatalaksanaan

11

BABIIILAPORANKASUS

14

BABIVPEMBAHASAN

32

4.1 Anamnesis

32

4.2 PemeriksaanFisik

33

4.3 PemeriksaanPenunjang…………………………………………. 34

4.4 Diagnosis

34

4.5Terapi

34

BABVSIMPULAN

37

DAFTARPUSTAKA

iii

BABI

PENDAHULUAN

Osteoartritis(OA)merupakanpenyakitsendidegeneratifyangberkaitandengan kerusakan kartilago sendi. Osteoartritis yang juga disebut sebagai penyakit degeneratifmerupakansalahsatumasalahkedokteranyangpalingseringterjadi danmenimbulkangejalapadaorangusialanjutmaupunsetengahbaya.Terjadi pada orang dari segala etnis, lebih sering mengenai wanita dan merupakan penyebabterseringpadapenyebabdisabilitasjangkapanjangpadapasiendengan usialebihdaripada65tahun. 1

WHOmelaporkan40%pendudukduniayanglansiaakanmenderitaOA,

dari jumlah tersebut 80% mengalami keterbatasan gerak sendi. Prevalensi

OsteoartritisdiIndonesiacukuptinggiyaitu5%padausia>40tahun,30%pada

usia 40-60 tahun dan 65% pada usia > 61 tahun. Degenerasi sendi yang menyebabkansindromklinisosteoartritismunculpalingseringpadasenditangan, panggul,kaki,danspinemeskipunbisaterjadi padasendisinovialmanapun. Prevalensi kerusakan sendi sinovial ini meningkat dengan pertambahan usia. Diperkirakan 1 sampai 2 juta orang usia lanjut di Indonesia menderita cacat karenaOA.OlehkarenaitutantanganterhadapdampakOAakansemakinbesar karenasemakinbanyaknyapopulasiyangberusiatua. 1

Osteoartritisseringkaliterjaditanpadiketahuipenyebabnyayangdikenali sebagaiidiopatik.Osteoartritissekunderdapatterjadiakibattraumapadasendi, infeksi, perkembangan, kelainan neurologi dan metabolik. Osteoartritis merupakan sekuen retrogresif dari perubahan sel dan matriks yang berakibat kerusakanstrukturdanfungsikartilagoartikular,diikutiolehreaksiperbaikandan remodelingtulang.Karenareaksiperbaikandanremodelingtulangini,degenerasi permukanartikulerpadaOAtidakbersifatprogresif,dankecepatandegenerasi sendibergantungpadatiapindividudansendi. 1

PengobatanOAyangadapadasaatiniadalahbersifatsimtomatikdengan obat anti inflamasi non steroid dikombinasi dengan program rehabilitasi dan proteksisendi.Padastadiumlanjutdapatdipikrkanberbagaitindakanoperatif. 1

1

BABII

TINJAUANPUSTAKA

2.1DefinisiOsteoartritis

Osteoartitis (OA) merupakan penyakit sendi degeneratif, dimana keseluruhan strukturdarisendimengalamiperubahanpatologis.Ditandaidengankerusakan tulangrawan(kartilago)hyalinsendi,meningkatnyaketebalansertasklerosisdari lempengtulang,pertumbuhanosteofitpadatepiansendi,meregangnya kapsula sendi,timbulnyaperadangan,danmelemahnya otot–ototyangmenghubungkan sendi. 1,2

2.2EpidemiologiOsteoartritis

Osteoartritis merupakan sebagian besar bentuk arthritis dan penyebab utama disabilitas pada lansia. OA merupakan penyebab beban utama untuk pasien,

pemberipelayanankesehatan,danmasyarakat.WHOmelaporkan40%penduduk

dunia yang lansia akan menderita OA, dari jumlah tersebut 80% mengalami

keterbatasangeraksendi.Penyakitinibiasanyaterjadipadausiadiatas70tahun.

Bisaterjadipadapriadanwanita,tetapipriabisaterkenapadausiayanglebih

muda.PrevalensiOsteoartritisdiIndonesiacukuptinggiyaitu5%padausia>40

tahun,30%padausia40-60tahundan65%padausia>61tahun. 7 Berdasarkan studiyangdilakukandipedesaanJawaTengahmenemukanprevalensiuntukOA

mencapai52%padapriadanwanitaantarausia40-60tahundimana15,5%pada

priadan12,7%padawanita 1,2 .

Sebesar32,6%pendudukProvinsiBalimengalamigangguanpersendian,

danangkainilebihtinggidariprevalensiNasionalyaitu22,6%dengan60<4%

kasusterjadipadakelompokumur55-74tahunyangumumnyadikeluhkanpada

sendi lutut dan pergelangan kaki. Berdasarkan data kunjungan di poliklinik Reumatologi RSUP Sanglah Denpasar pada tahun 2001-2003, osteoartritis

merupakankasustertinggi(37%)diikutidenganRNA,AG,SLE,danlain-lain.

KelainanpadalututmerupakankelainanterbanyakdariOAdiikutisendipanggul dantulangbelakang. 1,2

2

2.3PatogenesisOsteoartritis

2.3PatogenesisOsteoartritis Gambar1.PathogenesisterjadinyaOsteoartritis. 3

Gambar1.PathogenesisterjadinyaOsteoartritis. 3 OAdisebabkanolehperubahanbiomekanikaldanbiokimiatulangrawanyang terjadiolehadanyapenyebabmultifaktorialantaralainkarenafaktorumur,stress mekanis, atau penggunaan sendi yang berlebihan, defek anatomik, obesitas, genetik,humoraldanfaktorkebudayaan,dimanaakanterjadiketidakseimbangan antaradegradasidansintesistulangrawan.Ketidakseimbanganinimenyebabkan pengeluaran enzim-enzim degradasi dan pengeluaran kolagen yang akan mengakibatkankerusakantulangrawansendidansinovium(sinuvitissekunder) akibat terjadinya perubahan matriks dan struktur. Selain itu juga akan terjadi pembentukanosteofitsebagaisuatuprosesperbaikanuntukmembentukkembali persendiansehinggadipandangsebagaikegagalansendiyangprogresif. 2,3 Duakeluargaenzimyangpentingdalamdegradasimatriks,baikdalam tulangrawanyangsehatataupunpadaosteoarthritisadalahmetaloproteinasedan aggrecanases. Metaloproteinase (stromelysin, collagenase, gelatinase) akan memecahkolagen,gelatin,dankomponenproteinlaindarimatriks.Enzimini disekresi oleh sinovial sel dan khondrosit. Aggrecanases (ADAMTS) akan mendegradasiaggrecan.PeningkatandegradasiaggrecansolehenzimADAMTS adalah salah satu indikasi dari osteoarthritis awal, dan memberikan kontribusi yangsignifikanterhadaphilangnyastrukturtulangrawandanfungsi. 2,3

3

Padatulangrawanyangsehat,aktivitasdegradasienzimdiseimbangkan dan diregulasi oleh faktor pertumbuhan dan inhibitor degradasi enzim. Faktor pertumbuhan ini menginduksi khondrosit untuk mensistesis DNA dan protein seperti kolagen dan proteoglikan. Faktor pertumbuhan yang berperan adalah

insulin-likegrowthfactor(IGF-1),growthhormone,transforminggrowthfactorb

(TGF-b)dancolonistimulatingfactors(CSFs).Tetapipadakeadaaninflamasi,sel menjadi kurang sensitif terhadap efek IGF-1. 1,2,3,4 Tissue inhibitor of metalloproteinase (TIMP) dan plasminogen activator inhibitor (PAI-1) adalah inhibitor-inhibitorenzimyangberfungsiuntuk mendegradasi collagenasedan aggrecanase. 2,3 Pembentukan dan perkembangan OA sekarang dipercayai melibatkan keradangan bahkan pada tahap awal penyakit. Keseimbangan aktivitas sendi

terganggumelaluisuatudegradativecascadedanpenyebabterpentingadalahIL-

1danTNF.Sekresidarifactorinflamasisepertisitokinmerupakanmediatoryang

bisamenyebabkanterganggunya prosesmetabolismedan meningkatkanproses katabolik pada sendi. IL-1 dan TNF yang diproduksi oleh khondrosit, sel mononeuklear, osteoblast dan tisu sinovial menstimulasi sintesis dan sekresi metalloproteinase dan tissue plasminogen activator serta mensupresi sintesis proteoglikandidalamsendi. 2,3,4

2.4FaktorRisikoOsteoartritis

Secara garis besar, terdapat dua pembagian faktor risiko OA yaitu faktor predisposisidanfaktorbiomekanis.Faktorpredisposisimerupakanfaktoryang memudahkanseseoranguntukterserangOA.Sedangkanfaktorbiomekaniklebih cenderung kepada faktor mekanis/ gerak tubuh yang memberikan beban atau tekananpadasendilututsebagaialatgeraktubuh,sehinggameningkatkanrisiko terjadinyaOA. 2,3,4

2.4.1FaktorPredisposisi

Usia Proses penuaan dianggap sebagai penyebab peningkatan kelemahan di sekitar sendi, penurunan kelenturan sendi kalsifikasi tulang rawa dan menurunkanfungsikondrosityangsemuanyamendukungterjadinyaOA. 3

4

JenisKelamin Prevalensi OA pada laki-laki sebelum usia 50 tahun lebih tinggi dibandingkan perempuan. Tetapi setelah usia lebih dari 50 tahun prevalensiperempuanlebihtinggimenderitaOAdibandingkanlaki-laki.

Perbedaantersebutmenjadisemakinberkurangsetelahmenginjakusia50-

80 tahun. Hal trsebut diperkirakan karena pada masa usia 50-80 tahun

wanitamengalamipenguranganhormoneestrogenyangsignifikan. 3,4

Ras/Etnis Prevalensi OA lutut pada pasien di Negara Eropa dan Amerika tidak berbeda, sedangkan suatu penelitian membuktikan bahwa ras Afrika- Amerika memiliki risiko menderita OA lutut 2 kali lebih besar dibandingkanrasKaukasia. 3,4

Faktorgenetik FaktorgenetikdidugajugaberperanpadakejadianOAlutut,haltersebut berhubungandenganabnormalitaskodegenetikuntuk sintesiskolagen yangbersifatditurunkan. 3,4

FaktorGayahidup Kebiasaanmerokok Banyaknya penelitian telah membuktikan bahwa ada hubungan positif antara merokok meningkatkan kandungan racun dalam darah dan mematikan jaringan akibat kekurangan oksigen, yang memungkinkan terjadinyakerusakantulangrawan. 3,4 Rokokjugadapatmerusakseltulang rawansendi.Hubungananataramerokokdenganhilangnyatulangrawan padaOAdapatdijelaskansebgaiberikut:

1. Merokok dapat merusak sel dan menghambat proliferasi sel tulangrawansendi. 2. Merokok dapat meningkatkan tekanan oksidan yang mempengaruhihilangnyatulangrawan. 3. Merokok dapat meningkatkan kandungan karbon monoksida dalamdarah,menyebabkanjaringankekuranganoksigendan dapatmenghambatpembentukantulangrawan. Perokok aktif mempunyai pengertian orang yang melakukan

5

langsungaktivitasmerokokdalamartimengisapbatangrokokyangtelah di bakar. Sedang perokok pasif adalah seorang yang tidak melakukan aktivitas merokok secara langsung, akan tetapi ia ikut menghirup asap yangdikeluarkanolehperokokaktif. 4 Dalampencatatanriwayatmerokokperludiperhatikan:

1. Riwayatmerokok

Perokokaktif

Perokokpasif

Bekasperokok

2. DerajatberatmerokokdalamIndeksBrinkman(IB),yaituperkalian

jumlahrata-ratabatangrokokdihisapseharidikalikanlamamerokok

dalamtahun:

Ringan:<10batangperhari

Sedang:10-20batangperhari

Berat:>20batangperhari

Penyakitlain

OAlututterbuktiberhubungandengandiabetesmellitus,hipertensidan

hiperurikemia,dengancatatanpasientidkmengalamiobesitas

Obesitas Obesitasmerupakanfaktorrisikoterkuatyangdapatdimodifikasi.Selama berjalan, setengah berat badan bertumpu pada sendi. Peningkatan berat badanakanmelipatgandakanbebansendisaatberjalan terutamasendi lutut.

Obesitasdapatdibedakanmenjadi3yaitu:

1. Obesitasberatadalahindeksmasatubuh(IMT)>27kg/m 2

2. ObesitasringanadalahIMT25-27kg/m 2

TidakobesitasadalahIMT≤25kg/m 2

Osteoporosis Osteoporosimerupakansalahsatufaktorrisikoyangdapatmenyebabkan osteoartritis.Salahsatufaktorresikoosteopororsisadalahminum-minum alkohol.Sehinggasemakinbanyakorangmengkonsumsialkoholsehingga akan mudah menjadi osteoporosis dan osteoporosis akan menyebabkan

6

osteoartritis. 2,3,4

2.4.2 FaktorBiomekanis

Riwayattraumalutut Trauma lutut yang aut termasuk robekan pada ligament krusiatum dan meniscusmerupakanfaktorrisikotimbulnyaOAlutut.StudiFramingham

menemukanbahwaorngadenganriwayattraumalututmemilikirisiko5-6

kalilipatlebih tinggi untukmenderita OA lutut.Hal tersebut biasanya terjadi pada kelompok usia yang lebih muda serta dapat menyebabkan kecacatanyanglamadanpengangguran 4 .

KelainanAnatomis Faktorrisikotimbulnya OAlutuanataralainkelainanlocalpadasendi lutut seperti genu varum, genu valgus, legg-calve Perthes disease dan dysplasiaasetubulum.Kelemahanototquadrisepdanlaksitiligamentum padasendilututtermasukkelainanlocalyangjugamenjadifaktorrisiko OAlutut. 4

Pekerjaan Osteoartritis banyak ditemukan pada pekerja fisik berat terutama yang banyak menggunakan kekuatan bertumpu pada lutut dan pinggang. PrevalensilebihtinggimenderitaOAlututditemukanpadakulipelabuhan, petani dan penambang dibandingkan pekerja yang tidak menggunakan kekuatanlututsepertipekerjaadministrasi.Terdapathubungansignifikan anatara pekerjaan yang menggunakan kekuatan lutut dan kejadian OA lutut. 4

Aktivitasfisik

Aktivitasfisikberatsepertiberdirilama(2jamataulebihsetiaphari),

berjalan jauh ( 2 jam atau lebih setiap hari), mengangkat barang berat

(10kg-20kg)selama10kaliataulebihsetiapminggu),naikturuntangga

setiaharimerupakanfaktorrisikoOAlutut. 4

Atlitolahragabenturankerasdanmembebanilututsepertisepakbola,lari marathondankungfumemilikirisikomeningkatkanuntukmenderitaOA lutut. Kelemahan otot quadrisep primer merupakan faktor risiko bagi

7

terjadinyaOAdenganprosesmenurunkanstabilitassendidanmengurangi shock yang menyerap materi otot. Tetapi, disisi lain seseorang yang memlikiaktivitasminimsehari-harijugaberisikomengalamiOA.Ketika seseorangtidakmengalamigerakan,alirancairansendiakanberkurang danberakibataliranmakananyangmasukkesendijugaberkurang.Hal tersebutakanmenyebabkanprosesdegeneratifberlebihan. 3,4

2.5DiagnosisOsteoartirits

2.5.1Anamnesis

Darianamnesis,pasienbiasanyaakanmengeluhkangejalasebagaiberikutsebagai tandadariseranganosteoartritis: 2,3,4

Persendiaan terasa kaku dan nyeri apabila digerakkan. Pada mulanya hanyaterjadipagihari,tetapiapabiladibiarkanakanbertambahburukdan menimbulkanrasasakitsetiapmelakukagerakantertentu,terutamapada waktumenopangberatbadan,namun bisamembaikbiladiistirahatkan. Pada beberapa pasien, nyeri sendi dapat timbul setelah istirahat lama, misalnyadudukdikursiataudijokmobildalamperjalananjauh.Kaku

sendipadaOAtidaklebihdari15-30menitdantimbulistirahatbeberapa

saatmisalnyasetelahbanguntidur.

Adanya pembengkakan/peradangan pada persendiaan. Pembengkakan bisapadasalahsatutulangsendiataulebih.Halinidisebabkankarena reaksiradangyangmenyebabkanpengumpulancairandalamruangsendi, biasanyaterabapanastanpaadakemerahan.

Nyerisenditerus-menerusatauhilangtimbul,terutamaapabilabergerak ataumenanggungbeban.

Persendianyangsakitberwarnakemerah-merahan.

Kelelahanyangmenyertairasasakitpadapersendiaan

Kesulitanmenggunakanpersendiaan

Bunyipadasetiappersendiaan(krepitus).Gejalainitidakmenimbulkan rasanyeri,hanyarasatidaknyamanpadasetiappersendiaan(umumnya tulanglutut)

Perubahanbentuktulang.Iniakibatjaringantulangrawanyangsemakin

8

rusak,tulangmulaiberubahbentukdanmeradang,menimbulakanrasasait yangamatsangat.

2.5.2PemeriksaanFisik

Padapemeriksaanfisikdariosteoartritisdapatditemukanketeganganlokaldan pembengkakan jaringan tulang atau jaringan lunak. Krepitus tulang (sensasi tulangbergesekan dengan tulang, yang ditimbulkangerakan sendi)merupakan karakteristikosteoartritis.Padaperabaandapatdirasakanpeningkatansuhupada sendi.Otot-ototsekitarsendiyangatrofidapatterjadikarenatidakdigunakanatau karenahambatanreflekdarikontraksiotot.Padatingkatlanjutosteoartritis,dapat terjadideformitasberat(misalpadaosteoartritislutut,kakimenjadiberbentukO atauX),hipertrofi(pembesaran)tulang,subluksasi,dankehilanganpergerakan sendi (Range of Motion,ROM). Pada saat melakukan gerakan aktif atau digerakkan secarapasif.Adapunpredileksiosteoartritisadalahpadasendi-sendi tertentuseperticarpometacarpalI,matatarsophalangealI,sendiapofisealtulang belakang,lutut(tersering)danpaha. 2,3,4

2.5.3KriteriaDiagnosis

UntukdiagnosisOAlutut,tangandanpinggulmenngunakancriteriaAmerican CollegeRheumatology1986. 2,3,4 1. KriteriaDiagnosisOsteoartritisPanggul Nyeripanggul Dan

1. KriteriaDiagnosisOsteoartritisPanggul Nyeripanggul Dan Endorotasi<15 0 ataudan LED<45mm/jamataudan

Endorotasi<15 0 ataudan

LED<45mm/jamataudan

Fleksi<115 0 jikaLED Tidakada

Fleksi<115 0 jikaLED Tidakada Eksorotasi15 0 dan nyeripanggul kaku sendi < 60

Eksorotasi15 0 dan nyeripanggul kaku sendi < 60 menitdan

Umur50tahun

Berdasarkananamnesis,pemeriksaanfisik,laboratorisdanradiologis

Tradisionalformat:nyeripangguldan2dariberikutini:

LED<20mm/jam

Ro:osteofitpadaacetabulumataufemur

Ro:penyempitanruangantarsendi

9

2. KriteriadiagnosisOsteoartritislutut

a. Berdasarkan anamnesis dan pemeriksaan fisiknyeri lutut dan 3 dari berikutini:

Umur>50tahun

Kakusendi<30menit

Krepituspadagerakanaktif

Pembesaransendi

Nyeritulang

Hangatpadaperabaan

b. Berdasarkananamnesis, pemeriksaanfisikdanradiologis:nyerilutut

dan1diantaraberikutini:

Umur>50tahun

Kakusendi<30menit

Krepituspadagerakanaktifdanosteofit

c. Berdasarkananamnesis,pemeriksaanfisikdanlaboratorium:nyerilutut

dan5diantaraberikutini:

Umur>50tahun

Kakusendi<30menit

Krepituspadagerakanaktif

Pembesaransendi

Nyeritulang

Hangatpadaperabaan

LED<40Mm/jam

Rheumatoidfaktor<1:40

AnalisisCairansendiMenunjukkanOA

3.Kriteriadiagnosis,Osteoartritistangan:nyeriataukakupadajari-jari

tangandan3dariberikutini:

Pembesaransendi2ataulebihdariDIPII,III,PIPII,IIIdanMCP

I(D/S)

Pembesaransendi2ataulebihDIP

PembengkakanMCP<3sendi

10

Derformitasdarisendi-sendiyangdisebutdiatas.

2.6PemeriksaanDiagnostik

PadapasienOA,dilakukannyapemeriksaanradiografipadasendiyangterkena

sudahcukupuntukmemberikansuatugambarandiagnostik.GambaranRadiografi

sendiyangmenyokongdiagnosisOAadalah:

a. Penyempitancelahsendiyangseringkaliasimetris(lebihberatpadabagian

yangmenanggungbebansepertilutut).

b. Peningkatandensitastulangsubkondral(sklerosis).

c. Kistapadatulang

d. Osteofitpadapinggirsendi

e. Perubahanstrukturanatomisendi

Berdasarkantemuan-temuanradiografisdiatas,makaOAdapatdiberikansuatu

derajat. Kriteria OA berdasarkan temuan radiografis dikenal sebagai kriteria KellgrendanLawrence yangmembagiOAdimulaidaritingkatringanhingga

tingkatberat.Perludiingatbahwapadaawalpenyakit,gambaranradiografissendi

masihterlihatnormal. 4,5 Padapemeriksaanlaboratoriumditemukanyaitudarah tepi (hemoglobin, leukosit, laju endap darah) dalam batas-batas normal. Pemeriksaanimunologi(ANA,faktorrheumatoiddankomplemen)juganormal. PadaOAyangdisertaiperadangan, mungkindidapatkan penurunan viskositas, pleositosis ringan sampai sedang, peningkatan sel peradangan (<8000/m) dan peningkatanprotein. 4,5

2.7Penatalaksanaan

PengelolaanpasiendenganOAbertujuanuntukuntukmenghilangkankeluhan, mengoptimalkan fungsi sendi, mengurangi ketergantungan dan meningkatkan kualitas hidup, menghambat progresivitas penyakit dan mencegah komplikasi. Pilarterapi:nonfarmakologis(edukasi,terapifisik,diet/penurunanberatbadan), farmakologis (analgetik, kortikosteroid lokal, sistemik, kondroprotektif dan biologik),danpembedahan. 3,4,5

11

1.

Edukasi

SangatpentingbagisemuapasienOAdiberikanedukasiyangtepat.Duahalyang menjadi tujuan edukasi adalah bagaimana mengatasi nyeri dan disabilitas. Pemberianedukasi(KIE)padapasieninisangatpentingkarenadenganedukasi diharapkanpengetahuanpasienmengenaipenyakitOAmenjadimeningkatdan pengobatan menjadi lebih mudah serta dapat diajak bersama-sama untuk mencegahkerusakanorgansendilebihlanjut.Edukasiyangdiberikanpadapasien ini yaitu memberikan pengertian bahwa OA adalah penyakit yang kronik, sehinggaperludipahamibahwamungkindalamderajattertentuakantetapada rasanyeri,kakudanketerbatasangeraksertafungsi.Selainitujuga diberikan pemahamanbahwahaltersebutperludipahamidandisadarisebagaibagiandari realitaskehidupannya. Agarrasanyeridapatberkurang,makapasiensedianya mengurangi aktivitas/pekerjaannya sehingga tidak terlalubanyak menggunakan sendilututdanlebihbanyakberistirahat.Pasienjugadisarankanuntukkontrol kembali sehingga dapat diketahui apakah penyakitnya sudah membaik atau

ternyataadaefeksampingakibatobatyangdiberikan. 4,5

2. Terapifisik

Terapifisikbertujuanuntukmelatihpasienagarpersendiannyatetapdapatdipakai danmelatihpasienuntukmelindungisendiyangsakit.PadapasienOAdianjurkan untukberolahragatapiolahragayangmemperberatsendisebaiknyadihindari seperti lari atau joging. Hal ini dikarenakan dapat menambah inflamasi, meningkatkantekananintraartikularbilaadaefusisendidanbahkanbisadapat menyebabkanrobekankapsulsendi.Untukmencegahrisikoterjadinyakecacatan padasendi,sebaiknyadilakukanolahragapereganganototsepertim.Quadrisep femoris, dengan peregangan dapat membantu dalam peningkatan fungsi sendi secara keseluruhan dan mengurangi nyeri. Pada pasien OA disarankan untuk

senamaerobiclowimpact/intensitasrendahtanpamembebanitubuhselama30

menit sehari tiga kali seminggu. Hal ini bisa dilakukan dengan olahraga naik sepedaataudenganmelakukansenamlantai.Senamlantaibisadilakukandimana pasienmengambilposisiterlentangsambilmeregangkanlututnya, dengancara mengangkatkakidansecaraperlahanmenekukdanmeluruskanlututnya. 4,5

3. Diet

12

DietbertujuanuntukmenurunkanberatbadanpadapasienOAyanggemuk.Hal inisebaiknya menjadiprogramutamapengobatan OA.Penurunanberatbadan seringkali dapat mengurangi keluhan dan peradangan. Selain itu obesitas juga dapat meningkatkan risiko progresifitas dari OA. Pada pasien OA disarankan untuk mengurangi berat badan dengan mengatur diet rendah kalori sampai mungkin mendekati berat badan ideal. Dimana prinsipnya adalah mengurangi kalori yang masuk dibawah energi yang dibutuhkan. Penurunan energi intake

yangamandianjurkanpemberiandefisitenergiantara500-1000kaloriperhari,

sehinggadiharapkanakanterjadipembakaranlemaktubuhdanpenurunanberat

badan0,5–1kgperminggu.Biasanyaintakeenergidiberikan1200-1300kalper

hari,danpalingrendah800kalperhari.Formulayangdapatdigunakanuntuk

kebutuhanenergiberdasarkanberatbadanadalah22kal/kgBBaktual/hari,dengan

carainididapatkandefisitenergi1000kal/hari.Padapasiendianjurkanuntukdiet

1200kalperhariagarmencapaiBBidealnyayaknisetidaknyamencapai55kg.

Contohkomposisimakananyangkamianjurkanadalahdalamseharipasienbisa

memasak1gelasberas(550kal),4potongtempesedang(150kal),1buahtelur

(100 kal), 2potong ayam sedang (300 kal) dan 1 ikat sayuran kangkung (75 kal). 4,5 4. Terapi Farmakologis Pada pasien OA biasanya bersifat simptomatis. Untuk membantu mengurangi keluhan nyeri pada pasien OA,biasanya digunakan analgetika atau Obat Anti InflamasiNonSteroid(OAINS).Untuknyeriyangringanmakaasetaminophen

tidaklebihdari4gramperharimerupakanpilihanpertama.Untuknyerisedang

sampaiberat,atauadainflamasi,makaOAINSyangselektifCOX-2merupakan

pilihan pertama, kecuali jika pasien mempunyai risiko tinggi untuk terjadinya hipertensi dan penyakit ginjal. OAINS yang COX-2 non-selektif juga bisa diberikan asalkan ada perhatian khusus untuk terjadinya komplikasi gastrointestinaldanjikaadarisikoinimakaharusdikombinasidenganinhibitor pompaprotonataumisoprostol.Injeksikortikosteroidintraartikulerbisadiberikan terutamapadapasienyangtidakadaperbaikansetelahpemberianasetaminophen danOAINS.Tramadolbisadiberikantersendiriataudengankombinasidengan analgetik. 4,5

13

BABIII

LAPORANKASUS

I. IDENTITASPASIEN

Nama

:NWK

Umur

:74tahun

JenisKelamin

:Perempuan

Suku

:Bali

Agama

:Hindu

Pendidikan

:TamatSD

StatusPerkawinan

:Menikah

Pekerjaan

:IbuRumahTangga

Alamat

:Jl.DanauTempeG.MawarNo.7Sanur

TanggalMRS

:26April2013

TanggalPemeriksaan

:4Mei2013

II. KELUHANUTAMA

Nyeripadalututkiridankanan

III. ANAMNESAKHUSUS

PasiendatangkeIGDRSUPSanglahdengankeluhannyeripadalututkiri

dankanansejak11harisebelumpemeriksaan.Nyeriawalnyadikatakanhilang

timbul namun pagi hari sebelum masuk rumah sakit (MRS), nyeri dikatakan menetap.Nyeridirasakansepertiditusuk-tusukdanterlokalisirpadalututkiridan kanan. Nyeri dirasakan sangat berat oleh pasien hingga pasien tidak dapat beraktivitas.Nyeripadalututdirasakanmemberatterutamajikapasienberjalan, berdiri agak lama atau bangun dari posisi jongkok. Keluhan juga dikatakan memberatsaatpagiharidantidakmembaikjikapasienberistirahat.Pasienjuga

mengatakanseringmerasakannyeripadalututkanansejaksekitar2tahunyang

laludansudahmemperolehpengobatandaridokter.

Pasienjugamengeluhlututkiridankanannyaagakkakusehinggasulit

untukdigerakkan.Kakudikatakanbersamaandengantimbulnyarasanyeripada

14

lututdandirasakansekitar5-10menitkemudianhilang.Kakudirasakanbiasanya

padapagiharisaatbangundaritidurdansetelahpasienduduklama.Riwayat demamdisangkalolehpasien. Mual-muntahdisangkalolehpasien.

RiwayatPengobatan

Sejak2tahunyanglalupasienmengatakanhanyamemeriksakandirike

dokterumumbilakeluhannyatidakterlaluparah.Pasienhanyaberobatkerumah

sakitbilakeluhannyeri-nyeripadalututnyatidakhilangsetelahberobatdidokter

umum.Obat-obatantersebuthanyadiminumjikaterdapatkeluhansaja.Obatyang

biasadiminumolehpasienadalahnatriumdiclofenac.

RiwayatPenyakitSebelumnya

Pasiensudahseringmengalamisakitpadalututnyasejak2tahunyanglalu.

Pasien juga mengatakan pernah dirawat di RSUP Sanglah 2 bulan yang lalu dengan diagnosis OA dan DM tipe 2. Riwayat jatuh atau kecelakaan yang menimpalututkananmaupunkiripasiendisangkal.

RiwayatPenyakitKeluarga Pasienmengatakanibunyamempunyairiwayatpenyakityangsamapada

sendilututnyakira-kirasejakberumur50tahun,tetapitidakpernahmemeriksakan

diri ke dokter, hanya menggunakan obat tradisional seperti “boreh”. Riwayat penyakit lain seperti penyakit jantung, darah tinggi, diabetes militus dalam keluargajugadisangkal.

RiwayatSosialdanPribadi

Dahulupasienbekerjasebagaiburuhbangunan,namunsaatinipasiensudahtidak

bekerjalagidanhanyadiamdirumah.

IV. ANAMNESAUMUM KELUHANUMUM Perasaannyeri

: ada

Rasalemas

: ada

15

Faalumum

: menurun

Nafsukerja

: menurun

Beratbadan

: tetap

Panasbadan

: tidakada

Bengkak

: tidakada

Ikterus

: tidakada

Nafsumakan

: normal

Rasahaus

: tidakada

Cepatlapar

: tidakada

KELUHANDIKEPALA

Penglihatandiwaktusiang

: normal

Penglihatandiwaktumalam

: normal

Berkunang-kunang

: tidakada

Sakitpadamata

: tidakada

Pendengaran

: normal

Keseimbangan

: normal

Kotorantelinga

: ada

Hidung

darah

: tidakada

ingus

: tidakada

nyeri

: tidakada

Lidah

: normal

Gigi

: normal

Gangguanbicara

: tidakada

Gangguanmenelan

: tidakada

KELUHANALATDILEHER

Kakukuduk

: tidakada

Sesakdileher

: tidakada

Pembesaran/nyerikel.Limpe

: tidakada

Pembesaran/nyerikel.Tiroid

: tidakada

Pembengkakankel.Leher

: tidakada

16

Lain-lain

: tidakada

KELUHANALATDADA

Sesaknafas

 

: tidakada

Sesaknafasmalamhari

: tidakada

Sesaknafaskumat-kumatan

: tidakada

Ortopneu

: tidakada

Nyeriwaktunafas

 

: tidakada

Nafasberbunyi

: tidakada

Nyeridaerahjantung

: tidakada

Berdebar-debar

 

: tidakada

NyeriRetrosternal

: tidakada

Batuk

: tidakada

Riak

: tidakada

Hemoptoe

 

: tidakada

KELUHANDIPERUT

Membesar

 

: tidakada

Mengecil

: tidakada

Pembengkakan

 

: tidakada

Nyerispontan

: tidakada

Nyeritekan

 

: tidakada

Nyeribila

 

Makan

: tidakada

Berak

: tidakada

Lapar

: tidakada

Mual

: tidakada

Muntah

: tidakada

Obstipasi

: tidakada

Melena

: tidakada

Feses

:

berair

: tidakada

 

warna

: kuningkecoklatan

17

Diare

:

darah

: tidakada

 

lendir

: tidakada

Urine

:

Warna

: kuning

Inkontinensiaalvi

Inkontinensiaurine

Frekuensi : 3-5kaliperhari Jumlah : ½-1gelas(±100-200cc) Nokturia : tidakada : tidakada : tidakada

KELUHANTANGANDANKAKI

Gerakankakiterganggu

: ada

Nyerispontan

: ada

Nyeritekan

: ada

Nyeridalam

: tidakada

Kesemutan

: tidakada

Gerakantanganterganggu

: tidakada

Gangguansendi

: ada

Luka-luka

: tidakada

Gangrene

: tidakada

Rasamati

: tidakada

Lebihkurus

: tidakada

Oedema

: tidakada

Nekrosis

: tidakada

Kelainankuku

: tidakada

Kelainankulit

: tidakada

KELUHANLAIN

Alatlokomotorik

: tidakada

Tulang

: tidakada

Otot

: tidakada

Kel.Limfe

: tidakada

Kel.Hipertiroid

: tidakada

18

Kel.Hipotiroid

: tidakada

Kel.Endokrin

: tidakada

Lain-lain

: tidakada

V. ANAMNESISTAMBAHAN

Makanan:

Kualitas

: cukup

Kuantitas

: cukup

Intoksikasi

: tidakada

Merokok

: tidakada

Alkohol

: tidakada

Candu

: tidakada

Obat-obatan

: tidakada

Keluarga

Penyakitmenular

: tidakada

Penyakitketurunan : ada

Penyakityangberhubungandenganpekerjaan: tidakada

 

Penyakitvenerik

: tidakada

VI. PEMERIKSAANUMUM A. KESANUMUM Kesansakitnya :berat

Kesadaran

: E 4 V 5 M 6

Tinggibadan

:150cm

Keadaangizi

: cukup

Beratbadan

: 55kg

Anemia

: tidakada

IMT

: 24,44kg/m 2

Ikterus

: tidakada

Suhubadan

: 36,5 o C

Sianosis

: tidakada

Tidurdengan

:1bantal

Oedema

: tidakada

Tidurmiringkiri :bisa

Keadaankulit : normal

Tidurmiringkanan:bisa

Afoni

: tidakada

Pergerakan

: terbatas

Afasia

: tidakada

Tenang

: ada

Anatria

: tidakada

Kejang

: tidakada

Tremor

: tidakada

19

B. KEADAANPEREDARANDARAH

TekananDarah : 130/80mmHg

Kelainannadi:

Nadi

: 82x/menit

P.Different: tidakada

Isi

: cukup

P.Paradoksus: tidakada

Gelombang

: teratur

P.Magnus : tidakada

Iramanadi

: reguler

P.Parvus : tidakada

Kelainanpadaarteri

P.Alternan: tidakada

: tidakada

Kelainanpadaarteri

: tidakada

Kelainanpadaarteri abdominalis : tidakada

dilengan

femoralis

C. KEADAANKULIT

Penyakitkulit

:

tidakada

Petekie

: tidakada

Luka-luka

:

tidakada

Hematom

: tidakada

Pigmentasi

:

tidakada

Oedema

: tidakada

Anemia

:

tidakada

Dehidrasi

: tidakada

Ikterus

:

tidakada

Elastisitaskulit : normal

Dermografi

:

tidakada

Turgor

: normal

D. PERNAFASAN

Tipe

: torakoabdominal Kelainanpernafasan:tidakada

Frekwensi : 20x/menit

Oligpnoe

: tidakada

Teratur

: ada

Polipnoe

: tidakada

Ekspirasi

: normal

Ortopnoe

: tidakada

Inspirasi

: normal

Dispnoe

: tidakada

Stridor

: tidakada

Nafascupinghidung: tidakada

Pernafasanberbunyi:tidakada

20

VII. PEMERIKSAANKHUSUS

A. KEPALA

Tenggorokan

Bentuk

Nyeritekan : tidakada

: normal

Mata

Letak

Pergerakan : N/N

: normal

Lain-lain

: tidakada

Anemia

: -/-

Muka

Sianosis

: -/-

Kel.Kulit : tidakada

Ikterus

: -/-

Otot

: tidakada

Reflekcahaya: +/+

Tumor

: tidakada

Pupil

:isokor

Oedem

: tidakada

Kornea

: N/N

Kakheksia : tidakada Kel.Parotis : normal Hidung

Konvergensi:+/+ Konjungtiva :N/N Kel.Lakrimalis:N/N

Ingus

: tidakada

Tek.Intraokuler:N/N

Meatus

: normal

Saddlenose : tidakada

Lidah

Telinga

Besar

: normal

Cairan

: -/-

Bentuk

: normal

Pendengaran : N/N

Papil

: normal

Drumhead

: -/-

Frenulum

: normal

ProcesusMastoideus: N/N

Pergerakan : normal

Faring

Permukaan : normal

Mukosa

: normal

Bibir

: normal

Tonsil

: T 1 /T 1

Gigi&Gusi

: normal

Dinding

: normal

 

Uvula

: normal

B. LEHER

Inspeksi

Laring

:

Lokalisasi

: normal

Pem.kel.Limpe : tidakada

21

Besarnya

: normal

Bendunganvena :tidakada

Gerakansaatmenelan: normal

Denyutan

: normal

Palpasi

JVP

: PR+0cmH 2 O

Kakukuduk

: tidakada

Tulang

: normal

Tumor

: tidakada

Laring

: normal

Kelenjar

: normal

Kel.Tiroid

: normal

C. KETIAK

Kulitketiak

: normal

Tumor

: tidakada

Kelenjar

Pembuluhdarah : normal

: tidakmembesar

D. THORAKDEPAN

1) Inspeksi Fossasupraklavikulakanan : normal

: normal

kiri

Klavikula : N/N

Sternum : normal

Lengkungsudutepigastrium : <90 o

Selaiga

: N/N

Vousurecardiac

: tidakada Ototthorak:N/N

Simetrithorak

: simetris

Kulit

: N/N

Pergerakanwaktubernafas : N/N

: N/N

Pembuluhdarahkulit

Denyutanictuscordis

2) Palpasi

Pergerakannafas : simetris

Spidernevi: tidakada

Mamma

: N/N

:tidaktampak

Iktuscordis: tidakteraba

Vokalfremitus : N/N

Otot

:normal

Kulit

: normal

Tulang

:normal

Luasnya

: normal

Mamma

:N/N

Irama

: teratur

Getaran/thrill

: tidakada

3) Perkusi

Paru :

Jantung:

22

Batasbawahkanan: ICSVI Batasbawahkiri: ICSVII Pergerakan: N/N

Perbandinganperkusi: Sonor/Sonor 4) Auskultasi

Bataskanan:PSL(D)

Bataskiri:MCL(S)ICSV

Batasatas:ICSII

Paru

Jantung

Suaranafas

:

vesikuler+/+ Bunyijantung :S 1 S 2 Tglreg

Suaranafastambahan: Rhonki-/-, Murmur

:tidakada

Wheezing-/- Punctummaksimum:-

Bronkofoni

: -/-

Kualitas/kuantitas :-

 

Wisperedpectoriloque: -/-

Derajat

:

-

Penyebaran

:-

E. THORAKBELAKANG Inspeksi

Palpasi

Bentuk

: simetris

Nyeritekan

: -/-

Pergerakan

: simetris

VokalFremitus :N/N

Tulang

: N/N

Tulang

: N/N

Otot

: N/N

Otot

: N/N

Kulit

: N/N

Kulit

: N/N

Perkusi

Auskultasi

Batasbawahkanan : ThX

Suarapernafasan: ves/ves

Batasbawahkiri

: ThX

Suaratambahan:Rh-/-,Wh-/- Bronkoponi: tidakada Wisperedpectoriloque:tidakada

F.ABDOMEN

Inspeksi

Bentuk

: normal

Epigastrium:

 

Kulit

: Normal

Denyutan

: tidakada

Otot

: Normal

Sudut

: <90 o

Pusar

: normal

Pergerakanwaktunafas: normal

23

Pembuluhdarah : normal

Auskultasi

Suarausus

: normal

Suaraalirandalampembuluhdarah

: tidakterdeteksi

Palpasi

 

Dindingperut

: normal

Hati

:tidakteraba

Denyutanepigastrium : tidakada

-konsistensi

:-

Nyeri

: tidakada

-permukaan

:

-

Kandungempedu

: tidakteraba

-tepi

:-

Ginjal

: tidakteraba

-nyeritekan

:

-

Lien

: tidakteraba

Acites

: tidakada

Perkusi

 

Shiftingdullness

:tidakada

Undulasi

:tidakada

F.

REGIOINGUINALDANGENETALIA

 

Lipatanpaha

: tidakdievaluasi

Genetalia

: tidakdievaluasi

Sakrum

: tidakdievaluasi

Rektum

: tidakdievaluasi

G.

KAKIDANTANGAN

 

Kulit

: normal

Sendi-sendi

:

normal

Otot

: normal

Pembuluhdaraharteri: normal

 

Tulang

: normal

Jaridantelapaktangan: normal

Nyeritekan

: ada

LiverPalmaris : tidakada

Nyerispontan

: ada

Jaritabuh

: tidakada

Oedema

: tidakada

Kukusendok

: tidakada

Tenaga

: normal

Kukukacaarloji : tidakada

Lain-lain

: tidakada

24

H. URATSARAF Refleklutut

: +/+

Archiles

: +/+

DindingAbdomen : +/+

Bisep

: +/+

ReflekPatologis

: -/-

Perasaanditangan

: N/N

Perasaandikaki

: N/N

Tesromberg

: tidakdikerjakan

Caraberjalan

: pincang

Ataksia

: tidakada

Tessensibilitas

: normal

I.STATUSLOKALIS

Inspeksi:Simetrisitas Tophus Bengkak Hiperemis Palpasi: Hangat

Nyeritekan

Cekungansekitarpatela

Ballotement

Gerak: Fleksi

aktif

pasif Ekstensi aktif

pasif

Auskultasi:Krepitasi

GenuDekstra

25

-

-

-

-

+

+

+

130

130

0

0

0

0

0

0

+

simetris

GenuSinistra

-

-

-

-

+

+

+

130

130

0

0

0

0

0

0

+

VIII. PEMERIKSAANPENUNJANG A. RadiologiRontgen GenuDextraetSinistraAP/Lat -Alignmentbaik -Tampakosteofit+padacondylusmedialisdanlateralisos.femur dantibiakanankiri,padamargopotero-superoetinferior os.patellakanankiri -Celahdanpermukaansendibaik -Tidakrampakerosi/destruksitulang -Softtissueswelling(-) Kesan:OAgenubilateral

-Softtissueswelling(-) Kesan:OAgenubilateral Gambar2.1FotoPolosRontgenGenuDextraetSinistraAP/Lateral B.
-Softtissueswelling(-) Kesan:OAgenubilateral Gambar2.1FotoPolosRontgenGenuDextraetSinistraAP/Lateral B.

Gambar2.1FotoPolosRontgenGenuDextraetSinistraAP/Lateral

B. Laboratorium

DL(29-04-2013)

Pemeriksaan

Nilai

Satuan

NilaiRujukan

Remarks

WBC

7,37

x10 3 /μL g/dL

4,10-11,00

 

HGB

11,50

12,00-16,00

Rendah

HCT

37,80

%

36,00-46,00

PLT

319

x10 3 /μL

140,00-440,00

26

Kimiadarah(27-04-2013)

Pemeriksaan

Nilai

Satuan

NilaiRujukan

Remarks

BUN(mg/dl) Creatinin(mg/dl) Asamurat GlukosaDarahSewaktu

8,00

mg/dL

8,00-23,00

 

0,41

mg/dL

0,5-0,9

Rendah

1,80

mg/dL

2,00-5,70

Rendah

109,00

mg/dL

70,00-140,00

HbA1C

5,82

%

0,00-6,5

UrinLengkapdanSedimenUrin(26-04-2013)

Pemeriksaan

Nilai

Satuan

NilaiRujukan

Remarks

pH

5,0

-

5–8

 

nitrit

neg

-

Negatif

keton

150,00

mg/dL

Negatif

4+

protein

25,00

mg/dL

Negatif

1+

bilirubin

1,00

mg/dL

Negatif

1+

urobilinogen

8,00

mg/dL

1mg/dL

3+

eritrosit

250,00

ery/μL

Negatif

5+

leukosit

25,00

Leu/μL

Negatif

1+

silinder:

-

/lp

--

eritrosit

banyak

/lp

<3/lp

kristal

-

/lp

--

lekosit

1-3

/lp

<6/lp

selepitel

-

-

--

selgepeng

1-2

/lp

--

bakteri

+

/lp

--

VIII. RESUME Anamnesa

Pasienperempuan,74tahun,AgamaHindu,SukuBali,Pasiendatangke

IGDRSUPSanglahdengankeluhannyeripadalututkiridankanansejak11hari

sebelumpemeriksaan.Nyeriawalnyadikatakanhilangtimbulnamunpagihari

27

sebelummasukrumahsakit(MRS),nyeridikatakanmenetap.Nyeri dirasakan sepertiditusuk-tusukdanterlokalisirpadalututkiridankanan.Nyeridirasakan sangatberatolehpasienhinggapasientidakdapatberaktivitas.Nyeripadalutut dirasakanmemberatterutamajikapasienberjalan,berdiriagaklamaataubangun dariposisijongkok.Keluhanjugadikatakanmemberatsaatpagiharidantidak membaikjikapasienberistirahat.Pasienjugamengatakanseringmerasakannyeri

padakedualututsejak2tahunyanglaludansudahmemperolehpengobatandari

dokter.Pasienjugamengeluhlututkiridankanannyaagakkakusehinggasulit untukdigerakkan.Kakudikatakanbersamaandengantimbulnyarasanyeripada

lututdandirasakansekitar5-10menitkemudianhilang.Kakudirasakanbiasanya

padapagiharisaatbangundaritidurdansetelahpasienduduklama.Riwayat demamdisangkalolehpasien.Mual-muntahdisangkalolehpasien. Sejak2tahunyanglalupasien mengatakan hanya memeriksakandirike dokterumumbilakeluhannyatidakterlaluparah.Biasanyapasienmemperoleh pengobatandengannatriumdiclofenacyangdiminumhanyabilakeluhanmuncul. Pasien juga mengatakan pernah dirawat di RSUP Sanglah 2 bulan yang lalu dengan diagnosis OA dan DM tipe 2. Pasien mengatakan ibunya mempunyai riwayatpenyakityangsamasepertipasien.

PemeriksaanFisik:

KesanUmum Kesansakit :berat

Kesadaran

Tekanandarah :130/80mmHg

:CM

Nadi

:82x/menit

Respirasi

:20x/menit

T ax

:36,5ºC

BB

:55kg

TB

:150cm

IMT

: 24,44kg/mm 2

28

PemeriksaanKhusus:

Mata

: Anemia-/-,Ikterus-/-,RefleksPupil+/+(isokor)

Leher

: JVP=PR+0cmH 2 O

Thorak(Cor) :

Inspeksi : IktusKordistidakterlihat

Palpasi

: IktusKordistidakteraba

Perkusi

:

Bataskanan

: PSLkanan

 

Bataskiri

: MCLkiriICSV

Batasatas

: ICSII

Auskultasi :

Thorak(Pulmo):

S 1 S 2 tunggalreguler,murmur(-)

Inspeksi : Simetrisstatis/dinamis

Perkusi

: sonor/sonor

Palpasi

: VFN/N

Auskultasi : Vesikuler+/+,Rhonki-/-,Wheezing-/-

Abdomen

: Distensi(-),BisingUsus(+)normal,

Ekstremitas

Hepar/Lientidakteraba : Akralhangat(+),Edema(-)

29

STATUSLOKALIS

Inspeksi:Simetrisitas Tophus Bengkak Hiperemis Palpasi: Hangat Nyeritekan Cekungansekitarpatela Ballotement

Gerak: Fleksi

aktif

pasif

Ekstensi

aktif

pasif

Auskultasi:Krepitasi

PemeriksaanPenunjang:

GenuDekstra

simetris

-

-

-

-

+

+

+

130

130

0

0

0

0

0

0

+

GenuSinistra

-

-

-

-

+

+

+

130

130

0

0

0

0

0

0

+

PemeriksaanUrinLengkapdanSedimenUrin:Preoteinuria

RoGenuDet.SAP/Lat:KesanOAGenuDextraet.Sinistra

IX. DIAGNOSISKERJA OAGenuD/SFcIV

DMtipe2terkontrol

ObservasiCardiomegaliecHHD

X. PENATALAKSANAAN

IVFDNS8tpm

DietDM1900kkal+rendahgaram

Captopril2x25mg

NatriumDiclofenac2x50mg

Pantoprazole2x40mg

30

Fisioterapi

KIEpasien

XI. PROGNOSIS Advitam:Dubiusadbonam Adfungsionam:Dubiusadmalam

BABIV

PEMBAHASAN

4.1Anamnesis

Pada umumnya pasien OA mengatakan bahwa keluhannya sudah berlangsunglamatetapiberkembangsecaraperlahan-lahan.PasienOAbiasanya mengeluhnyeripadasendiyangterkenayangbertambahdengangerakanatau waktu melakukan aktivitas dan berkurang dengan istirahat. Namun, seiring denganperkembanganpenyakit,nyeriOAbisamenjadipersistent.Selainitujuga terdapatkakusendiyangdapattimbulsetelahimmobilitasataubahkansetelah bangun tidur. Krepitasi juga kadang-kadang terdengar pada sendi yang sakit, bentuksendiberubah(pembesaransendi)dangangguanfungsisendi.Gangguan berjalandangangguanfungsibisamenyukarkanaktivitaspasien.Hampirsemua pasien OA pergelangan kaki, tumit, lutut atau panggul berkembang menjadi pincang. 1,2 Padakasusini,darianamnesisditemukangejala-gejalaosteoartritisseperti nyerihilangtimbulpadalututyangsudahberlangsunglama.Nyeriyangdirasakan semakinlamasemakinseringdanakhirnyamenetapbeberapasaatsebelumpasien masukrumahsakit.Nyeridirasakansangatberatolehpasienhinggapasientidak dapat beraktivitas. Nyeri pada lutut dirasakan memberat terutama jika pasien berjalan, berdiri agak lama atau bangun dari posisi jongkok. Keluhan juga dikatakanmemberatsaatpagiharidantidakmembaikjikapasienberistirahat. Pasienjuga mengeluhlututkiridankanannya agakkakusehingga sulituntuk digerakkan.Kakudirasakanbiasanyapadapagiharisaatbangundaritidurdan setelahpasienduduklama. EpidemiologiterjadinyaOAlebihseringpadawanitadibandingkanpria. Faktorgenetikjuga berpengaruhpadatimbulnya OA.Pekerjaanberatmaupun denganpemakaiansatusendiyangterus-menerus berkaitandengan resikoOA tertentu. Demikian juga cedera sendi dan olahraga yang sering menimbulkan cederasendiberkaitandenganresikoOAyanglebihtinggi. 1,2

Padakasusini,pasienmerupakanseorangwanitaberumur74tahunyang

dahulu berprofesi sebagai buruh bangunan. Ibu pasien juga dikatakan pernah

32

memilikigejalayangsamadenganyangdideritaolehpasien.Haltersebutsesuai

denganfaktorresikoterjadinyaOA.

4.2PemeriksaanFisik

Pada pemeriksaan fisik dari osteoartritis dapat ditemukan tanda-tanda berupahambatangerak.PerubahaniniseringkalisudahadameskipunpadaOA yangmasihdini(secararadiologis).Biasanyabertambahberatdenganberatnya penyakit,sampaisendihanyabisadigoyangkandanmenjadikontraktur.Gejala lainnyaialahkrepitasi.GejalainilebihberartiuntukpemeriksaanklinislututOA. Gejalainitimbulkarenagesekankeduapermukaantulangsendipadasaatsendi digerakkan atau secara pasif di manipulasi. Pada perabaan dapat dirasakan pembangkakansendi.PembengkakanpadapasienOAdapattimbulkarenaefusi

padasendiyangbiasanyatidakbanyak(<100cc).Sebablainadalahkarenaadanya

osteofit,yangdapatmengubahpermukaansendi.Nyeritekan,gangguangerak, rasahangatyangmeratadanwarnakemerahanmungkindijumpaipadaOAkarena adanyasinovitis.Biasanyatanda-tandainitakmenonjoldantimbulbelakangan, seringkalidijumpaidilutut,pergelangankakidansendi-sendikeciltangandan kaki.Otot-ototsekitarsendiyangatrofidapatterjadikarenatidakdigunakanatau karenahambatanreflekdarikontraksiotot.Padatingkatlanjutosteoartritis,dapat terjadideformitasberatmisalpadaosteoartritislutut,kakimenjadiberbentukO atauX),hipertrofi(pembesaran)tulang,subluksasi,dankehilanganpergerakan sendi (Range of Motion,ROM). Pada saat melakukan gerakan aktif atau digerakkan secarapasif.Adapunpredileksiosteoartritisadalahpadasendi-sendi tertentuseperticarpometacarpalI,matatarsophalangealI,sendiapofisealtulang belakang,lutut(tersering)danpaha. 1,2,3 Padapasienini,daripemeriksaanfisikditemukanadanyanyeripadasendi lututkanandankiri.Nyeritersebutmunculsecaraspontandanjugasaatdilakukan penekanan.Akibatnyeritersebut,gerakansendilututpasienmenjaditerbatasdan pergerakansendipunmenjaditerganggu.Saattibadirumahsakit,nyeriyang dirasakan oleh pasien sudah menetap sehingga pasien sulit berjalan. Saat dilakukanpemeriksaansendi,ditemukanadanyakrepitasipadakedualututpasien. Lututpasienjugatampaksedikitbengkak.Deformitasjugatidakditemukan.

33

4.3Pemeriksaanpenunjang

PadapasienOAdapatdilakukanpemeriksaanradiologidanlaboratoriumuntuk menegakkandiagnosis.GambaranradiografiyangmendukungdiagnosisOAialah penyempitan celah sendi yang seringkali asimetris, peningkatan densitas (sklerosis tulang subkhondral), kista tulang, osteofit pada pinggir sendi dan

perubahan struktur anatomi sendi. 2,3 Pada pasien ini ditemukan osteofit pada

condylusmedialisdanlateralisos.femurdantibiakanankiri,padamargopostero-

superoetinferioros.patellakanankiri.HalinimendukungdiagnosisOAGenu

Dextraet.Sinistra.

Pada pemeriksaan laboratorium yang mendukung diagnosis OA yaitu darah tepi (hemoglobin, leukosit, laju endap darah) dalam batas-batas normal, kecualiOAgeneralisatayangharusdibedakandenganarthritisperadangan.Pada OA disertai peradangan, mungkin didapatkan penurunan viskositas, pleositosis

ringansampaisedang,peningkatanselperadangan(<8000/m)danpeningkatan

protein. 2,3,4 Padapasieniniditemukanpeningkatanproteinyangsalahsatunya karenaterjadikerusakanendotelakibattekanandarahyangtinggi.

4.4Diagnosis

PadasaatinipenegakandiagnosisOAterdiriatasanamnesis,pemeriksaanfisik, laboratorium, dan radiologi. 1,2,3,4 Dari hasil anamnesis, pemeriksaan fisik, laboratoriumdanradiologidapatdisimpulkanbahwapasieninimengalamiOA GenuDextraetSinistraFcIV. Selain itu, diagnosis OA sudah dapat ditegakkan berdasarkan kriteria klasifikasiTheAmericanCollegeof Rheumatologyyaituadanyanyerilututdan

gambaranradiografikosteofitdansalahsatudari:umur>50tahun,kakusendi<

30menit,serta krepitasi. 2,3,4 Pada pasieninimemenuhiseluruh kriteria diatas, sehinggasudahdapatmenegakkandiagnosisOA.

4.5Terapi

Penatalaksanaan pasien dengan OA bertujuan untuk menghilangkan keluhan, mengoptimalkan fungsi sendi, mengurangi ketergantungan dan meningkatkan kualitashidup,menghambat progresivitas penyakitdan mencegah komplikasi. 5

34

Terapi yang diberikan berupa terapi non farmakologis (edukasi, terapi fisik, diet/penurunan berat badan), farmakologis (analgetik, kortikosteroid lokal, sistemik,kondroprotektifdanbiologik),danpembedahan. 5 Edukasi Pemberianedukasi(KIE)padapasieninisangatpentingkarenadenganedukasi diharapkan pengetahuan mengenai penyakit OA menjadi meningkat dan pengobatan menjadi lebih mudah serta dapat diajak bersama-sama untuk mencegahkerusakanorgansendilebihlanjut.Agarrasanyeridapatberkurang, makapasiensedianyamengurangiaktivitas/pekerjaannya.Pasienjugadisarankan untuk kontrol kembali sehingga dapat diketahui apakah penyakitnya sudah membaikatauternyataadaefeksampingakibatobatyangdiberikan. 5 Terapifisik Terapifisikbertujuanuntukmelatihpasienagarpersendiannyatetapdapatdipakai danmelatihpasienuntukmelindungisendiyangsakit.Padapasieninidianjurkan untukberolahragatapiolahragayangmemperberatsendisebaiknyadihindari sepertilariataujoging.Untukmencegahrisikoterjadinyakecacatanpadasendi, sebaiknya dilakukan olah raga peregangan otot seperti m. Quadrisep femoris, dengan peregangan dapat membantu dalam peningkatan fungsi sendi secara keseluruhandanmenguranginyeri.Padapasieninidapatdisarankanuntuksenam aerobiclowimpact/intensitasrendah tanpamembebani tubuhselama 30menit seharitigakaliseminggu.Halinibisadilakukandenganolahraganaiksepedaatau denganmelakukansenamlantai. 5 Diet DietbertujuanuntukmenurunkanberatbadanpadapasienOAyanggemuk.Hal inisebaiknya menjadiprogramutamapengobatan OA.Penurunanberatbadan seringkali dapat mengurangi keluhan dan peradangan. Selain itu obesitas juga dapat meningkatkan risiko progresifitas dari OA. Pada pasien ini disarankan untuk mengurangi berat badan dengan mengatur diet rendah kalori sampai mungkin mendekati berat badan ideal. Dimana prinsipnya adalah mengurangi kalori yang masuk dibawah energi yang dibutuhkan. Penurunan energi intake

yangamandianjurkanpemberiandefisitenergiantara500-1000kaloriperhari,

sehinggadiharapkanakanterjadipembakaranlemaktubuhdanpenurunanberat

35

badan0,5–1kgperminggu.Biasanyaintakeenergidiberikan1200-1300kalper

hari,danpalingrendah800kalperhari.Formulayangdapatdigunakanuntuk

kebutuhanenergiberdasarkanberatbadanadalah22kal/kgBBaktual/hari,dengan

carainididapatkandefisitenergi1000kal/hari.Padapasiendianjurkanuntukdiet

1200kalperhariagarmencapaiBBidealnyayaknisetidaknyamencapai55kg.

Contohkomposisimakananyangkamianjurkanadalahdalamseharipasienbisa

memasak1gelasberas(550kal),4potongtempesedang(150kal),1buahtelur

(100kal),2potongayamsedang(300kal)dan1ikatsayurankangkung(75kal). 5 Terapi Farmakologis Pada pasien OA biasanya bersifat simptomatis. Untuk membantu mengurangi keluhan nyeri pada pasien OA,biasanya digunakan analgetika atau Obat Anti InflamasiNonSteroid(OAINS).Untuknyeriyangringanmakaasetaminophen

tidaklebihdari4gramperharimerupakanpilihanpertama.Untuknyerisedang

sampaiberat,atauadainflamasi,makaOAINSyangselektifCOX-2merupakan

pilihan pertama, kecuali jika pasien mempunyai risiko tinggi untuk terjadinya hipertensi dan penyakit ginjal. OAINS yang COX-2 non-selektif juga bisa diberikan asalkan ada perhatian khusus untuk terjadinya komplikasi gastrointestinaldanjikaadarisikoinimakaharusdikombinasidenganinhibitor pompa proton atau misoprostol. 5 Pada pasien ini diberikan natrium diclofenac

yangmerupakanselektifCOX-2untukmengobatinyerisedangsampaiberatdan

sebagaiantiinflamasi.Selainitu,obatinijugamemilikiefeksampingminimal

padagastrointestinal.

36

BABV

SIMPULAN

Osteoartitis (OA) merupakan penyakit sendi degeneratif yang ditandai dengan kerusakan tulang rawan hyalin sendi, meningkatnya ketebalan serta sklerosis, pertumbuhan osteofit, meregangnya kapsula sendi, timbulnya peradangan, dan melemahnyaotot–ototyangmenghubungkansendi.PadaumumnyapasienOA mengatakanbahwakeluhannyasudahberlangsunglamatetapiberkembangsecara perlahan-lahan. Pasien OA biasanya mengeluh nyeri pada sendi yang terkena yangbertambahdengangerakanatauwaktumelakukanaktivitasdanberkurang denganistirahat.

Padakasusini,darianamnesisditemukangejala-gejalaosteoartritisseperti nyerihilangtimbulpadalututyangsudahberlangsunglama.Nyeriyangdirasakan semakinlamasemakinseringdanakhirnyamenetap.Nyeridirasakansangatberat oleh pasien hingga pasien tidak dapat beraktivitas. Nyeri pada lututdirasakan memberatterutamajikapasienberjalan,berdiriagaklamaataubangundariposisi jongkok.Keluhanjugadikatakanmemberatsaatpagiharidanagakberkurangjika pasien beristirahat. Pasien juga mengeluh lutut kiri dan kanannya agak kaku sehingga sulit untukdigerakkan. Kaku dirasakan biasanya pada pagi hari saat bangundaritidurdansetelahpasienduduklama.

EpidemiologiterjadinyaOAlebihseringpadawanitadibandingkanpria. Faktorgenetikjuga berpengaruhpadatimbulnya OA.Pekerjaanberatmaupun denganpemakaiansatusendiyangterus-menerus berkaitandengan resikoOA tertentu. Pasien merupakan seorang wanita berumur 74 tahun yang dahulu berprofesisebagaiburuhbangunan.Ibupasienjugamemilikigejalayangsama. HaltersebutsesuaidenganfaktorresikoterjadinyaOA.Padapemeriksaanfisik ditemukanadanyanyeripadasendilututkanandankiri.Nyeritersebutmuncul secaraspontandanjugasaatdilakukanpenekanan.Akibatnyeritersebut,gerakan sendilututpasienmenjaditerbatasdanpergerakansendipunmenjaditerganggu. Pada pemeriksaan sendi ditemukan adanya krepitasi pada kedua lutut pasien. Lututpasientampaksedikitbengkakdandeformitastidakditemukan.

37

PadapasienOAdapatdilakukanpemeriksaanradiologidanlaboratorium untukmenegakkandiagnosis.Padapasieniniditemukanosteofitpadacondylus medialisdanlateralisos.femurdantibiakanankiri,padamargopostero-superoet inferior os.patella kanan kiri. Pada pemeriksaan laboratorium yaitu darah tepi (hemoglobin,leukosit,lajuendapdarah)dalambatas-batasnormal.Pemeriksaan imunologi (ANA, faktor rheumatoid dan komplemen) juga normal. Pada OA disertaiperadangan,mungkindidapatkanpenurunanviskositas,pleositosisringan sampaisedang,peningkatanselperadangandanpeningkatanprotein.

Penatalaksanaan pasien dengan OA bertujuan untuk menghilangkan keluhan, mengoptimalkan fungsi sendi, mengurangi ketergantungan dan meningkatkankualitashidup,menghambatprogresivitaspenyakitdanmencegah komplikasi.Terapiyangdiberikanpadapasieniniberupaterapinonfarmakologis (edukasi,terapifisik,diet/penurunanberatbadan),danfarmakologis(analgetik, kortikosteroidlokal,dansistemik).Padapasieninidiberikannatriumdiclofenac

yangmerupakanselektifCOX-2untukmengobatinyerisedangsampaiberatdan

sebagaiantiinflamasi.Selainitu,obatinijugamemilikiefeksampingminimal

padagastrointestinal.

38

DAFTARPUSTAKA

1. S Joewono, I Haryy, K Handono, B Rawan, P Riardi. Chapter 279 :

Osteoartritis.BukuAjarIlmuPenyakitDalamEdisiIVFKUI2006.1195-

1202

2. Kapoor,M.etal.RoleofPro-inflammatoryCytokinesinPathophysiology

ofOsteoarthritis.Nat.Rev.Rheumatol.7,33–42(2011)

3. BMandelbaum,WDavid.EtiologyandPathophysiologyofOsteoarthritis.

ORTHOSupersiteFebruari12005

4. DBKenneth.HarrisonPrincipleofInternalMedicine16 th edition.Chapter

312:Osteoartritis.McGrawHills2005.2036-2045

5. Subcommittee on Osteoarthritis Guidelines. Recommendations for the Medical Management of Osteoarthrits of the Hip and Knee. American

CollegeofRheumatologyJanuary29,2000

39